data_5URZ # _entry.id 5URZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5URZ WWPDB D_1000226421 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5URZ _pdbx_database_status.recvd_initial_deposition_date 2017-02-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mukund, S.' 1 ? 'Nile, A.H.' 2 ? 'Stanger, K.' 3 ? 'Hannoush, R.N.' 4 ? 'Wang, W.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 114 _citation.language ? _citation.page_first 4147 _citation.page_last 4152 _citation.title 'Unsaturated fatty acyl recognition by Frizzled receptors mediates dimerization upon Wnt ligand binding.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1618293114 _citation.pdbx_database_id_PubMed 28377511 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nile, A.H.' 1 ? primary 'Mukund, S.' 2 ? primary 'Stanger, K.' 3 ? primary 'Wang, W.' 4 ? primary 'Hannoush, R.N.' 5 ? # _cell.entry_id 5URZ _cell.length_a 123.051 _cell.length_b 123.051 _cell.length_c 46.870 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5URZ _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Frizzled-5 16769.109 2 ? ? ? ? 2 branched man 'alpha-L-fucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 513.490 1 ? ? ? ? 3 non-polymer man 'octyl beta-D-glucopyranoside' 292.369 1 ? ? ? ? 4 water nat water 18.015 97 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name hFz5,FzE5 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AHHHHHHGENLYFQGSKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTP ICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYERSEAGNS ; _entity_poly.pdbx_seq_one_letter_code_can ;AHHHHHHGENLYFQGSKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTP ICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYERSEAGNS ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 GLU n 1 10 ASN n 1 11 LEU n 1 12 TYR n 1 13 PHE n 1 14 GLN n 1 15 GLY n 1 16 SER n 1 17 LYS n 1 18 ALA n 1 19 PRO n 1 20 VAL n 1 21 CYS n 1 22 GLN n 1 23 GLU n 1 24 ILE n 1 25 THR n 1 26 VAL n 1 27 PRO n 1 28 MET n 1 29 CYS n 1 30 ARG n 1 31 GLY n 1 32 ILE n 1 33 GLY n 1 34 TYR n 1 35 ASN n 1 36 LEU n 1 37 THR n 1 38 HIS n 1 39 MET n 1 40 PRO n 1 41 ASN n 1 42 GLN n 1 43 PHE n 1 44 ASN n 1 45 HIS n 1 46 ASP n 1 47 THR n 1 48 GLN n 1 49 ASP n 1 50 GLU n 1 51 ALA n 1 52 GLY n 1 53 LEU n 1 54 GLU n 1 55 VAL n 1 56 HIS n 1 57 GLN n 1 58 PHE n 1 59 TRP n 1 60 PRO n 1 61 LEU n 1 62 VAL n 1 63 GLU n 1 64 ILE n 1 65 GLN n 1 66 CYS n 1 67 SER n 1 68 PRO n 1 69 ASP n 1 70 LEU n 1 71 ARG n 1 72 PHE n 1 73 PHE n 1 74 LEU n 1 75 CYS n 1 76 SER n 1 77 MET n 1 78 TYR n 1 79 THR n 1 80 PRO n 1 81 ILE n 1 82 CYS n 1 83 LEU n 1 84 PRO n 1 85 ASP n 1 86 TYR n 1 87 HIS n 1 88 LYS n 1 89 PRO n 1 90 LEU n 1 91 PRO n 1 92 PRO n 1 93 CYS n 1 94 ARG n 1 95 SER n 1 96 VAL n 1 97 CYS n 1 98 GLU n 1 99 ARG n 1 100 ALA n 1 101 LYS n 1 102 ALA n 1 103 GLY n 1 104 CYS n 1 105 SER n 1 106 PRO n 1 107 LEU n 1 108 MET n 1 109 ARG n 1 110 GLN n 1 111 TYR n 1 112 GLY n 1 113 PHE n 1 114 ALA n 1 115 TRP n 1 116 PRO n 1 117 GLU n 1 118 ARG n 1 119 MET n 1 120 SER n 1 121 CYS n 1 122 ASP n 1 123 ARG n 1 124 LEU n 1 125 PRO n 1 126 VAL n 1 127 LEU n 1 128 GLY n 1 129 ARG n 1 130 ASP n 1 131 ALA n 1 132 GLU n 1 133 VAL n 1 134 LEU n 1 135 CYS n 1 136 MET n 1 137 ASP n 1 138 TYR n 1 139 GLU n 1 140 ARG n 1 141 SER n 1 142 GLU n 1 143 ALA n 1 144 GLY n 1 145 ASN n 1 146 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 146 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FZD5, C2orf31' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Trichoplusia ni' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7111 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FZD5_HUMAN _struct_ref.pdbx_db_accession Q13467 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRS VCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEA ; _struct_ref.pdbx_align_begin 28 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5URZ A 16 ? 143 ? Q13467 28 ? 155 ? 3 130 2 1 5URZ B 16 ? 143 ? Q13467 28 ? 155 ? 3 130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5URZ ALA A 1 ? UNP Q13467 ? ? 'expression tag' -12 1 1 5URZ HIS A 2 ? UNP Q13467 ? ? 'expression tag' -11 2 1 5URZ HIS A 3 ? UNP Q13467 ? ? 'expression tag' -10 3 1 5URZ HIS A 4 ? UNP Q13467 ? ? 'expression tag' -9 4 1 5URZ HIS A 5 ? UNP Q13467 ? ? 'expression tag' -8 5 1 5URZ HIS A 6 ? UNP Q13467 ? ? 'expression tag' -7 6 1 5URZ HIS A 7 ? UNP Q13467 ? ? 'expression tag' -6 7 1 5URZ GLY A 8 ? UNP Q13467 ? ? 'expression tag' -5 8 1 5URZ GLU A 9 ? UNP Q13467 ? ? 'expression tag' -4 9 1 5URZ ASN A 10 ? UNP Q13467 ? ? 'expression tag' -3 10 1 5URZ LEU A 11 ? UNP Q13467 ? ? 'expression tag' -2 11 1 5URZ TYR A 12 ? UNP Q13467 ? ? 'expression tag' -1 12 1 5URZ PHE A 13 ? UNP Q13467 ? ? 'expression tag' 0 13 1 5URZ GLN A 14 ? UNP Q13467 ? ? 'expression tag' 1 14 1 5URZ GLY A 15 ? UNP Q13467 ? ? 'expression tag' 2 15 1 5URZ GLU A 139 ? UNP Q13467 ASN 151 conflict 126 16 1 5URZ GLY A 144 ? UNP Q13467 ? ? 'expression tag' 131 17 1 5URZ ASN A 145 ? UNP Q13467 ? ? 'expression tag' 132 18 1 5URZ SER A 146 ? UNP Q13467 ? ? 'expression tag' 133 19 2 5URZ ALA B 1 ? UNP Q13467 ? ? 'expression tag' -12 20 2 5URZ HIS B 2 ? UNP Q13467 ? ? 'expression tag' -11 21 2 5URZ HIS B 3 ? UNP Q13467 ? ? 'expression tag' -10 22 2 5URZ HIS B 4 ? UNP Q13467 ? ? 'expression tag' -9 23 2 5URZ HIS B 5 ? UNP Q13467 ? ? 'expression tag' -8 24 2 5URZ HIS B 6 ? UNP Q13467 ? ? 'expression tag' -7 25 2 5URZ HIS B 7 ? UNP Q13467 ? ? 'expression tag' -6 26 2 5URZ GLY B 8 ? UNP Q13467 ? ? 'expression tag' -5 27 2 5URZ GLU B 9 ? UNP Q13467 ? ? 'expression tag' -4 28 2 5URZ ASN B 10 ? UNP Q13467 ? ? 'expression tag' -3 29 2 5URZ LEU B 11 ? UNP Q13467 ? ? 'expression tag' -2 30 2 5URZ TYR B 12 ? UNP Q13467 ? ? 'expression tag' -1 31 2 5URZ PHE B 13 ? UNP Q13467 ? ? 'expression tag' 0 32 2 5URZ GLN B 14 ? UNP Q13467 ? ? 'expression tag' 1 33 2 5URZ GLY B 15 ? UNP Q13467 ? ? 'expression tag' 2 34 2 5URZ GLU B 139 ? UNP Q13467 ASN 151 conflict 126 35 2 5URZ GLY B 144 ? UNP Q13467 ? ? 'expression tag' 131 36 2 5URZ ASN B 145 ? UNP Q13467 ? ? 'expression tag' 132 37 2 5URZ SER B 146 ? UNP Q13467 ? ? 'expression tag' 133 38 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BOG D-saccharide n 'octyl beta-D-glucopyranoside' ? 'C14 H28 O6' 292.369 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose ? 'C6 H12 O5' 164.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5URZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M sodium citrate tribasic dehydrate pH 5.5, 22% polyethylene glycol 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-09-19 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.99999 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.99999 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5URZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.20 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20901 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5URZ _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 20889 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.556 _refine.ls_d_res_high 2.202 _refine.ls_percent_reflns_obs 99.94 _refine.ls_R_factor_obs 0.1818 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1796 _refine.ls_R_factor_R_free 0.2236 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.12 _refine.ls_number_reflns_R_free 1070 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.21 _refine.pdbx_overall_phase_error 21.76 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1910 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 54 _refine_hist.number_atoms_solvent 97 _refine_hist.number_atoms_total 2061 _refine_hist.d_res_high 2.202 _refine_hist.d_res_low 29.556 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.011 ? ? 2046 'X-RAY DIFFRACTION' ? f_angle_d 1.215 ? ? 2762 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.788 ? ? 792 'X-RAY DIFFRACTION' ? f_chiral_restr 0.045 ? ? 298 'X-RAY DIFFRACTION' ? f_plane_restr 0.006 ? ? 356 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.2017 2.3019 2434 0.2205 100.00 0.2425 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.3019 2.4232 2443 0.1979 100.00 0.2491 . . 131 . . . . 'X-RAY DIFFRACTION' . 2.4232 2.5749 2463 0.1897 100.00 0.2307 . . 138 . . . . 'X-RAY DIFFRACTION' . 2.5749 2.7736 2444 0.1982 100.00 0.2552 . . 144 . . . . 'X-RAY DIFFRACTION' . 2.7736 3.0524 2476 0.2043 100.00 0.2444 . . 118 . . . . 'X-RAY DIFFRACTION' . 3.0524 3.4935 2471 0.1881 100.00 0.2729 . . 136 . . . . 'X-RAY DIFFRACTION' . 3.4935 4.3991 2524 0.1592 100.00 0.1706 . . 123 . . . . 'X-RAY DIFFRACTION' . 4.3991 29.5585 2564 0.1702 100.00 0.2181 . . 139 . . . . # _struct.entry_id 5URZ _struct.title 'Crystal structure of Frizzled 5 CRD in complex with BOG' _struct.pdbx_descriptor Frizzled-5 _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5URZ _struct_keywords.text 'Frizzled 5, CRD, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 26 ? ARG A 30 ? VAL A 13 ARG A 17 5 ? 5 HELX_P HELX_P2 AA2 THR A 47 ? HIS A 56 ? THR A 34 HIS A 43 1 ? 10 HELX_P HELX_P3 AA3 PHE A 58 ? ILE A 64 ? PHE A 45 ILE A 51 1 ? 7 HELX_P HELX_P4 AA4 ASP A 69 ? THR A 79 ? ASP A 56 THR A 66 1 ? 11 HELX_P HELX_P5 AA5 CYS A 93 ? TYR A 111 ? CYS A 80 TYR A 98 1 ? 19 HELX_P HELX_P6 AA6 PRO A 116 ? LEU A 124 ? PRO A 103 LEU A 111 5 ? 9 HELX_P HELX_P7 AA7 VAL B 26 ? ARG B 30 ? VAL B 13 ARG B 17 5 ? 5 HELX_P HELX_P8 AA8 THR B 47 ? HIS B 56 ? THR B 34 HIS B 43 1 ? 10 HELX_P HELX_P9 AA9 PHE B 58 ? GLN B 65 ? PHE B 45 GLN B 52 1 ? 8 HELX_P HELX_P10 AB1 ASP B 69 ? THR B 79 ? ASP B 56 THR B 66 1 ? 11 HELX_P HELX_P11 AB2 CYS B 93 ? TYR B 111 ? CYS B 80 TYR B 98 1 ? 19 HELX_P HELX_P12 AB3 PRO B 116 ? LEU B 124 ? PRO B 103 LEU B 111 5 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 82 SG ? ? A CYS 8 A CYS 69 1_555 ? ? ? ? ? ? ? 2.047 ? ? disulf2 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 16 A CYS 62 1_555 ? ? ? ? ? ? ? 2.043 ? ? disulf3 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 104 SG ? ? A CYS 53 A CYS 91 1_555 ? ? ? ? ? ? ? 2.047 ? ? disulf4 disulf ? ? A CYS 93 SG ? ? ? 1_555 A CYS 135 SG ? ? A CYS 80 A CYS 122 1_555 ? ? ? ? ? ? ? 2.046 ? ? disulf5 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 121 SG ? ? A CYS 84 A CYS 108 1_555 ? ? ? ? ? ? ? 2.049 ? ? disulf6 disulf ? ? B CYS 21 SG ? ? ? 1_555 B CYS 82 SG ? ? B CYS 8 B CYS 69 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf7 disulf ? ? B CYS 29 SG ? ? ? 1_555 B CYS 75 SG ? ? B CYS 16 B CYS 62 1_555 ? ? ? ? ? ? ? 2.063 ? ? disulf8 disulf ? ? B CYS 66 SG ? ? ? 1_555 B CYS 104 SG ? ? B CYS 53 B CYS 91 1_555 ? ? ? ? ? ? ? 2.077 ? ? disulf9 disulf ? ? B CYS 93 SG ? ? ? 1_555 B CYS 135 SG ? ? B CYS 80 B CYS 122 1_555 ? ? ? ? ? ? ? 2.045 ? ? disulf10 disulf ? ? B CYS 97 SG ? ? ? 1_555 B CYS 121 SG ? ? B CYS 84 B CYS 108 1_555 ? ? ? ? ? ? ? 2.041 ? ? covale1 covale one ? A ASN 35 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 22 C NAG 1 1_555 ? ? ? ? ? ? ? 1.283 ? N-Glycosylation covale2 covale both ? C NAG . O4 ? ? ? 1_555 C FUC . C1 ? ? C NAG 1 C FUC 2 1_555 ? ? ? ? ? ? ? 1.468 ? ? covale3 covale one ? C NAG . O6 ? ? ? 1_555 C FUC . C1 ? ? C NAG 1 C FUC 3 1_555 ? ? ? ? ? ? ? 1.451 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 MET 39 A . ? MET 26 A PRO 40 A ? PRO 27 A 1 1.39 2 MET 39 B . ? MET 26 B PRO 40 B ? PRO 27 B 1 1.45 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 22 ? GLU A 23 ? GLN A 9 GLU A 10 AA1 2 LEU A 36 ? THR A 37 ? LEU A 23 THR A 24 AA2 1 GLN B 22 ? GLU B 23 ? GLN B 9 GLU B 10 AA2 2 LEU B 36 ? THR B 37 ? LEU B 23 THR B 24 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 22 ? N GLN A 9 O THR A 37 ? O THR A 24 AA2 1 2 N GLN B 22 ? N GLN B 9 O THR B 37 ? O THR B 24 # _atom_sites.entry_id 5URZ _atom_sites.fract_transf_matrix[1][1] 0.008127 _atom_sites.fract_transf_matrix[1][2] 0.004692 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009384 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021336 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -12 ? ? ? A . n A 1 2 HIS 2 -11 ? ? ? A . n A 1 3 HIS 3 -10 ? ? ? A . n A 1 4 HIS 4 -9 ? ? ? A . n A 1 5 HIS 5 -8 ? ? ? A . n A 1 6 HIS 6 -7 ? ? ? A . n A 1 7 HIS 7 -6 ? ? ? A . n A 1 8 GLY 8 -5 ? ? ? A . n A 1 9 GLU 9 -4 ? ? ? A . n A 1 10 ASN 10 -3 ? ? ? A . n A 1 11 LEU 11 -2 ? ? ? A . n A 1 12 TYR 12 -1 ? ? ? A . n A 1 13 PHE 13 0 ? ? ? A . n A 1 14 GLN 14 1 ? ? ? A . n A 1 15 GLY 15 2 ? ? ? A . n A 1 16 SER 16 3 ? ? ? A . n A 1 17 LYS 17 4 ? ? ? A . n A 1 18 ALA 18 5 ? ? ? A . n A 1 19 PRO 19 6 ? ? ? A . n A 1 20 VAL 20 7 7 VAL VAL A . n A 1 21 CYS 21 8 8 CYS CYS A . n A 1 22 GLN 22 9 9 GLN GLN A . n A 1 23 GLU 23 10 10 GLU GLU A . n A 1 24 ILE 24 11 11 ILE ILE A . n A 1 25 THR 25 12 12 THR THR A . n A 1 26 VAL 26 13 13 VAL VAL A . n A 1 27 PRO 27 14 14 PRO PRO A . n A 1 28 MET 28 15 15 MET MET A . n A 1 29 CYS 29 16 16 CYS CYS A . n A 1 30 ARG 30 17 17 ARG ARG A . n A 1 31 GLY 31 18 18 GLY GLY A . n A 1 32 ILE 32 19 19 ILE ILE A . n A 1 33 GLY 33 20 20 GLY GLY A . n A 1 34 TYR 34 21 21 TYR TYR A . n A 1 35 ASN 35 22 22 ASN ASN A . n A 1 36 LEU 36 23 23 LEU LEU A . n A 1 37 THR 37 24 24 THR THR A . n A 1 38 HIS 38 25 25 HIS HIS A . n A 1 39 MET 39 26 26 MET MET A . n A 1 40 PRO 40 27 27 PRO PRO A . n A 1 41 ASN 41 28 28 ASN ASN A . n A 1 42 GLN 42 29 29 GLN GLN A . n A 1 43 PHE 43 30 30 PHE PHE A . n A 1 44 ASN 44 31 31 ASN ASN A . n A 1 45 HIS 45 32 32 HIS HIS A . n A 1 46 ASP 46 33 33 ASP ASP A . n A 1 47 THR 47 34 34 THR THR A . n A 1 48 GLN 48 35 35 GLN GLN A . n A 1 49 ASP 49 36 36 ASP ASP A . n A 1 50 GLU 50 37 37 GLU GLU A . n A 1 51 ALA 51 38 38 ALA ALA A . n A 1 52 GLY 52 39 39 GLY GLY A . n A 1 53 LEU 53 40 40 LEU LEU A . n A 1 54 GLU 54 41 41 GLU GLU A . n A 1 55 VAL 55 42 42 VAL VAL A . n A 1 56 HIS 56 43 43 HIS HIS A . n A 1 57 GLN 57 44 44 GLN GLN A . n A 1 58 PHE 58 45 45 PHE PHE A . n A 1 59 TRP 59 46 46 TRP TRP A . n A 1 60 PRO 60 47 47 PRO PRO A . n A 1 61 LEU 61 48 48 LEU LEU A . n A 1 62 VAL 62 49 49 VAL VAL A . n A 1 63 GLU 63 50 50 GLU GLU A . n A 1 64 ILE 64 51 51 ILE ILE A . n A 1 65 GLN 65 52 52 GLN GLN A . n A 1 66 CYS 66 53 53 CYS CYS A . n A 1 67 SER 67 54 54 SER SER A . n A 1 68 PRO 68 55 55 PRO PRO A . n A 1 69 ASP 69 56 56 ASP ASP A . n A 1 70 LEU 70 57 57 LEU LEU A . n A 1 71 ARG 71 58 58 ARG ARG A . n A 1 72 PHE 72 59 59 PHE PHE A . n A 1 73 PHE 73 60 60 PHE PHE A . n A 1 74 LEU 74 61 61 LEU LEU A . n A 1 75 CYS 75 62 62 CYS CYS A . n A 1 76 SER 76 63 63 SER SER A . n A 1 77 MET 77 64 64 MET MET A . n A 1 78 TYR 78 65 65 TYR TYR A . n A 1 79 THR 79 66 66 THR THR A . n A 1 80 PRO 80 67 67 PRO PRO A . n A 1 81 ILE 81 68 68 ILE ILE A . n A 1 82 CYS 82 69 69 CYS CYS A . n A 1 83 LEU 83 70 70 LEU LEU A . n A 1 84 PRO 84 71 71 PRO PRO A . n A 1 85 ASP 85 72 72 ASP ASP A . n A 1 86 TYR 86 73 73 TYR TYR A . n A 1 87 HIS 87 74 74 HIS HIS A . n A 1 88 LYS 88 75 75 LYS LYS A . n A 1 89 PRO 89 76 76 PRO PRO A . n A 1 90 LEU 90 77 77 LEU LEU A . n A 1 91 PRO 91 78 78 PRO PRO A . n A 1 92 PRO 92 79 79 PRO PRO A . n A 1 93 CYS 93 80 80 CYS CYS A . n A 1 94 ARG 94 81 81 ARG ARG A . n A 1 95 SER 95 82 82 SER SER A . n A 1 96 VAL 96 83 83 VAL VAL A . n A 1 97 CYS 97 84 84 CYS CYS A . n A 1 98 GLU 98 85 85 GLU GLU A . n A 1 99 ARG 99 86 86 ARG ARG A . n A 1 100 ALA 100 87 87 ALA ALA A . n A 1 101 LYS 101 88 88 LYS LYS A . n A 1 102 ALA 102 89 89 ALA ALA A . n A 1 103 GLY 103 90 90 GLY GLY A . n A 1 104 CYS 104 91 91 CYS CYS A . n A 1 105 SER 105 92 92 SER SER A . n A 1 106 PRO 106 93 93 PRO PRO A . n A 1 107 LEU 107 94 94 LEU LEU A . n A 1 108 MET 108 95 95 MET MET A . n A 1 109 ARG 109 96 96 ARG ARG A . n A 1 110 GLN 110 97 97 GLN GLN A . n A 1 111 TYR 111 98 98 TYR TYR A . n A 1 112 GLY 112 99 99 GLY GLY A . n A 1 113 PHE 113 100 100 PHE PHE A . n A 1 114 ALA 114 101 101 ALA ALA A . n A 1 115 TRP 115 102 102 TRP TRP A . n A 1 116 PRO 116 103 103 PRO PRO A . n A 1 117 GLU 117 104 104 GLU GLU A . n A 1 118 ARG 118 105 105 ARG ARG A . n A 1 119 MET 119 106 106 MET MET A . n A 1 120 SER 120 107 107 SER SER A . n A 1 121 CYS 121 108 108 CYS CYS A . n A 1 122 ASP 122 109 109 ASP ASP A . n A 1 123 ARG 123 110 110 ARG ARG A . n A 1 124 LEU 124 111 111 LEU LEU A . n A 1 125 PRO 125 112 112 PRO PRO A . n A 1 126 VAL 126 113 113 VAL VAL A . n A 1 127 LEU 127 114 114 LEU LEU A . n A 1 128 GLY 128 115 115 GLY GLY A . n A 1 129 ARG 129 116 116 ARG ARG A . n A 1 130 ASP 130 117 117 ASP ASP A . n A 1 131 ALA 131 118 118 ALA ALA A . n A 1 132 GLU 132 119 119 GLU GLU A . n A 1 133 VAL 133 120 120 VAL VAL A . n A 1 134 LEU 134 121 121 LEU LEU A . n A 1 135 CYS 135 122 122 CYS CYS A . n A 1 136 MET 136 123 123 MET MET A . n A 1 137 ASP 137 124 124 ASP ASP A . n A 1 138 TYR 138 125 125 TYR TYR A . n A 1 139 GLU 139 126 ? ? ? A . n A 1 140 ARG 140 127 ? ? ? A . n A 1 141 SER 141 128 ? ? ? A . n A 1 142 GLU 142 129 ? ? ? A . n A 1 143 ALA 143 130 ? ? ? A . n A 1 144 GLY 144 131 ? ? ? A . n A 1 145 ASN 145 132 ? ? ? A . n A 1 146 SER 146 133 ? ? ? A . n B 1 1 ALA 1 -12 ? ? ? B . n B 1 2 HIS 2 -11 ? ? ? B . n B 1 3 HIS 3 -10 ? ? ? B . n B 1 4 HIS 4 -9 ? ? ? B . n B 1 5 HIS 5 -8 ? ? ? B . n B 1 6 HIS 6 -7 ? ? ? B . n B 1 7 HIS 7 -6 ? ? ? B . n B 1 8 GLY 8 -5 ? ? ? B . n B 1 9 GLU 9 -4 ? ? ? B . n B 1 10 ASN 10 -3 ? ? ? B . n B 1 11 LEU 11 -2 ? ? ? B . n B 1 12 TYR 12 -1 ? ? ? B . n B 1 13 PHE 13 0 ? ? ? B . n B 1 14 GLN 14 1 ? ? ? B . n B 1 15 GLY 15 2 ? ? ? B . n B 1 16 SER 16 3 ? ? ? B . n B 1 17 LYS 17 4 ? ? ? B . n B 1 18 ALA 18 5 ? ? ? B . n B 1 19 PRO 19 6 ? ? ? B . n B 1 20 VAL 20 7 ? ? ? B . n B 1 21 CYS 21 8 8 CYS CYS B . n B 1 22 GLN 22 9 9 GLN GLN B . n B 1 23 GLU 23 10 10 GLU GLU B . n B 1 24 ILE 24 11 11 ILE ILE B . n B 1 25 THR 25 12 12 THR THR B . n B 1 26 VAL 26 13 13 VAL VAL B . n B 1 27 PRO 27 14 14 PRO PRO B . n B 1 28 MET 28 15 15 MET MET B . n B 1 29 CYS 29 16 16 CYS CYS B . n B 1 30 ARG 30 17 17 ARG ARG B . n B 1 31 GLY 31 18 18 GLY GLY B . n B 1 32 ILE 32 19 19 ILE ILE B . n B 1 33 GLY 33 20 20 GLY GLY B . n B 1 34 TYR 34 21 21 TYR TYR B . n B 1 35 ASN 35 22 22 ASN ASN B . n B 1 36 LEU 36 23 23 LEU LEU B . n B 1 37 THR 37 24 24 THR THR B . n B 1 38 HIS 38 25 25 HIS HIS B . n B 1 39 MET 39 26 26 MET MET B . n B 1 40 PRO 40 27 27 PRO PRO B . n B 1 41 ASN 41 28 28 ASN ASN B . n B 1 42 GLN 42 29 29 GLN GLN B . n B 1 43 PHE 43 30 30 PHE PHE B . n B 1 44 ASN 44 31 31 ASN ASN B . n B 1 45 HIS 45 32 32 HIS HIS B . n B 1 46 ASP 46 33 33 ASP ASP B . n B 1 47 THR 47 34 34 THR THR B . n B 1 48 GLN 48 35 35 GLN GLN B . n B 1 49 ASP 49 36 36 ASP ASP B . n B 1 50 GLU 50 37 37 GLU GLU B . n B 1 51 ALA 51 38 38 ALA ALA B . n B 1 52 GLY 52 39 39 GLY GLY B . n B 1 53 LEU 53 40 40 LEU LEU B . n B 1 54 GLU 54 41 41 GLU GLU B . n B 1 55 VAL 55 42 42 VAL VAL B . n B 1 56 HIS 56 43 43 HIS HIS B . n B 1 57 GLN 57 44 44 GLN GLN B . n B 1 58 PHE 58 45 45 PHE PHE B . n B 1 59 TRP 59 46 46 TRP TRP B . n B 1 60 PRO 60 47 47 PRO PRO B . n B 1 61 LEU 61 48 48 LEU LEU B . n B 1 62 VAL 62 49 49 VAL VAL B . n B 1 63 GLU 63 50 50 GLU GLU B . n B 1 64 ILE 64 51 51 ILE ILE B . n B 1 65 GLN 65 52 52 GLN GLN B . n B 1 66 CYS 66 53 53 CYS CYS B . n B 1 67 SER 67 54 54 SER SER B . n B 1 68 PRO 68 55 55 PRO PRO B . n B 1 69 ASP 69 56 56 ASP ASP B . n B 1 70 LEU 70 57 57 LEU LEU B . n B 1 71 ARG 71 58 58 ARG ARG B . n B 1 72 PHE 72 59 59 PHE PHE B . n B 1 73 PHE 73 60 60 PHE PHE B . n B 1 74 LEU 74 61 61 LEU LEU B . n B 1 75 CYS 75 62 62 CYS CYS B . n B 1 76 SER 76 63 63 SER SER B . n B 1 77 MET 77 64 64 MET MET B . n B 1 78 TYR 78 65 65 TYR TYR B . n B 1 79 THR 79 66 66 THR THR B . n B 1 80 PRO 80 67 67 PRO PRO B . n B 1 81 ILE 81 68 68 ILE ILE B . n B 1 82 CYS 82 69 69 CYS CYS B . n B 1 83 LEU 83 70 70 LEU LEU B . n B 1 84 PRO 84 71 71 PRO PRO B . n B 1 85 ASP 85 72 72 ASP ASP B . n B 1 86 TYR 86 73 73 TYR TYR B . n B 1 87 HIS 87 74 74 HIS HIS B . n B 1 88 LYS 88 75 75 LYS LYS B . n B 1 89 PRO 89 76 76 PRO PRO B . n B 1 90 LEU 90 77 77 LEU LEU B . n B 1 91 PRO 91 78 78 PRO PRO B . n B 1 92 PRO 92 79 79 PRO PRO B . n B 1 93 CYS 93 80 80 CYS CYS B . n B 1 94 ARG 94 81 81 ARG ARG B . n B 1 95 SER 95 82 82 SER SER B . n B 1 96 VAL 96 83 83 VAL VAL B . n B 1 97 CYS 97 84 84 CYS CYS B . n B 1 98 GLU 98 85 85 GLU GLU B . n B 1 99 ARG 99 86 86 ARG ARG B . n B 1 100 ALA 100 87 87 ALA ALA B . n B 1 101 LYS 101 88 88 LYS LYS B . n B 1 102 ALA 102 89 89 ALA ALA B . n B 1 103 GLY 103 90 90 GLY GLY B . n B 1 104 CYS 104 91 91 CYS CYS B . n B 1 105 SER 105 92 92 SER SER B . n B 1 106 PRO 106 93 93 PRO PRO B . n B 1 107 LEU 107 94 94 LEU LEU B . n B 1 108 MET 108 95 95 MET MET B . n B 1 109 ARG 109 96 96 ARG ARG B . n B 1 110 GLN 110 97 97 GLN GLN B . n B 1 111 TYR 111 98 98 TYR TYR B . n B 1 112 GLY 112 99 99 GLY GLY B . n B 1 113 PHE 113 100 100 PHE PHE B . n B 1 114 ALA 114 101 101 ALA ALA B . n B 1 115 TRP 115 102 102 TRP TRP B . n B 1 116 PRO 116 103 103 PRO PRO B . n B 1 117 GLU 117 104 104 GLU GLU B . n B 1 118 ARG 118 105 105 ARG ARG B . n B 1 119 MET 119 106 106 MET MET B . n B 1 120 SER 120 107 107 SER SER B . n B 1 121 CYS 121 108 108 CYS CYS B . n B 1 122 ASP 122 109 109 ASP ASP B . n B 1 123 ARG 123 110 110 ARG ARG B . n B 1 124 LEU 124 111 111 LEU LEU B . n B 1 125 PRO 125 112 112 PRO PRO B . n B 1 126 VAL 126 113 113 VAL VAL B . n B 1 127 LEU 127 114 114 LEU LEU B . n B 1 128 GLY 128 115 115 GLY GLY B . n B 1 129 ARG 129 116 116 ARG ARG B . n B 1 130 ASP 130 117 117 ASP ASP B . n B 1 131 ALA 131 118 118 ALA ALA B . n B 1 132 GLU 132 119 119 GLU GLU B . n B 1 133 VAL 133 120 120 VAL VAL B . n B 1 134 LEU 134 121 121 LEU LEU B . n B 1 135 CYS 135 122 122 CYS CYS B . n B 1 136 MET 136 123 123 MET MET B . n B 1 137 ASP 137 124 124 ASP ASP B . n B 1 138 TYR 138 125 125 TYR TYR B . n B 1 139 GLU 139 126 126 GLU GLU B . n B 1 140 ARG 140 127 ? ? ? B . n B 1 141 SER 141 128 ? ? ? B . n B 1 142 GLU 142 129 ? ? ? B . n B 1 143 ALA 143 130 ? ? ? B . n B 1 144 GLY 144 131 ? ? ? B . n B 1 145 ASN 145 132 ? ? ? B . n B 1 146 SER 146 133 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 BOG 1 201 1 BOG BOG B . E 4 HOH 1 301 93 HOH HOH A . E 4 HOH 2 302 72 HOH HOH A . E 4 HOH 3 303 34 HOH HOH A . E 4 HOH 4 304 43 HOH HOH A . E 4 HOH 5 305 22 HOH HOH A . E 4 HOH 6 306 17 HOH HOH A . E 4 HOH 7 307 63 HOH HOH A . E 4 HOH 8 308 49 HOH HOH A . E 4 HOH 9 309 41 HOH HOH A . E 4 HOH 10 310 19 HOH HOH A . E 4 HOH 11 311 36 HOH HOH A . E 4 HOH 12 312 23 HOH HOH A . E 4 HOH 13 313 70 HOH HOH A . E 4 HOH 14 314 27 HOH HOH A . E 4 HOH 15 315 55 HOH HOH A . E 4 HOH 16 316 38 HOH HOH A . E 4 HOH 17 317 94 HOH HOH A . E 4 HOH 18 318 8 HOH HOH A . E 4 HOH 19 319 31 HOH HOH A . E 4 HOH 20 320 33 HOH HOH A . E 4 HOH 21 321 18 HOH HOH A . E 4 HOH 22 322 48 HOH HOH A . E 4 HOH 23 323 6 HOH HOH A . E 4 HOH 24 324 86 HOH HOH A . E 4 HOH 25 325 57 HOH HOH A . E 4 HOH 26 326 13 HOH HOH A . E 4 HOH 27 327 1 HOH HOH A . E 4 HOH 28 328 67 HOH HOH A . E 4 HOH 29 329 40 HOH HOH A . E 4 HOH 30 330 64 HOH HOH A . E 4 HOH 31 331 89 HOH HOH A . E 4 HOH 32 332 9 HOH HOH A . E 4 HOH 33 333 7 HOH HOH A . E 4 HOH 34 334 24 HOH HOH A . E 4 HOH 35 335 12 HOH HOH A . E 4 HOH 36 336 14 HOH HOH A . E 4 HOH 37 337 80 HOH HOH A . E 4 HOH 38 338 75 HOH HOH A . E 4 HOH 39 339 52 HOH HOH A . E 4 HOH 40 340 11 HOH HOH A . E 4 HOH 41 341 62 HOH HOH A . E 4 HOH 42 342 35 HOH HOH A . E 4 HOH 43 343 73 HOH HOH A . E 4 HOH 44 344 25 HOH HOH A . E 4 HOH 45 345 76 HOH HOH A . E 4 HOH 46 346 15 HOH HOH A . E 4 HOH 47 347 51 HOH HOH A . E 4 HOH 48 348 3 HOH HOH A . E 4 HOH 49 349 97 HOH HOH A . E 4 HOH 50 350 74 HOH HOH A . E 4 HOH 51 351 88 HOH HOH A . E 4 HOH 52 352 69 HOH HOH A . E 4 HOH 53 353 32 HOH HOH A . E 4 HOH 54 354 83 HOH HOH A . E 4 HOH 55 355 66 HOH HOH A . E 4 HOH 56 356 4 HOH HOH A . E 4 HOH 57 357 87 HOH HOH A . E 4 HOH 58 358 91 HOH HOH A . E 4 HOH 59 359 60 HOH HOH A . E 4 HOH 60 360 85 HOH HOH A . E 4 HOH 61 361 90 HOH HOH A . E 4 HOH 62 362 58 HOH HOH A . F 4 HOH 1 301 79 HOH HOH B . F 4 HOH 2 302 59 HOH HOH B . F 4 HOH 3 303 65 HOH HOH B . F 4 HOH 4 304 39 HOH HOH B . F 4 HOH 5 305 53 HOH HOH B . F 4 HOH 6 306 5 HOH HOH B . F 4 HOH 7 307 20 HOH HOH B . F 4 HOH 8 308 44 HOH HOH B . F 4 HOH 9 309 16 HOH HOH B . F 4 HOH 10 310 50 HOH HOH B . F 4 HOH 11 311 30 HOH HOH B . F 4 HOH 12 312 28 HOH HOH B . F 4 HOH 13 313 46 HOH HOH B . F 4 HOH 14 314 71 HOH HOH B . F 4 HOH 15 315 68 HOH HOH B . F 4 HOH 16 316 29 HOH HOH B . F 4 HOH 17 317 2 HOH HOH B . F 4 HOH 18 318 77 HOH HOH B . F 4 HOH 19 319 10 HOH HOH B . F 4 HOH 20 320 21 HOH HOH B . F 4 HOH 21 321 84 HOH HOH B . F 4 HOH 22 322 45 HOH HOH B . F 4 HOH 23 323 95 HOH HOH B . F 4 HOH 24 324 47 HOH HOH B . F 4 HOH 25 325 61 HOH HOH B . F 4 HOH 26 326 37 HOH HOH B . F 4 HOH 27 327 54 HOH HOH B . F 4 HOH 28 328 42 HOH HOH B . F 4 HOH 29 329 56 HOH HOH B . F 4 HOH 30 330 26 HOH HOH B . F 4 HOH 31 331 81 HOH HOH B . F 4 HOH 32 332 82 HOH HOH B . F 4 HOH 33 333 78 HOH HOH B . F 4 HOH 34 334 96 HOH HOH B . F 4 HOH 35 335 92 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 362 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-05-10 2 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Derived calculations' 5 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' atom_site_anisotrop 3 2 'Structure model' chem_comp 4 2 'Structure model' entity 5 2 'Structure model' pdbx_branch_scheme 6 2 'Structure model' pdbx_chem_comp_identifier 7 2 'Structure model' pdbx_entity_branch 8 2 'Structure model' pdbx_entity_branch_descriptor 9 2 'Structure model' pdbx_entity_branch_link 10 2 'Structure model' pdbx_entity_branch_list 11 2 'Structure model' pdbx_entity_nonpoly 12 2 'Structure model' pdbx_nonpoly_scheme 13 2 'Structure model' pdbx_struct_assembly_gen 14 2 'Structure model' pdbx_struct_special_symmetry 15 2 'Structure model' pdbx_validate_close_contact 16 2 'Structure model' struct_asym 17 2 'Structure model' struct_conn 18 2 'Structure model' struct_site 19 2 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.auth_asym_id' 6 2 'Structure model' '_atom_site.auth_seq_id' 7 2 'Structure model' '_atom_site.label_asym_id' 8 2 'Structure model' '_atom_site.label_entity_id' 9 2 'Structure model' '_atom_site_anisotrop.U[1][1]' 10 2 'Structure model' '_atom_site_anisotrop.U[1][2]' 11 2 'Structure model' '_atom_site_anisotrop.U[1][3]' 12 2 'Structure model' '_atom_site_anisotrop.U[2][2]' 13 2 'Structure model' '_atom_site_anisotrop.U[2][3]' 14 2 'Structure model' '_atom_site_anisotrop.U[3][3]' 15 2 'Structure model' '_atom_site_anisotrop.pdbx_auth_asym_id' 16 2 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 17 2 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id' 18 2 'Structure model' '_chem_comp.mon_nstd_flag' 19 2 'Structure model' '_chem_comp.name' 20 2 'Structure model' '_chem_comp.type' 21 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 22 2 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 23 2 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 24 2 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 25 2 'Structure model' '_struct_conn.pdbx_role' 26 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 27 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 29 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -38.5823 45.7349 -7.7263 0.3206 0.3992 0.2926 -0.1070 -0.0268 -0.0319 0.4906 0.7012 1.7167 0.1265 -0.1906 0.9608 0.0838 0.1737 -0.1438 -0.1080 -0.0885 -0.0069 0.2579 -0.1599 0.0003 'X-RAY DIFFRACTION' 2 ? refined -53.0036 62.9800 10.7878 0.2370 0.4465 0.4051 -0.0156 0.0108 -0.0182 1.4908 1.3807 0.8351 1.0340 0.1163 -0.4095 -0.0845 -0.3197 0.2932 0.0413 0.1288 0.2895 -0.0799 -0.1745 -0.0000 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'chain A' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'chain B' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 ND2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 22 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O5 _pdbx_validate_close_contact.auth_asym_id_2 C _pdbx_validate_close_contact.auth_comp_id_2 NAG _pdbx_validate_close_contact.auth_seq_id_2 1 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 77 ? ? -117.70 73.20 2 1 ASP B 72 ? ? 76.30 -16.16 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA -12 ? A ALA 1 2 1 Y 1 A HIS -11 ? A HIS 2 3 1 Y 1 A HIS -10 ? A HIS 3 4 1 Y 1 A HIS -9 ? A HIS 4 5 1 Y 1 A HIS -8 ? A HIS 5 6 1 Y 1 A HIS -7 ? A HIS 6 7 1 Y 1 A HIS -6 ? A HIS 7 8 1 Y 1 A GLY -5 ? A GLY 8 9 1 Y 1 A GLU -4 ? A GLU 9 10 1 Y 1 A ASN -3 ? A ASN 10 11 1 Y 1 A LEU -2 ? A LEU 11 12 1 Y 1 A TYR -1 ? A TYR 12 13 1 Y 1 A PHE 0 ? A PHE 13 14 1 Y 1 A GLN 1 ? A GLN 14 15 1 Y 1 A GLY 2 ? A GLY 15 16 1 Y 1 A SER 3 ? A SER 16 17 1 Y 1 A LYS 4 ? A LYS 17 18 1 Y 1 A ALA 5 ? A ALA 18 19 1 Y 1 A PRO 6 ? A PRO 19 20 1 Y 1 A GLU 126 ? A GLU 139 21 1 Y 1 A ARG 127 ? A ARG 140 22 1 Y 1 A SER 128 ? A SER 141 23 1 Y 1 A GLU 129 ? A GLU 142 24 1 Y 1 A ALA 130 ? A ALA 143 25 1 Y 1 A GLY 131 ? A GLY 144 26 1 Y 1 A ASN 132 ? A ASN 145 27 1 Y 1 A SER 133 ? A SER 146 28 1 Y 1 B ALA -12 ? B ALA 1 29 1 Y 1 B HIS -11 ? B HIS 2 30 1 Y 1 B HIS -10 ? B HIS 3 31 1 Y 1 B HIS -9 ? B HIS 4 32 1 Y 1 B HIS -8 ? B HIS 5 33 1 Y 1 B HIS -7 ? B HIS 6 34 1 Y 1 B HIS -6 ? B HIS 7 35 1 Y 1 B GLY -5 ? B GLY 8 36 1 Y 1 B GLU -4 ? B GLU 9 37 1 Y 1 B ASN -3 ? B ASN 10 38 1 Y 1 B LEU -2 ? B LEU 11 39 1 Y 1 B TYR -1 ? B TYR 12 40 1 Y 1 B PHE 0 ? B PHE 13 41 1 Y 1 B GLN 1 ? B GLN 14 42 1 Y 1 B GLY 2 ? B GLY 15 43 1 Y 1 B SER 3 ? B SER 16 44 1 Y 1 B LYS 4 ? B LYS 17 45 1 Y 1 B ALA 5 ? B ALA 18 46 1 Y 1 B PRO 6 ? B PRO 19 47 1 Y 1 B VAL 7 ? B VAL 20 48 1 Y 1 B ARG 127 ? B ARG 140 49 1 Y 1 B SER 128 ? B SER 141 50 1 Y 1 B GLU 129 ? B GLU 142 51 1 Y 1 B ALA 130 ? B ALA 143 52 1 Y 1 B GLY 131 ? B GLY 144 53 1 Y 1 B ASN 132 ? B ASN 145 54 1 Y 1 B SER 133 ? B SER 146 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero C 2 NAG 1 C NAG 1 L NAG 2 n C 2 FUC 2 C FUC 2 L FUC 4 n C 2 FUC 3 C FUC 3 L FUC 3 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BOG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-octylglucoside FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 LFucpa FUC 'COMMON NAME' GMML 1.0 a-L-fucopyranose FUC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-Fucp FUC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fuc NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'LFucpa1-4[LFucpa1-6]DGlcpNAcb1-' 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-2-2/a4-b1_a6-c1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-L-Fucp]{}[(6+1)][a-L-Fucp]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 FUC C1 O1 1 NAG O4 HO4 sing ? 2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 FUC 2 n 2 FUC 3 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'octyl beta-D-glucopyranoside' BOG 4 water HOH #