data_5USS # _entry.id 5USS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5USS WWPDB D_1000226445 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5USP unspecified PDB . 5USV unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5USS _pdbx_database_status.recvd_initial_deposition_date 2017-02-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lieblich, S.A.' 1 ? 'Fang, K.Y.' 2 ? 'Tirrell, D.A.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Insulin with proline analog PiP at position B28 in the R6 state' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lieblich, S.A.' 1 ? primary 'Fang, K.Y.' 2 ? primary 'Tirrell, D.A.' 3 ? # _cell.length_a 79.024 _cell.length_b 79.024 _cell.length_c 39.509 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 5USS _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'H 3' _symmetry.entry_id 5USS _symmetry.Int_Tables_number 146 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Insulin Chain A' 2383.698 2 ? ? ? ? 2 polymer man 'Insulin Chain B' 3447.980 2 ? ? ? ? 3 non-polymer syn PHENOL 94.111 2 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 6 water nat water 18.015 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN A,C ? 2 'polypeptide(L)' no yes 'FVNQHLCGSHLVEALYLVCGERGFFYT(YCP)KT' FVNQHLCGSHLVEALYLVCGERGFFYTXKT B,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 HIS n 2 11 LEU n 2 12 VAL n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 PHE n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 YCP n 2 29 LYS n 2 30 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 21 Human ? INS ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 30 Human ? INS ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP INS_HUMAN P01308 ? 1 GIVEQCCTSICSLYQLENYCN 90 2 UNP INS_HUMAN P01308 ? 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5USS A 1 ? 21 ? P01308 90 ? 110 ? 1 21 2 2 5USS B 1 ? 30 ? P01308 25 ? 54 ? 1 30 3 1 5USS C 1 ? 21 ? P01308 90 ? 110 ? 1 21 4 2 5USS D 1 ? 30 ? P01308 25 ? 54 ? 1 30 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPH non-polymer . PHENOL ? 'C6 H6 O' 94.111 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 YCP 'L-peptide linking' . '(2S)-piperidine-2-carboxylic acid' ? 'C6 H11 N O2' 129.157 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5USS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.04 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details 'Room temperature' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '300mM Tris pH 8, 17mM Zinc Acetate, 1% phenol, 313mM Sodium Citrate, 11.25% Acetone' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-23 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'LIQUID NITROGEN-COOLED DOUBLE CRYSTAL K-B FOCUSING MIRRORS' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.entry_id 5USS _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 25.870 _reflns.d_resolution_high 1.750 _reflns.number_obs 9265 _reflns.number_all ? _reflns.percent_possible_obs 99.800 _reflns.pdbx_Rmerge_I_obs 0.055 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.900 _reflns.B_iso_Wilson_estimate 42.110 _reflns.pdbx_redundancy 5.300 _reflns.pdbx_Rrim_I_all 0.061 _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_number_measured_all 49116 _reflns.pdbx_scaling_rejects 97 _reflns.pdbx_chi_squared ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 1.750 1.780 ? 2520 ? ? 3.267 ? ? ? 5.100 ? 0.400 ? 493 ? ? ? ? 99.800 3.646 1.604 0.284 1 2 9.100 25.870 ? 398 ? ? 0.038 ? ? ? 6.000 ? 52.200 ? 66 ? ? ? ? 96.600 0.042 0.017 0.998 # _refine.entry_id 5USS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.0610 _refine.ls_d_res_low 25.8660 _refine.pdbx_ls_sigma_F 1.960 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.8200 _refine.ls_number_reflns_obs 5673 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1709 _refine.ls_R_factor_R_work 0.1686 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2253 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.5100 _refine.ls_number_reflns_R_free 256 _refine.ls_number_reflns_R_work 5417 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 48.8064 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2900 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 1EV6 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 88.790 _refine.B_iso_min 27.350 _refine.pdbx_overall_phase_error 27.9700 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.0610 _refine_hist.d_res_low 25.8660 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 719 _refine_hist.pdbx_number_residues_total 97 _refine_hist.pdbx_B_iso_mean_ligand 38.25 _refine_hist.pdbx_B_iso_mean_solvent 49.05 _refine_hist.pdbx_number_atoms_protein 700 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 733 0.009 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 983 1.080 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 113 0.051 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 125 0.005 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 232 12.669 ? ? ? # loop_ _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso 1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 162 0.938 ? ? ? ? ? 2 'X-RAY DIFFRACTION' 1 2 TORSIONAL C 162 0.938 ? ? ? ? ? 3 'X-RAY DIFFRACTION' 2 1 TORSIONAL B 200 0.938 ? ? ? ? ? 4 'X-RAY DIFFRACTION' 2 2 TORSIONAL D 200 0.938 ? ? ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id 2.0614 2.5968 2 100.0000 2702 . 0.2340 0.2928 . 137 0.0000 2839 . 'X-RAY DIFFRACTION' 2.5968 25.8678 2 100.0000 2715 . 0.1533 0.2038 . 119 0.0000 2834 . 'X-RAY DIFFRACTION' # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 'chain A' 1 2 'chain C' 2 1 'chain B' 2 2 'chain D' # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id 1 1 1 ? A 1 A 21 'chain A' ? ? ? ? ? ? ? ? 1 2 1 ? C 1 C 21 'chain C' ? ? ? ? ? ? ? ? 2 1 1 ? B 2 B 28 'chain B' ? ? ? ? ? ? ? ? 2 2 1 ? D 1 D 28 'chain D' ? ? ? ? ? ? ? ? # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _struct.entry_id 5USS _struct.title 'Insulin with proline analog PiP at position B28 in the R6 state' _struct.pdbx_descriptor 'Insulin Chain A, Insulin Chain B' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5USS _struct_keywords.text 'Insulin, HORMONE' _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? H N N 3 ? I N N 4 ? J N N 5 ? K N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? CYS A 7 ? GLY A 1 CYS A 7 1 ? 7 HELX_P HELX_P2 AA2 SER A 12 ? GLU A 17 ? SER A 12 GLU A 17 1 ? 6 HELX_P HELX_P3 AA3 ASN A 18 ? CYS A 20 ? ASN A 18 CYS A 20 5 ? 3 HELX_P HELX_P4 AA4 ASN B 3 ? GLY B 20 ? ASN B 3 GLY B 20 1 ? 18 HELX_P HELX_P5 AA5 GLU B 21 ? GLY B 23 ? GLU B 21 GLY B 23 5 ? 3 HELX_P HELX_P6 AA6 ILE C 2 ? CYS C 7 ? ILE C 2 CYS C 7 1 ? 6 HELX_P HELX_P7 AA7 SER C 12 ? ASN C 18 ? SER C 12 ASN C 18 1 ? 7 HELX_P HELX_P8 AA8 VAL D 2 ? GLY D 20 ? VAL D 2 GLY D 20 1 ? 19 HELX_P HELX_P9 AA9 GLU D 21 ? GLY D 23 ? GLU D 21 GLY D 23 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.023 ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 7 1_555 ? ? ? ? ? ? ? 2.041 ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.027 ? disulf4 disulf ? ? C CYS 6 SG ? ? ? 1_555 C CYS 11 SG ? ? C CYS 6 C CYS 11 1_555 ? ? ? ? ? ? ? 2.017 ? disulf5 disulf ? ? C CYS 7 SG ? ? ? 1_555 D CYS 7 SG ? ? C CYS 7 D CYS 7 1_555 ? ? ? ? ? ? ? 2.039 ? disulf6 disulf ? ? C CYS 20 SG ? ? ? 1_555 D CYS 19 SG ? ? C CYS 20 D CYS 19 1_555 ? ? ? ? ? ? ? 2.037 ? metalc1 metalc ? ? B HIS 10 NE2 ? ? ? 1_555 F ZN . ZN ? ? B HIS 10 B ZN 101 1_555 ? ? ? ? ? ? ? 2.044 ? covale1 covale both ? B THR 27 C ? ? ? 1_555 B YCP 28 N ? ? B THR 27 B YCP 28 1_555 ? ? ? ? ? ? ? 1.332 ? metalc2 metalc ? ? D HIS 10 NE2 ? ? ? 1_555 I ZN . ZN ? ? D HIS 10 D ZN 101 1_555 ? ? ? ? ? ? ? 2.054 ? covale2 covale both ? D THR 27 C ? ? ? 1_555 D YCP 28 N ? ? D THR 27 D YCP 28 1_555 ? ? ? ? ? ? ? 1.333 ? metalc3 metalc ? ? B HIS 10 NE2 ? ? ? 1_555 F ZN . ZN ? ? B HIS 10 B ZN 101 2_555 ? ? ? ? ? ? ? 2.044 ? metalc4 metalc ? ? D HIS 10 NE2 ? ? ? 1_555 I ZN . ZN ? ? D HIS 10 D ZN 101 2_555 ? ? ? ? ? ? ? 2.054 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? covale ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE B 24 ? TYR B 26 ? PHE B 24 TYR B 26 AA1 2 PHE D 24 ? TYR D 26 ? PHE D 24 TYR D 26 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id B _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id B _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id D _pdbx_struct_sheet_hbond.range_2_label_seq_id 26 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id D _pdbx_struct_sheet_hbond.range_2_auth_seq_id 26 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A IPH 101 ? 6 'binding site for residue IPH A 101' AC2 Software B ZN 101 ? 6 'binding site for residue ZN B 101' AC3 Software B CL 102 ? 6 'binding site for residue CL B 102' AC4 Software C IPH 101 ? 5 'binding site for residue IPH C 101' AC5 Software D ZN 101 ? 6 'binding site for residue ZN D 101' AC6 Software D CL 102 ? 6 'binding site for residue CL D 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 CYS A 6 ? CYS A 6 . ? 1_555 ? 2 AC1 6 SER A 9 ? SER A 9 . ? 1_555 ? 3 AC1 6 ILE A 10 ? ILE A 10 . ? 1_555 ? 4 AC1 6 CYS A 11 ? CYS A 11 . ? 1_555 ? 5 AC1 6 HIS B 5 ? HIS B 5 . ? 3_555 ? 6 AC1 6 LEU B 11 ? LEU B 11 . ? 1_555 ? 7 AC2 6 HIS B 10 ? HIS B 10 . ? 2_555 ? 8 AC2 6 HIS B 10 ? HIS B 10 . ? 3_555 ? 9 AC2 6 HIS B 10 ? HIS B 10 . ? 1_555 ? 10 AC2 6 CL G . ? CL B 102 . ? 3_555 ? 11 AC2 6 CL G . ? CL B 102 . ? 2_555 ? 12 AC2 6 CL G . ? CL B 102 . ? 1_555 ? 13 AC3 6 HIS B 10 ? HIS B 10 . ? 1_555 ? 14 AC3 6 HIS B 10 ? HIS B 10 . ? 2_555 ? 15 AC3 6 HIS B 10 ? HIS B 10 . ? 3_555 ? 16 AC3 6 ZN F . ? ZN B 101 . ? 2_555 ? 17 AC3 6 ZN F . ? ZN B 101 . ? 3_555 ? 18 AC3 6 ZN F . ? ZN B 101 . ? 1_555 ? 19 AC4 5 CYS C 6 ? CYS C 6 . ? 1_555 ? 20 AC4 5 SER C 9 ? SER C 9 . ? 1_555 ? 21 AC4 5 ILE C 10 ? ILE C 10 . ? 1_555 ? 22 AC4 5 CYS C 11 ? CYS C 11 . ? 1_555 ? 23 AC4 5 LEU D 11 ? LEU D 11 . ? 1_555 ? 24 AC5 6 HIS D 10 ? HIS D 10 . ? 1_555 ? 25 AC5 6 HIS D 10 ? HIS D 10 . ? 2_555 ? 26 AC5 6 HIS D 10 ? HIS D 10 . ? 3_555 ? 27 AC5 6 CL J . ? CL D 102 . ? 2_555 ? 28 AC5 6 CL J . ? CL D 102 . ? 3_555 ? 29 AC5 6 CL J . ? CL D 102 . ? 1_555 ? 30 AC6 6 HIS D 10 ? HIS D 10 . ? 1_555 ? 31 AC6 6 HIS D 10 ? HIS D 10 . ? 2_555 ? 32 AC6 6 HIS D 10 ? HIS D 10 . ? 3_555 ? 33 AC6 6 ZN I . ? ZN D 101 . ? 2_555 ? 34 AC6 6 ZN I . ? ZN D 101 . ? 3_555 ? 35 AC6 6 ZN I . ? ZN D 101 . ? 1_555 ? # _atom_sites.entry_id 5USS _atom_sites.fract_transf_matrix[1][1] 0.012654 _atom_sites.fract_transf_matrix[1][2] 0.007306 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014612 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025311 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n B 2 1 PHE 1 1 ? ? ? B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 ASN 3 3 3 ASN ASN B . n B 2 4 GLN 4 4 4 GLN GLN B . n B 2 5 HIS 5 5 5 HIS HIS B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 CYS 7 7 7 CYS CYS B . n B 2 8 GLY 8 8 8 GLY GLY B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 HIS 10 10 10 HIS HIS B . n B 2 11 LEU 11 11 11 LEU LEU B . n B 2 12 VAL 12 12 12 VAL VAL B . n B 2 13 GLU 13 13 13 GLU GLU B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 TYR 16 16 16 TYR TYR B . n B 2 17 LEU 17 17 17 LEU LEU B . n B 2 18 VAL 18 18 18 VAL VAL B . n B 2 19 CYS 19 19 19 CYS CYS B . n B 2 20 GLY 20 20 20 GLY GLY B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ARG 22 22 22 ARG ARG B . n B 2 23 GLY 23 23 23 GLY GLY B . n B 2 24 PHE 24 24 24 PHE PHE B . n B 2 25 PHE 25 25 25 PHE PHE B . n B 2 26 TYR 26 26 26 TYR TYR B . n B 2 27 THR 27 27 27 THR THR B . n B 2 28 YCP 28 28 28 YCP YCP B . n B 2 29 LYS 29 29 ? ? ? B . n B 2 30 THR 30 30 ? ? ? B . n C 1 1 GLY 1 1 1 GLY GLY C . n C 1 2 ILE 2 2 2 ILE ILE C . n C 1 3 VAL 3 3 3 VAL VAL C . n C 1 4 GLU 4 4 4 GLU GLU C . n C 1 5 GLN 5 5 5 GLN GLN C . n C 1 6 CYS 6 6 6 CYS CYS C . n C 1 7 CYS 7 7 7 CYS CYS C . n C 1 8 THR 8 8 8 THR THR C . n C 1 9 SER 9 9 9 SER SER C . n C 1 10 ILE 10 10 10 ILE ILE C . n C 1 11 CYS 11 11 11 CYS CYS C . n C 1 12 SER 12 12 12 SER SER C . n C 1 13 LEU 13 13 13 LEU LEU C . n C 1 14 TYR 14 14 14 TYR TYR C . n C 1 15 GLN 15 15 15 GLN GLN C . n C 1 16 LEU 16 16 16 LEU LEU C . n C 1 17 GLU 17 17 17 GLU GLU C . n C 1 18 ASN 18 18 18 ASN ASN C . n C 1 19 TYR 19 19 19 TYR TYR C . n C 1 20 CYS 20 20 20 CYS CYS C . n C 1 21 ASN 21 21 21 ASN ASN C . n D 2 1 PHE 1 1 1 PHE PHE D . n D 2 2 VAL 2 2 2 VAL VAL D . n D 2 3 ASN 3 3 3 ASN ASN D . n D 2 4 GLN 4 4 4 GLN GLN D . n D 2 5 HIS 5 5 5 HIS HIS D . n D 2 6 LEU 6 6 6 LEU LEU D . n D 2 7 CYS 7 7 7 CYS CYS D . n D 2 8 GLY 8 8 8 GLY GLY D . n D 2 9 SER 9 9 9 SER SER D . n D 2 10 HIS 10 10 10 HIS HIS D . n D 2 11 LEU 11 11 11 LEU LEU D . n D 2 12 VAL 12 12 12 VAL VAL D . n D 2 13 GLU 13 13 13 GLU GLU D . n D 2 14 ALA 14 14 14 ALA ALA D . n D 2 15 LEU 15 15 15 LEU LEU D . n D 2 16 TYR 16 16 16 TYR TYR D . n D 2 17 LEU 17 17 17 LEU LEU D . n D 2 18 VAL 18 18 18 VAL VAL D . n D 2 19 CYS 19 19 19 CYS CYS D . n D 2 20 GLY 20 20 20 GLY GLY D . n D 2 21 GLU 21 21 21 GLU GLU D . n D 2 22 ARG 22 22 22 ARG ARG D . n D 2 23 GLY 23 23 23 GLY GLY D . n D 2 24 PHE 24 24 24 PHE PHE D . n D 2 25 PHE 25 25 25 PHE PHE D . n D 2 26 TYR 26 26 26 TYR TYR D . n D 2 27 THR 27 27 27 THR THR D . n D 2 28 YCP 28 28 28 YCP YCP D . n D 2 29 LYS 29 29 ? ? ? D . n D 2 30 THR 30 30 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 IPH 1 101 2 IPH IPH A . F 4 ZN 1 101 31 ZN ZN B . G 5 CL 1 102 32 CL CL B . H 3 IPH 1 101 1 IPH IPH C . I 4 ZN 1 101 31 ZN ZN D . J 5 CL 1 102 32 CL CL D . K 6 HOH 1 201 1 HOH HOH D . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B YCP 28 B YCP 28 ? PRO 'modified residue' 2 D YCP 28 D YCP 28 ? PRO 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 17690 ? 1 MORE -327 ? 1 'SSA (A^2)' 11400 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B ZN 101 ? F ZN . 2 1 B CL 102 ? G CL . 3 1 D ZN 101 ? I ZN . 4 1 D CL 102 ? J CL . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? B HIS 10 ? B HIS 10 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 NE2 ? B HIS 10 ? B HIS 10 ? 1_555 0.0 ? 2 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? I ZN . ? D ZN 101 ? 1_555 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 0.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-21 2 'Structure model' 1 1 2020-01-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_audit_support # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 4.0732 13.1763 -12.3477 0.6509 0.5169 0.5106 -0.0114 0.1495 0.0870 1.9286 7.8939 6.7866 0.0986 0.2110 0.6371 0.0305 0.3817 -0.6253 0.7126 0.3857 0.2631 -0.8986 -0.6172 0.0868 'X-RAY DIFFRACTION' 2 ? refined 6.7774 18.5013 -3.5091 0.6445 0.3776 0.6964 -0.0755 0.0282 0.0464 2.4958 2.1642 8.7788 -1.4475 0.1566 1.0500 -0.0228 -0.1268 0.2076 0.1417 1.2891 -0.0325 -0.3414 -1.2246 0.2887 'X-RAY DIFFRACTION' 3 ? refined 1.0602 9.7704 -2.6419 0.3542 0.3263 0.3156 0.0197 0.0276 0.0279 5.0963 9.1557 5.3913 1.6197 1.2833 1.8818 -0.1831 -0.1143 0.4045 0.2769 0.7326 0.4163 -0.1692 -0.2895 -0.1458 'X-RAY DIFFRACTION' 4 ? refined -2.3761 17.2366 -2.1219 0.6735 0.3921 0.5182 0.0595 0.1469 0.0758 2.0113 8.7274 4.1423 1.5538 5.2753 4.2531 0.1790 -0.7272 -0.1133 0.2614 2.7519 -0.1920 0.0078 0.1762 0.2912 'X-RAY DIFFRACTION' 5 ? refined -8.5230 12.6489 13.5275 0.8287 0.7691 0.3946 0.1589 0.1193 -0.0015 0.4027 9.3428 2.1472 1.3156 0.3957 -1.6538 -0.5293 0.3960 -0.1573 -0.3737 0.2352 1.2149 1.6474 -1.0396 0.2238 'X-RAY DIFFRACTION' 6 ? refined -11.0021 6.9316 13.9234 0.6205 0.7302 0.4770 0.1417 0.1971 0.0769 3.3702 4.1184 4.2349 1.3614 2.2329 -0.6750 0.4413 -0.0181 -0.2779 -1.2253 0.7191 0.0434 1.0591 -0.5838 -0.7990 'X-RAY DIFFRACTION' 7 ? refined -15.1575 12.6623 4.7863 0.5659 0.6121 0.7025 0.2190 0.0932 -0.0355 6.7226 7.9437 5.5907 2.5040 0.2665 -0.8674 -0.0474 -0.0124 0.1278 -0.0504 0.7966 0.5329 0.0513 -0.7046 -1.2084 'X-RAY DIFFRACTION' 8 ? refined -5.0546 8.3155 4.4602 0.3488 0.3213 0.3511 0.0071 0.0409 -0.0175 4.3310 7.6249 5.3820 -1.4420 1.5790 -2.3391 -0.3727 -0.0453 0.4923 0.0475 0.7709 -0.0919 0.3717 -0.7353 0.1227 'X-RAY DIFFRACTION' 9 ? refined -5.1588 17.0515 2.9066 0.6573 0.3994 0.6649 0.1206 0.0786 0.0549 5.3742 2.5344 5.1317 -3.6833 5.1509 -3.5123 -0.1120 -0.0761 0.1988 0.0005 2.0340 -0.7356 0.6848 -1.0314 -0.7690 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 12 ;chain 'A' and (resid 1 through 12 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 13 A 21 ;chain 'A' and (resid 13 through 21 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 B 2 B 22 ;chain 'B' and (resid 2 through 22 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 B 23 B 27 ;chain 'B' and (resid 23 through 27 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 C 1 C 6 ;chain 'C' and (resid 1 through 6 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 C 7 C 12 ;chain 'C' and (resid 7 through 12 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 C 13 C 21 ;chain 'C' and (resid 13 through 21 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 D 1 D 22 ;chain 'D' and (resid 1 through 22 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 D 23 D 27 ;chain 'D' and (resid 23 through 27 ) ; ? ? ? ? ? # _pdbx_phasing_MR.entry_id 5USS _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 4.860 _pdbx_phasing_MR.d_res_low_rotation 25.870 _pdbx_phasing_MR.d_res_high_translation 4.860 _pdbx_phasing_MR.d_res_low_translation 25.870 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.27 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.6.1 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 6 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 4 ? CG ? A GLU 4 CG 2 1 Y 1 A GLU 4 ? CD ? A GLU 4 CD 3 1 Y 1 A GLU 4 ? OE1 ? A GLU 4 OE1 4 1 Y 1 A GLU 4 ? OE2 ? A GLU 4 OE2 5 1 Y 1 A GLN 5 ? CG ? A GLN 5 CG 6 1 Y 1 A GLN 5 ? CD ? A GLN 5 CD 7 1 Y 1 A GLN 5 ? OE1 ? A GLN 5 OE1 8 1 Y 1 A GLN 5 ? NE2 ? A GLN 5 NE2 9 1 Y 1 A ILE 10 ? CG1 ? A ILE 10 CG1 10 1 Y 1 A ILE 10 ? CG2 ? A ILE 10 CG2 11 1 Y 1 A ILE 10 ? CD1 ? A ILE 10 CD1 12 1 Y 1 A TYR 14 ? CG ? A TYR 14 CG 13 1 Y 1 A TYR 14 ? CD1 ? A TYR 14 CD1 14 1 Y 1 A TYR 14 ? CD2 ? A TYR 14 CD2 15 1 Y 1 A TYR 14 ? CE1 ? A TYR 14 CE1 16 1 Y 1 A TYR 14 ? CE2 ? A TYR 14 CE2 17 1 Y 1 A TYR 14 ? CZ ? A TYR 14 CZ 18 1 Y 1 A TYR 14 ? OH ? A TYR 14 OH 19 1 Y 1 B ASN 3 ? CG ? B ASN 3 CG 20 1 Y 1 B ASN 3 ? OD1 ? B ASN 3 OD1 21 1 Y 1 B ASN 3 ? ND2 ? B ASN 3 ND2 22 1 Y 1 B GLN 4 ? CG ? B GLN 4 CG 23 1 Y 1 B GLN 4 ? CD ? B GLN 4 CD 24 1 Y 1 B GLN 4 ? OE1 ? B GLN 4 OE1 25 1 Y 1 B GLN 4 ? NE2 ? B GLN 4 NE2 26 1 Y 1 B GLU 13 ? CG ? B GLU 13 CG 27 1 Y 1 B GLU 13 ? CD ? B GLU 13 CD 28 1 Y 1 B GLU 13 ? OE1 ? B GLU 13 OE1 29 1 Y 1 B GLU 13 ? OE2 ? B GLU 13 OE2 30 1 Y 1 B GLU 21 ? CG ? B GLU 21 CG 31 1 Y 1 B GLU 21 ? CD ? B GLU 21 CD 32 1 Y 1 B GLU 21 ? OE1 ? B GLU 21 OE1 33 1 Y 1 B GLU 21 ? OE2 ? B GLU 21 OE2 34 1 Y 1 C GLU 4 ? CG ? C GLU 4 CG 35 1 Y 1 C GLU 4 ? CD ? C GLU 4 CD 36 1 Y 1 C GLU 4 ? OE1 ? C GLU 4 OE1 37 1 Y 1 C GLU 4 ? OE2 ? C GLU 4 OE2 38 1 Y 1 C SER 9 ? OG ? C SER 9 OG 39 1 Y 1 C ILE 10 ? CG1 ? C ILE 10 CG1 40 1 Y 1 C ILE 10 ? CG2 ? C ILE 10 CG2 41 1 Y 1 C ILE 10 ? CD1 ? C ILE 10 CD1 42 1 Y 1 D PHE 1 ? N ? D PHE 1 N 43 1 Y 1 D PHE 1 ? CB ? D PHE 1 CB 44 1 Y 1 D PHE 1 ? CG ? D PHE 1 CG 45 1 Y 1 D PHE 1 ? CD1 ? D PHE 1 CD1 46 1 Y 1 D PHE 1 ? CD2 ? D PHE 1 CD2 47 1 Y 1 D PHE 1 ? CE1 ? D PHE 1 CE1 48 1 Y 1 D PHE 1 ? CE2 ? D PHE 1 CE2 49 1 Y 1 D PHE 1 ? CZ ? D PHE 1 CZ 50 1 Y 1 D ASN 3 ? CG ? D ASN 3 CG 51 1 Y 1 D ASN 3 ? OD1 ? D ASN 3 OD1 52 1 Y 1 D ASN 3 ? ND2 ? D ASN 3 ND2 53 1 Y 1 D GLN 4 ? CG ? D GLN 4 CG 54 1 Y 1 D GLN 4 ? CD ? D GLN 4 CD 55 1 Y 1 D GLN 4 ? OE1 ? D GLN 4 OE1 56 1 Y 1 D GLN 4 ? NE2 ? D GLN 4 NE2 57 1 Y 1 D GLU 13 ? CG ? D GLU 13 CG 58 1 Y 1 D GLU 13 ? CD ? D GLU 13 CD 59 1 Y 1 D GLU 13 ? OE1 ? D GLU 13 OE1 60 1 Y 1 D GLU 13 ? OE2 ? D GLU 13 OE2 61 1 Y 1 D LEU 17 ? CG ? D LEU 17 CG 62 1 Y 1 D LEU 17 ? CD1 ? D LEU 17 CD1 63 1 Y 1 D LEU 17 ? CD2 ? D LEU 17 CD2 64 1 Y 1 D GLU 21 ? CG ? D GLU 21 CG 65 1 Y 1 D GLU 21 ? CD ? D GLU 21 CD 66 1 Y 1 D GLU 21 ? OE1 ? D GLU 21 OE1 67 1 Y 1 D GLU 21 ? OE2 ? D GLU 21 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B PHE 1 ? B PHE 1 2 1 Y 1 B LYS 29 ? B LYS 29 3 1 Y 1 B THR 30 ? B THR 30 4 1 Y 1 D LYS 29 ? D LYS 29 5 1 Y 1 D THR 30 ? D THR 30 # _pdbx_audit_support.funding_organization 'Novo Nordisk Foundation' _pdbx_audit_support.country Denmark _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 PHENOL IPH 4 'ZINC ION' ZN 5 'CHLORIDE ION' CL 6 water HOH #