data_5UY9 # _entry.id 5UY9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5UY9 WWPDB D_1000226618 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5UY9 _pdbx_database_status.recvd_initial_deposition_date 2017-02-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dong, S.-H.' 1 0000-0002-1743-2163 'Nair, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Oncogene _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1476-5594 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 36 _citation.language ? _citation.page_first 5177 _citation.page_last 5188 _citation.title 'Prolyl isomerase PIN1 regulates the stability, transcriptional activity and oncogenic potential of BRD4.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/onc.2017.137 _citation.pdbx_database_id_PubMed 28481868 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hu, X.' 1 primary 'Dong, S.H.' 2 primary 'Chen, J.' 3 primary 'Zhou, X.Z.' 4 primary 'Chen, R.' 5 primary 'Nair, S.' 6 primary 'Lu, K.P.' 7 primary 'Chen, L.F.' 8 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5UY9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.534 _cell.length_a_esd ? _cell.length_b 68.534 _cell.length_b_esd ? _cell.length_c 79.640 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5UY9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1' 18185.193 1 5.2.1.8 R14A ? ? 2 polymer syn 'Brd4 peptide' 859.801 1 ? ? ? ? 3 non-polymer man '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' 354.436 1 ? ? ? ? 4 non-polymer man 'SULFATE ION' 96.063 2 ? ? ? ? 5 water nat water 18.015 80 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Peptidyl-prolyl cis-trans isomerase Pin1,PPIase Pin1,Rotamase Pin1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MADEEKLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITR TKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIIL RTE ; ;MADEEKLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITR TKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIIL RTE ; A ? 2 'polypeptide(L)' no yes 'QAS(TPO)PR(NIT)' QASTPRX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASP n 1 4 GLU n 1 5 GLU n 1 6 LYS n 1 7 LEU n 1 8 PRO n 1 9 PRO n 1 10 GLY n 1 11 TRP n 1 12 GLU n 1 13 LYS n 1 14 ALA n 1 15 MET n 1 16 SER n 1 17 ARG n 1 18 SER n 1 19 SER n 1 20 GLY n 1 21 ARG n 1 22 VAL n 1 23 TYR n 1 24 TYR n 1 25 PHE n 1 26 ASN n 1 27 HIS n 1 28 ILE n 1 29 THR n 1 30 ASN n 1 31 ALA n 1 32 SER n 1 33 GLN n 1 34 TRP n 1 35 GLU n 1 36 ARG n 1 37 PRO n 1 38 SER n 1 39 GLY n 1 40 ASN n 1 41 SER n 1 42 SER n 1 43 SER n 1 44 GLY n 1 45 GLY n 1 46 LYS n 1 47 ASN n 1 48 GLY n 1 49 GLN n 1 50 GLY n 1 51 GLU n 1 52 PRO n 1 53 ALA n 1 54 ARG n 1 55 VAL n 1 56 ARG n 1 57 CYS n 1 58 SER n 1 59 HIS n 1 60 LEU n 1 61 LEU n 1 62 VAL n 1 63 LYS n 1 64 HIS n 1 65 SER n 1 66 GLN n 1 67 SER n 1 68 ARG n 1 69 ARG n 1 70 PRO n 1 71 SER n 1 72 SER n 1 73 TRP n 1 74 ARG n 1 75 GLN n 1 76 GLU n 1 77 LYS n 1 78 ILE n 1 79 THR n 1 80 ARG n 1 81 THR n 1 82 LYS n 1 83 GLU n 1 84 GLU n 1 85 ALA n 1 86 LEU n 1 87 GLU n 1 88 LEU n 1 89 ILE n 1 90 ASN n 1 91 GLY n 1 92 TYR n 1 93 ILE n 1 94 GLN n 1 95 LYS n 1 96 ILE n 1 97 LYS n 1 98 SER n 1 99 GLY n 1 100 GLU n 1 101 GLU n 1 102 ASP n 1 103 PHE n 1 104 GLU n 1 105 SER n 1 106 LEU n 1 107 ALA n 1 108 SER n 1 109 GLN n 1 110 PHE n 1 111 SER n 1 112 ASP n 1 113 CYS n 1 114 SER n 1 115 SER n 1 116 ALA n 1 117 LYS n 1 118 ALA n 1 119 ARG n 1 120 GLY n 1 121 ASP n 1 122 LEU n 1 123 GLY n 1 124 ALA n 1 125 PHE n 1 126 SER n 1 127 ARG n 1 128 GLY n 1 129 GLN n 1 130 MET n 1 131 GLN n 1 132 LYS n 1 133 PRO n 1 134 PHE n 1 135 GLU n 1 136 ASP n 1 137 ALA n 1 138 SER n 1 139 PHE n 1 140 ALA n 1 141 LEU n 1 142 ARG n 1 143 THR n 1 144 GLY n 1 145 GLU n 1 146 MET n 1 147 SER n 1 148 GLY n 1 149 PRO n 1 150 VAL n 1 151 PHE n 1 152 THR n 1 153 ASP n 1 154 SER n 1 155 GLY n 1 156 ILE n 1 157 HIS n 1 158 ILE n 1 159 ILE n 1 160 LEU n 1 161 ARG n 1 162 THR n 1 163 GLU n 2 1 GLN n 2 2 ALA n 2 3 SER n 2 4 TPO n 2 5 PRO n 2 6 ARG n 2 7 NIT n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 163 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIN1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 7 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PIN1_HUMAN Q13526 ? 1 ;MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITR TKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIIL RTE ; 1 2 PDB 5UY9 5UY9 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5UY9 A 1 ? 163 ? Q13526 1 ? 163 ? 1 163 2 2 5UY9 B 1 ? 7 ? 5UY9 1 ? 7 ? 1 7 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5UY9 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 14 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q13526 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 14 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 14 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NIT non-polymer . 4-NITROANILINE PARANITROANILINE 'C6 H6 N2 O2' 138.124 PE4 non-polymer . '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' 'POLYETHYLENE GLYCOL PEG4000' 'C16 H34 O8' 354.436 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5UY9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.76 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '140 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4 , 1.8 mM KH2PO4, PH 7.3' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 77.1 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-04-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5UY9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.85 _reflns.d_resolution_low 33.07 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17865 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.48 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -1.05 _refine.aniso_B[1][2] -0.53 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -1.05 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 3.42 _refine.B_iso_max ? _refine.B_iso_mean 42.425 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.914 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5UY9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.85 _refine.ls_d_res_low 33.07 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16929 _refine.ls_number_reflns_R_free 905 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.03 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23510 _refine.ls_R_factor_R_free 0.29078 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.23229 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.125 _refine.pdbx_overall_ESU_R_Free 0.157 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.007 _refine.overall_SU_ML 0.000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1257 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 80 _refine_hist.number_atoms_total 1337 _refine_hist.d_res_high 1.85 _refine_hist.d_res_low 33.07 # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.849 _refine_ls_shell.d_res_low 1.896 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 82 _refine_ls_shell.number_reflns_R_work 1228 _refine_ls_shell.percent_reflns_obs 96.82 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.394 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.390 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5UY9 _struct.title 'Prolyl isomerase Pin1 R14A mutant bound with Brd4 peptide' _struct.pdbx_descriptor 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (E.C.5.2.1.8), Brd4 peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5UY9 _struct_keywords.text ISOMERASE _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 81 ? SER A 98 ? THR A 81 SER A 98 1 ? 18 HELX_P HELX_P2 AA2 ASP A 102 ? SER A 111 ? ASP A 102 SER A 111 1 ? 10 HELX_P HELX_P3 AA3 CYS A 113 ? ARG A 119 ? CYS A 113 ARG A 119 5 ? 7 HELX_P HELX_P4 AA4 GLN A 131 ? LEU A 141 ? GLN A 131 LEU A 141 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? B SER 3 C ? ? ? 1_555 B TPO 4 N ? ? B SER 3 B TPO 4 1_555 ? ? ? ? ? ? ? 1.337 ? covale2 covale both ? B TPO 4 C ? ? ? 1_555 B PRO 5 N ? ? B TPO 4 B PRO 5 1_555 ? ? ? ? ? ? ? 1.363 ? covale3 covale both ? B ARG 6 C ? ? ? 1_555 B NIT 7 N1 ? ? B ARG 6 B NIT 7 1_555 ? ? ? ? ? ? ? 1.510 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 11 ? MET A 15 ? TRP A 11 MET A 15 AA1 2 VAL A 22 ? ASN A 26 ? VAL A 22 ASN A 26 AA1 3 SER A 32 ? GLN A 33 ? SER A 32 GLN A 33 AA2 1 ASP A 121 ? SER A 126 ? ASP A 121 SER A 126 AA2 2 ARG A 54 ? VAL A 62 ? ARG A 54 VAL A 62 AA2 3 GLY A 155 ? ARG A 161 ? GLY A 155 ARG A 161 AA2 4 VAL A 150 ? THR A 152 ? VAL A 150 THR A 152 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 14 ? N ALA A 14 O TYR A 23 ? O TYR A 23 AA1 2 3 N TYR A 24 ? N TYR A 24 O GLN A 33 ? O GLN A 33 AA2 1 2 O LEU A 122 ? O LEU A 122 N CYS A 57 ? N CYS A 57 AA2 2 3 N VAL A 62 ? N VAL A 62 O ILE A 156 ? O ILE A 156 AA2 3 4 O HIS A 157 ? O HIS A 157 N VAL A 150 ? N VAL A 150 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A PE4 300 ? 12 'binding site for residue PE4 A 300' AC2 Software A SO4 301 ? 6 'binding site for residue SO4 A 301' AC3 Software B SO4 101 ? 1 'binding site for residue SO4 B 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 TYR A 23 ? TYR A 23 . ? 1_555 ? 2 AC1 12 ALA A 31 ? ALA A 31 . ? 1_555 ? 3 AC1 12 SER A 32 ? SER A 32 . ? 1_555 ? 4 AC1 12 TRP A 34 ? TRP A 34 . ? 1_555 ? 5 AC1 12 ILE A 93 ? ILE A 93 . ? 1_555 ? 6 AC1 12 LYS A 97 ? LYS A 97 . ? 1_555 ? 7 AC1 12 LYS A 97 ? LYS A 97 . ? 6_555 ? 8 AC1 12 SER A 98 ? SER A 98 . ? 6_555 ? 9 AC1 12 MET A 146 ? MET A 146 . ? 1_555 ? 10 AC1 12 SER A 147 ? SER A 147 . ? 1_555 ? 11 AC1 12 GLY A 148 ? GLY A 148 . ? 1_555 ? 12 AC1 12 HOH F . ? HOH A 420 . ? 1_555 ? 13 AC2 6 ARG A 69 ? ARG A 69 . ? 1_555 ? 14 AC2 6 SER A 72 ? SER A 72 . ? 1_555 ? 15 AC2 6 TRP A 73 ? TRP A 73 . ? 1_555 ? 16 AC2 6 CYS A 113 ? CYS A 113 . ? 1_555 ? 17 AC2 6 SER A 114 ? SER A 114 . ? 1_555 ? 18 AC2 6 HOH F . ? HOH A 455 . ? 1_555 ? 19 AC3 1 ARG B 6 ? ARG B 6 . ? 1_555 ? # _atom_sites.entry_id 5UY9 _atom_sites.fract_transf_matrix[1][1] 0.014591 _atom_sites.fract_transf_matrix[1][2] 0.008424 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016849 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012557 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLY 39 39 ? ? ? A . n A 1 40 ASN 40 40 ? ? ? A . n A 1 41 SER 41 41 ? ? ? A . n A 1 42 SER 42 42 ? ? ? A . n A 1 43 SER 43 43 ? ? ? A . n A 1 44 GLY 44 44 ? ? ? A . n A 1 45 GLY 45 45 ? ? ? A . n A 1 46 LYS 46 46 ? ? ? A . n A 1 47 ASN 47 47 ? ? ? A . n A 1 48 GLY 48 48 ? ? ? A . n A 1 49 GLN 49 49 ? ? ? A . n A 1 50 GLY 50 50 ? ? ? A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 CYS 113 113 113 CYS CYS A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 MET 146 146 146 MET MET A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 GLU 163 163 163 GLU GLU A . n B 2 1 GLN 1 1 1 GLN GLN B . n B 2 2 ALA 2 2 2 ALA ALA B . n B 2 3 SER 3 3 3 SER SER B . n B 2 4 TPO 4 4 4 TPO TPO B . n B 2 5 PRO 5 5 5 PRO PRO B . n B 2 6 ARG 6 6 6 ARG ARG B . n B 2 7 NIT 7 7 7 NIT ZNP B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 PE4 1 300 300 PE4 PE4 A . D 4 SO4 1 301 301 SO4 SO4 A . E 4 SO4 1 101 302 SO4 SO4 B . F 5 HOH 1 401 89 HOH HOH A . F 5 HOH 2 402 81 HOH HOH A . F 5 HOH 3 403 61 HOH HOH A . F 5 HOH 4 404 29 HOH HOH A . F 5 HOH 5 405 83 HOH HOH A . F 5 HOH 6 406 42 HOH HOH A . F 5 HOH 7 407 33 HOH HOH A . F 5 HOH 8 408 9 HOH HOH A . F 5 HOH 9 409 24 HOH HOH A . F 5 HOH 10 410 76 HOH HOH A . F 5 HOH 11 411 71 HOH HOH A . F 5 HOH 12 412 55 HOH HOH A . F 5 HOH 13 413 20 HOH HOH A . F 5 HOH 14 414 95 HOH HOH A . F 5 HOH 15 415 16 HOH HOH A . F 5 HOH 16 416 15 HOH HOH A . F 5 HOH 17 417 8 HOH HOH A . F 5 HOH 18 418 3 HOH HOH A . F 5 HOH 19 419 50 HOH HOH A . F 5 HOH 20 420 34 HOH HOH A . F 5 HOH 21 421 25 HOH HOH A . F 5 HOH 22 422 28 HOH HOH A . F 5 HOH 23 423 32 HOH HOH A . F 5 HOH 24 424 23 HOH HOH A . F 5 HOH 25 425 1 HOH HOH A . F 5 HOH 26 426 56 HOH HOH A . F 5 HOH 27 427 5 HOH HOH A . F 5 HOH 28 428 6 HOH HOH A . F 5 HOH 29 429 14 HOH HOH A . F 5 HOH 30 430 41 HOH HOH A . F 5 HOH 31 431 36 HOH HOH A . F 5 HOH 32 432 59 HOH HOH A . F 5 HOH 33 433 10 HOH HOH A . F 5 HOH 34 434 40 HOH HOH A . F 5 HOH 35 435 37 HOH HOH A . F 5 HOH 36 436 27 HOH HOH A . F 5 HOH 37 437 7 HOH HOH A . F 5 HOH 38 438 38 HOH HOH A . F 5 HOH 39 439 21 HOH HOH A . F 5 HOH 40 440 17 HOH HOH A . F 5 HOH 41 441 43 HOH HOH A . F 5 HOH 42 442 22 HOH HOH A . F 5 HOH 43 443 53 HOH HOH A . F 5 HOH 44 444 74 HOH HOH A . F 5 HOH 45 445 87 HOH HOH A . F 5 HOH 46 446 52 HOH HOH A . F 5 HOH 47 447 64 HOH HOH A . F 5 HOH 48 448 19 HOH HOH A . F 5 HOH 49 449 84 HOH HOH A . F 5 HOH 50 450 93 HOH HOH A . F 5 HOH 51 451 62 HOH HOH A . F 5 HOH 52 452 35 HOH HOH A . F 5 HOH 53 453 18 HOH HOH A . F 5 HOH 54 454 72 HOH HOH A . F 5 HOH 55 455 45 HOH HOH A . F 5 HOH 56 456 26 HOH HOH A . F 5 HOH 57 457 12 HOH HOH A . F 5 HOH 58 458 80 HOH HOH A . F 5 HOH 59 459 70 HOH HOH A . F 5 HOH 60 460 51 HOH HOH A . F 5 HOH 61 461 13 HOH HOH A . F 5 HOH 62 462 31 HOH HOH A . F 5 HOH 63 463 47 HOH HOH A . F 5 HOH 64 464 79 HOH HOH A . F 5 HOH 65 465 11 HOH HOH A . F 5 HOH 66 466 66 HOH HOH A . F 5 HOH 67 467 39 HOH HOH A . F 5 HOH 68 468 75 HOH HOH A . F 5 HOH 69 469 30 HOH HOH A . F 5 HOH 70 470 88 HOH HOH A . F 5 HOH 71 471 77 HOH HOH A . F 5 HOH 72 472 69 HOH HOH A . F 5 HOH 73 473 63 HOH HOH A . F 5 HOH 74 474 58 HOH HOH A . F 5 HOH 75 475 49 HOH HOH A . F 5 HOH 76 476 60 HOH HOH A . F 5 HOH 77 477 57 HOH HOH A . F 5 HOH 78 478 96 HOH HOH A . F 5 HOH 79 479 82 HOH HOH A . G 5 HOH 1 201 4 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2110 ? 1 MORE -26 ? 1 'SSA (A^2)' 8430 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-26 2 'Structure model' 1 1 2017-05-24 3 'Structure model' 1 2 2017-09-20 4 'Structure model' 1 3 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 4 'Structure model' audit_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_citation.page_first' 3 3 'Structure model' '_citation.page_last' 4 4 'Structure model' '_audit_author.name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? HKL2000 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? HKL2000 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 6 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 N1 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 NIT _pdbx_validate_close_contact.auth_seq_id_2 7 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.79 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C B TPO 4 ? ? N B PRO 5 ? ? CA B PRO 5 ? ? 133.11 119.30 13.81 1.50 Y 2 1 C B TPO 4 ? ? N B PRO 5 ? ? CD B PRO 5 ? ? 113.11 128.40 -15.29 2.10 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 7 ? ? 86.45 128.69 2 1 PRO A 8 ? ? -55.61 173.47 3 1 ALA B 2 ? ? -156.63 36.69 4 1 SER B 3 ? ? 86.51 -86.80 5 1 PRO B 5 ? ? 20.48 131.18 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A GLY 39 ? A GLY 39 7 1 Y 1 A ASN 40 ? A ASN 40 8 1 Y 1 A SER 41 ? A SER 41 9 1 Y 1 A SER 42 ? A SER 42 10 1 Y 1 A SER 43 ? A SER 43 11 1 Y 1 A GLY 44 ? A GLY 44 12 1 Y 1 A GLY 45 ? A GLY 45 13 1 Y 1 A LYS 46 ? A LYS 46 14 1 Y 1 A ASN 47 ? A ASN 47 15 1 Y 1 A GLY 48 ? A GLY 48 16 1 Y 1 A GLN 49 ? A GLN 49 17 1 Y 1 A GLY 50 ? A GLY 50 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' PE4 4 'SULFATE ION' SO4 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ? #