data_5UYO # _entry.id 5UYO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5UYO pdb_00005uyo 10.2210/pdb5uyo/pdb WWPDB D_1000226634 ? ? BMRB 30249 ? 10.13018/BMR30249 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-26 2 'Structure model' 1 1 2018-11-07 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity_src_gen 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 2 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 3 2 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 4 2 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 3 'Structure model' '_pdbx_nmr_software.name' 9 3 'Structure model' '_pdbx_nmr_spectrometer.model' 10 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5UYO _pdbx_database_status.recvd_initial_deposition_date 2017-02-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR structure of the de novo mini protein HEEH_rd4_0097' _pdbx_database_related.db_id 30249 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lemak, A.' 1 ? 'Rocklin, G.J.' 2 ? 'Houliston, S.' 3 ? 'Carter, L.' 4 ? 'Chidyausiku, T.M.' 5 ? 'Baker, D.' 6 ? 'Arrowsmith, C.H.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 357 _citation.language ? _citation.page_first 168 _citation.page_last 175 _citation.title 'Global analysis of protein folding using massively parallel design, synthesis, and testing.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aan0693 _citation.pdbx_database_id_PubMed 28706065 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rocklin, G.J.' 1 ? primary 'Chidyausiku, T.M.' 2 ? primary 'Goreshnik, I.' 3 ? primary 'Ford, A.' 4 ? primary 'Houliston, S.' 5 ? primary 'Lemak, A.' 6 ? primary 'Carter, L.' 7 ? primary 'Ravichandran, R.' 8 ? primary 'Mulligan, V.K.' 9 ? primary 'Chevalier, A.' 10 ? primary 'Arrowsmith, C.H.' 11 ? primary 'Baker, D.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description HEEH_rd4_0097 _entity.formula_weight 7469.417 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGSSHHHHHHSSGLVPRGSHMDVEEQIRRLEEVLKKNQPVTWNGTTYTDPNEIKKVIEELRKSM _entity_poly.pdbx_seq_one_letter_code_can MGSSHHHHHHSSGLVPRGSHMDVEEQIRRLEEVLKKNQPVTWNGTTYTDPNEIKKVIEELRKSM _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ASP n 1 23 VAL n 1 24 GLU n 1 25 GLU n 1 26 GLN n 1 27 ILE n 1 28 ARG n 1 29 ARG n 1 30 LEU n 1 31 GLU n 1 32 GLU n 1 33 VAL n 1 34 LEU n 1 35 LYS n 1 36 LYS n 1 37 ASN n 1 38 GLN n 1 39 PRO n 1 40 VAL n 1 41 THR n 1 42 TRP n 1 43 ASN n 1 44 GLY n 1 45 THR n 1 46 THR n 1 47 TYR n 1 48 THR n 1 49 ASP n 1 50 PRO n 1 51 ASN n 1 52 GLU n 1 53 ILE n 1 54 LYS n 1 55 LYS n 1 56 VAL n 1 57 ILE n 1 58 GLU n 1 59 GLU n 1 60 LEU n 1 61 ARG n 1 62 LYS n 1 63 SER n 1 64 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 64 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 MET 64 64 64 MET MET A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 64 ? O ? A MET 64 O 2 2 Y 1 A MET 64 ? O ? A MET 64 O 3 3 Y 1 A MET 64 ? O ? A MET 64 O 4 4 Y 1 A MET 64 ? O ? A MET 64 O 5 5 Y 1 A MET 64 ? O ? A MET 64 O 6 6 Y 1 A MET 64 ? O ? A MET 64 O 7 7 Y 1 A MET 64 ? O ? A MET 64 O 8 8 Y 1 A MET 64 ? O ? A MET 64 O 9 9 Y 1 A MET 64 ? O ? A MET 64 O 10 10 Y 1 A MET 64 ? O ? A MET 64 O 11 11 Y 1 A MET 64 ? O ? A MET 64 O 12 12 Y 1 A MET 64 ? O ? A MET 64 O 13 13 Y 1 A MET 64 ? O ? A MET 64 O 14 14 Y 1 A MET 64 ? O ? A MET 64 O 15 15 Y 1 A MET 64 ? O ? A MET 64 O 16 16 Y 1 A MET 64 ? O ? A MET 64 O 17 17 Y 1 A MET 64 ? O ? A MET 64 O 18 18 Y 1 A MET 64 ? O ? A MET 64 O 19 19 Y 1 A MET 64 ? O ? A MET 64 O 20 20 Y 1 A MET 64 ? O ? A MET 64 O # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5UYO _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5UYO _struct.title 'Solution NMR structure of the de novo mini protein HEEH_rd4_0097' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5UYO _struct_keywords.text 'de novo design, helix-strand-strand-helix, mini protein, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5UYO _struct_ref.pdbx_db_accession 5UYO _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5UYO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5UYO _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 64 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 64 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 23 ? ASN A 37 ? VAL A 23 ASN A 37 1 ? 15 HELX_P HELX_P2 AA2 ASP A 49 ? LYS A 62 ? ASP A 49 LYS A 62 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 40 ? THR A 41 ? VAL A 40 THR A 41 AA1 2 THR A 46 ? TYR A 47 ? THR A 46 TYR A 47 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 40 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 40 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 47 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 47 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 37 ? ? 59.82 74.06 2 2 PRO A 39 ? ? -64.95 98.11 3 2 ASN A 43 ? ? 71.47 55.81 4 3 ASP A 22 ? ? -69.68 90.02 5 4 ASN A 37 ? ? 62.77 80.51 6 5 ASN A 37 ? ? 61.33 76.18 7 5 ASN A 43 ? ? 79.02 55.37 8 7 ASN A 37 ? ? 57.27 78.65 9 9 ASN A 43 ? ? 71.61 53.68 10 10 MET A 21 ? ? -142.93 -16.00 11 10 ASP A 22 ? ? -51.16 90.79 12 10 ASN A 43 ? ? 73.69 54.98 13 12 ASN A 37 ? ? 61.24 71.48 14 14 ASN A 37 ? ? 59.41 75.46 15 18 ASP A 22 ? ? -69.30 90.60 16 18 ASN A 43 ? ? 76.00 58.20 17 19 ASP A 22 ? ? -69.44 99.44 18 19 ASN A 43 ? ? 70.52 54.41 19 20 ASP A 22 ? ? -65.83 96.54 20 20 ASN A 37 ? ? 64.40 76.47 # _pdbx_nmr_ensemble.entry_id 5UYO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5UYO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '150 mM sodium chloride, 400 uM [U-13C; U-15N] protein, 50 mM sodium phosphate, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label '15N/13C sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ;150 mM NaCl phosphate buffer (pH 7.4) ; # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium chloride' 150 ? mM 'natural abundance' 1 protein 400 ? uM '[U-13C; U-15N]' 1 'sodium phosphate' 50 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 2 isotropic 2 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HBHA(CO)NH' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 6 1 1 '3D HNCA' 1 isotropic # _pdbx_nmr_refine.entry_id 5UYO _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'peak picking' Sparky ? Goddard 5 'chemical shift assignment' ABACUS ? 'Lemak and Arrowsmith' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A SER 19 ? A SER 19 20 2 Y 1 A MET 1 ? A MET 1 21 2 Y 1 A GLY 2 ? A GLY 2 22 2 Y 1 A SER 3 ? A SER 3 23 2 Y 1 A SER 4 ? A SER 4 24 2 Y 1 A HIS 5 ? A HIS 5 25 2 Y 1 A HIS 6 ? A HIS 6 26 2 Y 1 A HIS 7 ? A HIS 7 27 2 Y 1 A HIS 8 ? A HIS 8 28 2 Y 1 A HIS 9 ? A HIS 9 29 2 Y 1 A HIS 10 ? A HIS 10 30 2 Y 1 A SER 11 ? A SER 11 31 2 Y 1 A SER 12 ? A SER 12 32 2 Y 1 A GLY 13 ? A GLY 13 33 2 Y 1 A LEU 14 ? A LEU 14 34 2 Y 1 A VAL 15 ? A VAL 15 35 2 Y 1 A PRO 16 ? A PRO 16 36 2 Y 1 A ARG 17 ? A ARG 17 37 2 Y 1 A GLY 18 ? A GLY 18 38 2 Y 1 A SER 19 ? A SER 19 39 3 Y 1 A MET 1 ? A MET 1 40 3 Y 1 A GLY 2 ? A GLY 2 41 3 Y 1 A SER 3 ? A SER 3 42 3 Y 1 A SER 4 ? A SER 4 43 3 Y 1 A HIS 5 ? A HIS 5 44 3 Y 1 A HIS 6 ? A HIS 6 45 3 Y 1 A HIS 7 ? A HIS 7 46 3 Y 1 A HIS 8 ? A HIS 8 47 3 Y 1 A HIS 9 ? A HIS 9 48 3 Y 1 A HIS 10 ? A HIS 10 49 3 Y 1 A SER 11 ? A SER 11 50 3 Y 1 A SER 12 ? A SER 12 51 3 Y 1 A GLY 13 ? A GLY 13 52 3 Y 1 A LEU 14 ? A LEU 14 53 3 Y 1 A VAL 15 ? A VAL 15 54 3 Y 1 A PRO 16 ? A PRO 16 55 3 Y 1 A ARG 17 ? A ARG 17 56 3 Y 1 A GLY 18 ? A GLY 18 57 3 Y 1 A SER 19 ? A SER 19 58 4 Y 1 A MET 1 ? A MET 1 59 4 Y 1 A GLY 2 ? A GLY 2 60 4 Y 1 A SER 3 ? A SER 3 61 4 Y 1 A SER 4 ? A SER 4 62 4 Y 1 A HIS 5 ? A HIS 5 63 4 Y 1 A HIS 6 ? A HIS 6 64 4 Y 1 A HIS 7 ? A HIS 7 65 4 Y 1 A HIS 8 ? A HIS 8 66 4 Y 1 A HIS 9 ? A HIS 9 67 4 Y 1 A HIS 10 ? A HIS 10 68 4 Y 1 A SER 11 ? A SER 11 69 4 Y 1 A SER 12 ? A SER 12 70 4 Y 1 A GLY 13 ? A GLY 13 71 4 Y 1 A LEU 14 ? A LEU 14 72 4 Y 1 A VAL 15 ? A VAL 15 73 4 Y 1 A PRO 16 ? A PRO 16 74 4 Y 1 A ARG 17 ? A ARG 17 75 4 Y 1 A GLY 18 ? A GLY 18 76 4 Y 1 A SER 19 ? A SER 19 77 5 Y 1 A MET 1 ? A MET 1 78 5 Y 1 A GLY 2 ? A GLY 2 79 5 Y 1 A SER 3 ? A SER 3 80 5 Y 1 A SER 4 ? A SER 4 81 5 Y 1 A HIS 5 ? A HIS 5 82 5 Y 1 A HIS 6 ? A HIS 6 83 5 Y 1 A HIS 7 ? A HIS 7 84 5 Y 1 A HIS 8 ? A HIS 8 85 5 Y 1 A HIS 9 ? A HIS 9 86 5 Y 1 A HIS 10 ? A HIS 10 87 5 Y 1 A SER 11 ? A SER 11 88 5 Y 1 A SER 12 ? A SER 12 89 5 Y 1 A GLY 13 ? A GLY 13 90 5 Y 1 A LEU 14 ? A LEU 14 91 5 Y 1 A VAL 15 ? A VAL 15 92 5 Y 1 A PRO 16 ? A PRO 16 93 5 Y 1 A ARG 17 ? A ARG 17 94 5 Y 1 A GLY 18 ? A GLY 18 95 5 Y 1 A SER 19 ? A SER 19 96 6 Y 1 A MET 1 ? A MET 1 97 6 Y 1 A GLY 2 ? A GLY 2 98 6 Y 1 A SER 3 ? A SER 3 99 6 Y 1 A SER 4 ? A SER 4 100 6 Y 1 A HIS 5 ? A HIS 5 101 6 Y 1 A HIS 6 ? A HIS 6 102 6 Y 1 A HIS 7 ? A HIS 7 103 6 Y 1 A HIS 8 ? A HIS 8 104 6 Y 1 A HIS 9 ? A HIS 9 105 6 Y 1 A HIS 10 ? A HIS 10 106 6 Y 1 A SER 11 ? A SER 11 107 6 Y 1 A SER 12 ? A SER 12 108 6 Y 1 A GLY 13 ? A GLY 13 109 6 Y 1 A LEU 14 ? A LEU 14 110 6 Y 1 A VAL 15 ? A VAL 15 111 6 Y 1 A PRO 16 ? A PRO 16 112 6 Y 1 A ARG 17 ? A ARG 17 113 6 Y 1 A GLY 18 ? A GLY 18 114 6 Y 1 A SER 19 ? A SER 19 115 7 Y 1 A MET 1 ? A MET 1 116 7 Y 1 A GLY 2 ? A GLY 2 117 7 Y 1 A SER 3 ? A SER 3 118 7 Y 1 A SER 4 ? A SER 4 119 7 Y 1 A HIS 5 ? A HIS 5 120 7 Y 1 A HIS 6 ? A HIS 6 121 7 Y 1 A HIS 7 ? A HIS 7 122 7 Y 1 A HIS 8 ? A HIS 8 123 7 Y 1 A HIS 9 ? A HIS 9 124 7 Y 1 A HIS 10 ? A HIS 10 125 7 Y 1 A SER 11 ? A SER 11 126 7 Y 1 A SER 12 ? A SER 12 127 7 Y 1 A GLY 13 ? A GLY 13 128 7 Y 1 A LEU 14 ? A LEU 14 129 7 Y 1 A VAL 15 ? A VAL 15 130 7 Y 1 A PRO 16 ? A PRO 16 131 7 Y 1 A ARG 17 ? A ARG 17 132 7 Y 1 A GLY 18 ? A GLY 18 133 7 Y 1 A SER 19 ? A SER 19 134 8 Y 1 A MET 1 ? A MET 1 135 8 Y 1 A GLY 2 ? A GLY 2 136 8 Y 1 A SER 3 ? A SER 3 137 8 Y 1 A SER 4 ? A SER 4 138 8 Y 1 A HIS 5 ? A HIS 5 139 8 Y 1 A HIS 6 ? A HIS 6 140 8 Y 1 A HIS 7 ? A HIS 7 141 8 Y 1 A HIS 8 ? A HIS 8 142 8 Y 1 A HIS 9 ? A HIS 9 143 8 Y 1 A HIS 10 ? A HIS 10 144 8 Y 1 A SER 11 ? A SER 11 145 8 Y 1 A SER 12 ? A SER 12 146 8 Y 1 A GLY 13 ? A GLY 13 147 8 Y 1 A LEU 14 ? A LEU 14 148 8 Y 1 A VAL 15 ? A VAL 15 149 8 Y 1 A PRO 16 ? A PRO 16 150 8 Y 1 A ARG 17 ? A ARG 17 151 8 Y 1 A GLY 18 ? A GLY 18 152 8 Y 1 A SER 19 ? A SER 19 153 9 Y 1 A MET 1 ? A MET 1 154 9 Y 1 A GLY 2 ? A GLY 2 155 9 Y 1 A SER 3 ? A SER 3 156 9 Y 1 A SER 4 ? A SER 4 157 9 Y 1 A HIS 5 ? A HIS 5 158 9 Y 1 A HIS 6 ? A HIS 6 159 9 Y 1 A HIS 7 ? A HIS 7 160 9 Y 1 A HIS 8 ? A HIS 8 161 9 Y 1 A HIS 9 ? A HIS 9 162 9 Y 1 A HIS 10 ? A HIS 10 163 9 Y 1 A SER 11 ? A SER 11 164 9 Y 1 A SER 12 ? A SER 12 165 9 Y 1 A GLY 13 ? A GLY 13 166 9 Y 1 A LEU 14 ? A LEU 14 167 9 Y 1 A VAL 15 ? A VAL 15 168 9 Y 1 A PRO 16 ? A PRO 16 169 9 Y 1 A ARG 17 ? A ARG 17 170 9 Y 1 A GLY 18 ? A GLY 18 171 9 Y 1 A SER 19 ? A SER 19 172 10 Y 1 A MET 1 ? A MET 1 173 10 Y 1 A GLY 2 ? A GLY 2 174 10 Y 1 A SER 3 ? A SER 3 175 10 Y 1 A SER 4 ? A SER 4 176 10 Y 1 A HIS 5 ? A HIS 5 177 10 Y 1 A HIS 6 ? A HIS 6 178 10 Y 1 A HIS 7 ? A HIS 7 179 10 Y 1 A HIS 8 ? A HIS 8 180 10 Y 1 A HIS 9 ? A HIS 9 181 10 Y 1 A HIS 10 ? A HIS 10 182 10 Y 1 A SER 11 ? A SER 11 183 10 Y 1 A SER 12 ? A SER 12 184 10 Y 1 A GLY 13 ? A GLY 13 185 10 Y 1 A LEU 14 ? A LEU 14 186 10 Y 1 A VAL 15 ? A VAL 15 187 10 Y 1 A PRO 16 ? A PRO 16 188 10 Y 1 A ARG 17 ? A ARG 17 189 10 Y 1 A GLY 18 ? A GLY 18 190 10 Y 1 A SER 19 ? A SER 19 191 11 Y 1 A MET 1 ? A MET 1 192 11 Y 1 A GLY 2 ? A GLY 2 193 11 Y 1 A SER 3 ? A SER 3 194 11 Y 1 A SER 4 ? A SER 4 195 11 Y 1 A HIS 5 ? A HIS 5 196 11 Y 1 A HIS 6 ? A HIS 6 197 11 Y 1 A HIS 7 ? A HIS 7 198 11 Y 1 A HIS 8 ? A HIS 8 199 11 Y 1 A HIS 9 ? A HIS 9 200 11 Y 1 A HIS 10 ? A HIS 10 201 11 Y 1 A SER 11 ? A SER 11 202 11 Y 1 A SER 12 ? A SER 12 203 11 Y 1 A GLY 13 ? A GLY 13 204 11 Y 1 A LEU 14 ? A LEU 14 205 11 Y 1 A VAL 15 ? A VAL 15 206 11 Y 1 A PRO 16 ? A PRO 16 207 11 Y 1 A ARG 17 ? A ARG 17 208 11 Y 1 A GLY 18 ? A GLY 18 209 11 Y 1 A SER 19 ? A SER 19 210 12 Y 1 A MET 1 ? A MET 1 211 12 Y 1 A GLY 2 ? A GLY 2 212 12 Y 1 A SER 3 ? A SER 3 213 12 Y 1 A SER 4 ? A SER 4 214 12 Y 1 A HIS 5 ? A HIS 5 215 12 Y 1 A HIS 6 ? A HIS 6 216 12 Y 1 A HIS 7 ? A HIS 7 217 12 Y 1 A HIS 8 ? A HIS 8 218 12 Y 1 A HIS 9 ? A HIS 9 219 12 Y 1 A HIS 10 ? A HIS 10 220 12 Y 1 A SER 11 ? A SER 11 221 12 Y 1 A SER 12 ? A SER 12 222 12 Y 1 A GLY 13 ? A GLY 13 223 12 Y 1 A LEU 14 ? A LEU 14 224 12 Y 1 A VAL 15 ? A VAL 15 225 12 Y 1 A PRO 16 ? A PRO 16 226 12 Y 1 A ARG 17 ? A ARG 17 227 12 Y 1 A GLY 18 ? A GLY 18 228 12 Y 1 A SER 19 ? A SER 19 229 13 Y 1 A MET 1 ? A MET 1 230 13 Y 1 A GLY 2 ? A GLY 2 231 13 Y 1 A SER 3 ? A SER 3 232 13 Y 1 A SER 4 ? A SER 4 233 13 Y 1 A HIS 5 ? A HIS 5 234 13 Y 1 A HIS 6 ? A HIS 6 235 13 Y 1 A HIS 7 ? A HIS 7 236 13 Y 1 A HIS 8 ? A HIS 8 237 13 Y 1 A HIS 9 ? A HIS 9 238 13 Y 1 A HIS 10 ? A HIS 10 239 13 Y 1 A SER 11 ? A SER 11 240 13 Y 1 A SER 12 ? A SER 12 241 13 Y 1 A GLY 13 ? A GLY 13 242 13 Y 1 A LEU 14 ? A LEU 14 243 13 Y 1 A VAL 15 ? A VAL 15 244 13 Y 1 A PRO 16 ? A PRO 16 245 13 Y 1 A ARG 17 ? A ARG 17 246 13 Y 1 A GLY 18 ? A GLY 18 247 13 Y 1 A SER 19 ? A SER 19 248 14 Y 1 A MET 1 ? A MET 1 249 14 Y 1 A GLY 2 ? A GLY 2 250 14 Y 1 A SER 3 ? A SER 3 251 14 Y 1 A SER 4 ? A SER 4 252 14 Y 1 A HIS 5 ? A HIS 5 253 14 Y 1 A HIS 6 ? A HIS 6 254 14 Y 1 A HIS 7 ? A HIS 7 255 14 Y 1 A HIS 8 ? A HIS 8 256 14 Y 1 A HIS 9 ? A HIS 9 257 14 Y 1 A HIS 10 ? A HIS 10 258 14 Y 1 A SER 11 ? A SER 11 259 14 Y 1 A SER 12 ? A SER 12 260 14 Y 1 A GLY 13 ? A GLY 13 261 14 Y 1 A LEU 14 ? A LEU 14 262 14 Y 1 A VAL 15 ? A VAL 15 263 14 Y 1 A PRO 16 ? A PRO 16 264 14 Y 1 A ARG 17 ? A ARG 17 265 14 Y 1 A GLY 18 ? A GLY 18 266 14 Y 1 A SER 19 ? A SER 19 267 15 Y 1 A MET 1 ? A MET 1 268 15 Y 1 A GLY 2 ? A GLY 2 269 15 Y 1 A SER 3 ? A SER 3 270 15 Y 1 A SER 4 ? A SER 4 271 15 Y 1 A HIS 5 ? A HIS 5 272 15 Y 1 A HIS 6 ? A HIS 6 273 15 Y 1 A HIS 7 ? A HIS 7 274 15 Y 1 A HIS 8 ? A HIS 8 275 15 Y 1 A HIS 9 ? A HIS 9 276 15 Y 1 A HIS 10 ? A HIS 10 277 15 Y 1 A SER 11 ? A SER 11 278 15 Y 1 A SER 12 ? A SER 12 279 15 Y 1 A GLY 13 ? A GLY 13 280 15 Y 1 A LEU 14 ? A LEU 14 281 15 Y 1 A VAL 15 ? A VAL 15 282 15 Y 1 A PRO 16 ? A PRO 16 283 15 Y 1 A ARG 17 ? A ARG 17 284 15 Y 1 A GLY 18 ? A GLY 18 285 15 Y 1 A SER 19 ? A SER 19 286 16 Y 1 A MET 1 ? A MET 1 287 16 Y 1 A GLY 2 ? A GLY 2 288 16 Y 1 A SER 3 ? A SER 3 289 16 Y 1 A SER 4 ? A SER 4 290 16 Y 1 A HIS 5 ? A HIS 5 291 16 Y 1 A HIS 6 ? A HIS 6 292 16 Y 1 A HIS 7 ? A HIS 7 293 16 Y 1 A HIS 8 ? A HIS 8 294 16 Y 1 A HIS 9 ? A HIS 9 295 16 Y 1 A HIS 10 ? A HIS 10 296 16 Y 1 A SER 11 ? A SER 11 297 16 Y 1 A SER 12 ? A SER 12 298 16 Y 1 A GLY 13 ? A GLY 13 299 16 Y 1 A LEU 14 ? A LEU 14 300 16 Y 1 A VAL 15 ? A VAL 15 301 16 Y 1 A PRO 16 ? A PRO 16 302 16 Y 1 A ARG 17 ? A ARG 17 303 16 Y 1 A GLY 18 ? A GLY 18 304 16 Y 1 A SER 19 ? A SER 19 305 17 Y 1 A MET 1 ? A MET 1 306 17 Y 1 A GLY 2 ? A GLY 2 307 17 Y 1 A SER 3 ? A SER 3 308 17 Y 1 A SER 4 ? A SER 4 309 17 Y 1 A HIS 5 ? A HIS 5 310 17 Y 1 A HIS 6 ? A HIS 6 311 17 Y 1 A HIS 7 ? A HIS 7 312 17 Y 1 A HIS 8 ? A HIS 8 313 17 Y 1 A HIS 9 ? A HIS 9 314 17 Y 1 A HIS 10 ? A HIS 10 315 17 Y 1 A SER 11 ? A SER 11 316 17 Y 1 A SER 12 ? A SER 12 317 17 Y 1 A GLY 13 ? A GLY 13 318 17 Y 1 A LEU 14 ? A LEU 14 319 17 Y 1 A VAL 15 ? A VAL 15 320 17 Y 1 A PRO 16 ? A PRO 16 321 17 Y 1 A ARG 17 ? A ARG 17 322 17 Y 1 A GLY 18 ? A GLY 18 323 17 Y 1 A SER 19 ? A SER 19 324 18 Y 1 A MET 1 ? A MET 1 325 18 Y 1 A GLY 2 ? A GLY 2 326 18 Y 1 A SER 3 ? A SER 3 327 18 Y 1 A SER 4 ? A SER 4 328 18 Y 1 A HIS 5 ? A HIS 5 329 18 Y 1 A HIS 6 ? A HIS 6 330 18 Y 1 A HIS 7 ? A HIS 7 331 18 Y 1 A HIS 8 ? A HIS 8 332 18 Y 1 A HIS 9 ? A HIS 9 333 18 Y 1 A HIS 10 ? A HIS 10 334 18 Y 1 A SER 11 ? A SER 11 335 18 Y 1 A SER 12 ? A SER 12 336 18 Y 1 A GLY 13 ? A GLY 13 337 18 Y 1 A LEU 14 ? A LEU 14 338 18 Y 1 A VAL 15 ? A VAL 15 339 18 Y 1 A PRO 16 ? A PRO 16 340 18 Y 1 A ARG 17 ? A ARG 17 341 18 Y 1 A GLY 18 ? A GLY 18 342 18 Y 1 A SER 19 ? A SER 19 343 19 Y 1 A MET 1 ? A MET 1 344 19 Y 1 A GLY 2 ? A GLY 2 345 19 Y 1 A SER 3 ? A SER 3 346 19 Y 1 A SER 4 ? A SER 4 347 19 Y 1 A HIS 5 ? A HIS 5 348 19 Y 1 A HIS 6 ? A HIS 6 349 19 Y 1 A HIS 7 ? A HIS 7 350 19 Y 1 A HIS 8 ? A HIS 8 351 19 Y 1 A HIS 9 ? A HIS 9 352 19 Y 1 A HIS 10 ? A HIS 10 353 19 Y 1 A SER 11 ? A SER 11 354 19 Y 1 A SER 12 ? A SER 12 355 19 Y 1 A GLY 13 ? A GLY 13 356 19 Y 1 A LEU 14 ? A LEU 14 357 19 Y 1 A VAL 15 ? A VAL 15 358 19 Y 1 A PRO 16 ? A PRO 16 359 19 Y 1 A ARG 17 ? A ARG 17 360 19 Y 1 A GLY 18 ? A GLY 18 361 19 Y 1 A SER 19 ? A SER 19 362 20 Y 1 A MET 1 ? A MET 1 363 20 Y 1 A GLY 2 ? A GLY 2 364 20 Y 1 A SER 3 ? A SER 3 365 20 Y 1 A SER 4 ? A SER 4 366 20 Y 1 A HIS 5 ? A HIS 5 367 20 Y 1 A HIS 6 ? A HIS 6 368 20 Y 1 A HIS 7 ? A HIS 7 369 20 Y 1 A HIS 8 ? A HIS 8 370 20 Y 1 A HIS 9 ? A HIS 9 371 20 Y 1 A HIS 10 ? A HIS 10 372 20 Y 1 A SER 11 ? A SER 11 373 20 Y 1 A SER 12 ? A SER 12 374 20 Y 1 A GLY 13 ? A GLY 13 375 20 Y 1 A LEU 14 ? A LEU 14 376 20 Y 1 A VAL 15 ? A VAL 15 377 20 Y 1 A PRO 16 ? A PRO 16 378 20 Y 1 A ARG 17 ? A ARG 17 379 20 Y 1 A GLY 18 ? A GLY 18 380 20 Y 1 A SER 19 ? A SER 19 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PRO N N N N 220 PRO CA C N S 221 PRO C C N N 222 PRO O O N N 223 PRO CB C N N 224 PRO CG C N N 225 PRO CD C N N 226 PRO OXT O N N 227 PRO H H N N 228 PRO HA H N N 229 PRO HB2 H N N 230 PRO HB3 H N N 231 PRO HG2 H N N 232 PRO HG3 H N N 233 PRO HD2 H N N 234 PRO HD3 H N N 235 PRO HXT H N N 236 SER N N N N 237 SER CA C N S 238 SER C C N N 239 SER O O N N 240 SER CB C N N 241 SER OG O N N 242 SER OXT O N N 243 SER H H N N 244 SER H2 H N N 245 SER HA H N N 246 SER HB2 H N N 247 SER HB3 H N N 248 SER HG H N N 249 SER HXT H N N 250 THR N N N N 251 THR CA C N S 252 THR C C N N 253 THR O O N N 254 THR CB C N R 255 THR OG1 O N N 256 THR CG2 C N N 257 THR OXT O N N 258 THR H H N N 259 THR H2 H N N 260 THR HA H N N 261 THR HB H N N 262 THR HG1 H N N 263 THR HG21 H N N 264 THR HG22 H N N 265 THR HG23 H N N 266 THR HXT H N N 267 TRP N N N N 268 TRP CA C N S 269 TRP C C N N 270 TRP O O N N 271 TRP CB C N N 272 TRP CG C Y N 273 TRP CD1 C Y N 274 TRP CD2 C Y N 275 TRP NE1 N Y N 276 TRP CE2 C Y N 277 TRP CE3 C Y N 278 TRP CZ2 C Y N 279 TRP CZ3 C Y N 280 TRP CH2 C Y N 281 TRP OXT O N N 282 TRP H H N N 283 TRP H2 H N N 284 TRP HA H N N 285 TRP HB2 H N N 286 TRP HB3 H N N 287 TRP HD1 H N N 288 TRP HE1 H N N 289 TRP HE3 H N N 290 TRP HZ2 H N N 291 TRP HZ3 H N N 292 TRP HH2 H N N 293 TRP HXT H N N 294 TYR N N N N 295 TYR CA C N S 296 TYR C C N N 297 TYR O O N N 298 TYR CB C N N 299 TYR CG C Y N 300 TYR CD1 C Y N 301 TYR CD2 C Y N 302 TYR CE1 C Y N 303 TYR CE2 C Y N 304 TYR CZ C Y N 305 TYR OH O N N 306 TYR OXT O N N 307 TYR H H N N 308 TYR H2 H N N 309 TYR HA H N N 310 TYR HB2 H N N 311 TYR HB3 H N N 312 TYR HD1 H N N 313 TYR HD2 H N N 314 TYR HE1 H N N 315 TYR HE2 H N N 316 TYR HH H N N 317 TYR HXT H N N 318 VAL N N N N 319 VAL CA C N S 320 VAL C C N N 321 VAL O O N N 322 VAL CB C N N 323 VAL CG1 C N N 324 VAL CG2 C N N 325 VAL OXT O N N 326 VAL H H N N 327 VAL H2 H N N 328 VAL HA H N N 329 VAL HB H N N 330 VAL HG11 H N N 331 VAL HG12 H N N 332 VAL HG13 H N N 333 VAL HG21 H N N 334 VAL HG22 H N N 335 VAL HG23 H N N 336 VAL HXT H N N 337 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 GLN N CA sing N N 58 GLN N H sing N N 59 GLN N H2 sing N N 60 GLN CA C sing N N 61 GLN CA CB sing N N 62 GLN CA HA sing N N 63 GLN C O doub N N 64 GLN C OXT sing N N 65 GLN CB CG sing N N 66 GLN CB HB2 sing N N 67 GLN CB HB3 sing N N 68 GLN CG CD sing N N 69 GLN CG HG2 sing N N 70 GLN CG HG3 sing N N 71 GLN CD OE1 doub N N 72 GLN CD NE2 sing N N 73 GLN NE2 HE21 sing N N 74 GLN NE2 HE22 sing N N 75 GLN OXT HXT sing N N 76 GLU N CA sing N N 77 GLU N H sing N N 78 GLU N H2 sing N N 79 GLU CA C sing N N 80 GLU CA CB sing N N 81 GLU CA HA sing N N 82 GLU C O doub N N 83 GLU C OXT sing N N 84 GLU CB CG sing N N 85 GLU CB HB2 sing N N 86 GLU CB HB3 sing N N 87 GLU CG CD sing N N 88 GLU CG HG2 sing N N 89 GLU CG HG3 sing N N 90 GLU CD OE1 doub N N 91 GLU CD OE2 sing N N 92 GLU OE2 HE2 sing N N 93 GLU OXT HXT sing N N 94 GLY N CA sing N N 95 GLY N H sing N N 96 GLY N H2 sing N N 97 GLY CA C sing N N 98 GLY CA HA2 sing N N 99 GLY CA HA3 sing N N 100 GLY C O doub N N 101 GLY C OXT sing N N 102 GLY OXT HXT sing N N 103 HIS N CA sing N N 104 HIS N H sing N N 105 HIS N H2 sing N N 106 HIS CA C sing N N 107 HIS CA CB sing N N 108 HIS CA HA sing N N 109 HIS C O doub N N 110 HIS C OXT sing N N 111 HIS CB CG sing N N 112 HIS CB HB2 sing N N 113 HIS CB HB3 sing N N 114 HIS CG ND1 sing Y N 115 HIS CG CD2 doub Y N 116 HIS ND1 CE1 doub Y N 117 HIS ND1 HD1 sing N N 118 HIS CD2 NE2 sing Y N 119 HIS CD2 HD2 sing N N 120 HIS CE1 NE2 sing Y N 121 HIS CE1 HE1 sing N N 122 HIS NE2 HE2 sing N N 123 HIS OXT HXT sing N N 124 ILE N CA sing N N 125 ILE N H sing N N 126 ILE N H2 sing N N 127 ILE CA C sing N N 128 ILE CA CB sing N N 129 ILE CA HA sing N N 130 ILE C O doub N N 131 ILE C OXT sing N N 132 ILE CB CG1 sing N N 133 ILE CB CG2 sing N N 134 ILE CB HB sing N N 135 ILE CG1 CD1 sing N N 136 ILE CG1 HG12 sing N N 137 ILE CG1 HG13 sing N N 138 ILE CG2 HG21 sing N N 139 ILE CG2 HG22 sing N N 140 ILE CG2 HG23 sing N N 141 ILE CD1 HD11 sing N N 142 ILE CD1 HD12 sing N N 143 ILE CD1 HD13 sing N N 144 ILE OXT HXT sing N N 145 LEU N CA sing N N 146 LEU N H sing N N 147 LEU N H2 sing N N 148 LEU CA C sing N N 149 LEU CA CB sing N N 150 LEU CA HA sing N N 151 LEU C O doub N N 152 LEU C OXT sing N N 153 LEU CB CG sing N N 154 LEU CB HB2 sing N N 155 LEU CB HB3 sing N N 156 LEU CG CD1 sing N N 157 LEU CG CD2 sing N N 158 LEU CG HG sing N N 159 LEU CD1 HD11 sing N N 160 LEU CD1 HD12 sing N N 161 LEU CD1 HD13 sing N N 162 LEU CD2 HD21 sing N N 163 LEU CD2 HD22 sing N N 164 LEU CD2 HD23 sing N N 165 LEU OXT HXT sing N N 166 LYS N CA sing N N 167 LYS N H sing N N 168 LYS N H2 sing N N 169 LYS CA C sing N N 170 LYS CA CB sing N N 171 LYS CA HA sing N N 172 LYS C O doub N N 173 LYS C OXT sing N N 174 LYS CB CG sing N N 175 LYS CB HB2 sing N N 176 LYS CB HB3 sing N N 177 LYS CG CD sing N N 178 LYS CG HG2 sing N N 179 LYS CG HG3 sing N N 180 LYS CD CE sing N N 181 LYS CD HD2 sing N N 182 LYS CD HD3 sing N N 183 LYS CE NZ sing N N 184 LYS CE HE2 sing N N 185 LYS CE HE3 sing N N 186 LYS NZ HZ1 sing N N 187 LYS NZ HZ2 sing N N 188 LYS NZ HZ3 sing N N 189 LYS OXT HXT sing N N 190 MET N CA sing N N 191 MET N H sing N N 192 MET N H2 sing N N 193 MET CA C sing N N 194 MET CA CB sing N N 195 MET CA HA sing N N 196 MET C O doub N N 197 MET C OXT sing N N 198 MET CB CG sing N N 199 MET CB HB2 sing N N 200 MET CB HB3 sing N N 201 MET CG SD sing N N 202 MET CG HG2 sing N N 203 MET CG HG3 sing N N 204 MET SD CE sing N N 205 MET CE HE1 sing N N 206 MET CE HE2 sing N N 207 MET CE HE3 sing N N 208 MET OXT HXT sing N N 209 PRO N CA sing N N 210 PRO N CD sing N N 211 PRO N H sing N N 212 PRO CA C sing N N 213 PRO CA CB sing N N 214 PRO CA HA sing N N 215 PRO C O doub N N 216 PRO C OXT sing N N 217 PRO CB CG sing N N 218 PRO CB HB2 sing N N 219 PRO CB HB3 sing N N 220 PRO CG CD sing N N 221 PRO CG HG2 sing N N 222 PRO CG HG3 sing N N 223 PRO CD HD2 sing N N 224 PRO CD HD3 sing N N 225 PRO OXT HXT sing N N 226 SER N CA sing N N 227 SER N H sing N N 228 SER N H2 sing N N 229 SER CA C sing N N 230 SER CA CB sing N N 231 SER CA HA sing N N 232 SER C O doub N N 233 SER C OXT sing N N 234 SER CB OG sing N N 235 SER CB HB2 sing N N 236 SER CB HB3 sing N N 237 SER OG HG sing N N 238 SER OXT HXT sing N N 239 THR N CA sing N N 240 THR N H sing N N 241 THR N H2 sing N N 242 THR CA C sing N N 243 THR CA CB sing N N 244 THR CA HA sing N N 245 THR C O doub N N 246 THR C OXT sing N N 247 THR CB OG1 sing N N 248 THR CB CG2 sing N N 249 THR CB HB sing N N 250 THR OG1 HG1 sing N N 251 THR CG2 HG21 sing N N 252 THR CG2 HG22 sing N N 253 THR CG2 HG23 sing N N 254 THR OXT HXT sing N N 255 TRP N CA sing N N 256 TRP N H sing N N 257 TRP N H2 sing N N 258 TRP CA C sing N N 259 TRP CA CB sing N N 260 TRP CA HA sing N N 261 TRP C O doub N N 262 TRP C OXT sing N N 263 TRP CB CG sing N N 264 TRP CB HB2 sing N N 265 TRP CB HB3 sing N N 266 TRP CG CD1 doub Y N 267 TRP CG CD2 sing Y N 268 TRP CD1 NE1 sing Y N 269 TRP CD1 HD1 sing N N 270 TRP CD2 CE2 doub Y N 271 TRP CD2 CE3 sing Y N 272 TRP NE1 CE2 sing Y N 273 TRP NE1 HE1 sing N N 274 TRP CE2 CZ2 sing Y N 275 TRP CE3 CZ3 doub Y N 276 TRP CE3 HE3 sing N N 277 TRP CZ2 CH2 doub Y N 278 TRP CZ2 HZ2 sing N N 279 TRP CZ3 CH2 sing Y N 280 TRP CZ3 HZ3 sing N N 281 TRP CH2 HH2 sing N N 282 TRP OXT HXT sing N N 283 TYR N CA sing N N 284 TYR N H sing N N 285 TYR N H2 sing N N 286 TYR CA C sing N N 287 TYR CA CB sing N N 288 TYR CA HA sing N N 289 TYR C O doub N N 290 TYR C OXT sing N N 291 TYR CB CG sing N N 292 TYR CB HB2 sing N N 293 TYR CB HB3 sing N N 294 TYR CG CD1 doub Y N 295 TYR CG CD2 sing Y N 296 TYR CD1 CE1 sing Y N 297 TYR CD1 HD1 sing N N 298 TYR CD2 CE2 doub Y N 299 TYR CD2 HD2 sing N N 300 TYR CE1 CZ doub Y N 301 TYR CE1 HE1 sing N N 302 TYR CE2 CZ sing Y N 303 TYR CE2 HE2 sing N N 304 TYR CZ OH sing N N 305 TYR OH HH sing N N 306 TYR OXT HXT sing N N 307 VAL N CA sing N N 308 VAL N H sing N N 309 VAL N H2 sing N N 310 VAL CA C sing N N 311 VAL CA CB sing N N 312 VAL CA HA sing N N 313 VAL C O doub N N 314 VAL C OXT sing N N 315 VAL CB CG1 sing N N 316 VAL CB CG2 sing N N 317 VAL CB HB sing N N 318 VAL CG1 HG11 sing N N 319 VAL CG1 HG12 sing N N 320 VAL CG1 HG13 sing N N 321 VAL CG2 HG21 sing N N 322 VAL CG2 HG22 sing N N 323 VAL CG2 HG23 sing N N 324 VAL OXT HXT sing N N 325 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE II' ? Bruker 800 ? # _atom_sites.entry_id 5UYO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_