data_5VA4 # _entry.id 5VA4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5VA4 pdb_00005va4 10.2210/pdb5va4/pdb WWPDB D_1000227106 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '5IEA is a similar structure from a different species.' _pdbx_database_related.db_id 5IEA _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VA4 _pdbx_database_status.recvd_initial_deposition_date 2017-03-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wagner, J.M.' 1 ? 'Ganser-Pornillos, B.K.' 2 ? 'Pornillos, O.W.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Virol.' _citation.journal_id_ASTM JOVIAM _citation.journal_id_CSD 0825 _citation.journal_id_ISSN 1098-5514 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 92 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'General Model for Retroviral Capsid Pattern Recognition by TRIM5 Proteins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/JVI.01563-17 _citation.pdbx_database_id_PubMed 29187540 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wagner, J.M.' 1 ? primary 'Christensen, D.E.' 2 ? primary 'Bhattacharya, A.' 3 ? primary 'Dawidziak, D.M.' 4 ? primary 'Roganowicz, M.D.' 5 ? primary 'Wan, Y.' 6 ? primary 'Pumroy, R.A.' 7 ? primary 'Demeler, B.' 8 ? primary 'Ivanov, D.N.' 9 ? primary 'Ganser-Pornillos, B.K.' 10 ? primary 'Sundquist, W.I.' 11 ? primary 'Pornillos, O.' 12 ? # _cell.entry_id 5VA4 _cell.length_a 104.596 _cell.length_b 104.596 _cell.length_c 104.596 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VA4 _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TRIM5/cyclophilin A V4 fusion protein' 16139.511 1 6.1.1.11 ? ? 'This is a chimera between TRIM5 sequence taken from TRIM-Cyclophilin A, and a bacterial tRNA synthetase sequence.' 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 3 water nat water 18.015 25 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Seryl-tRNA synthetase,SerRS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EEGQKVDHCAHHGEKLVLFCQQDGNVICWLCERSQEHRGHQTFLVEEVAQKYREKLQVALEMMRQKQKDAETECNQVAKR VPKAPPEEKEALIARGKACGEQTQSVRVLISDLEHRLQGSVMELLQGVDGVIKRIEKVTLQ ; _entity_poly.pdbx_seq_one_letter_code_can ;EEGQKVDHCAHHGEKLVLFCQQDGNVICWLCERSQEHRGHQTFLVEEVAQKYREKLQVALEMMRQKQKDAETECNQVAKR VPKAPPEEKEALIARGKACGEQTQSVRVLISDLEHRLQGSVMELLQGVDGVIKRIEKVTLQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 GLY n 1 4 GLN n 1 5 LYS n 1 6 VAL n 1 7 ASP n 1 8 HIS n 1 9 CYS n 1 10 ALA n 1 11 HIS n 1 12 HIS n 1 13 GLY n 1 14 GLU n 1 15 LYS n 1 16 LEU n 1 17 VAL n 1 18 LEU n 1 19 PHE n 1 20 CYS n 1 21 GLN n 1 22 GLN n 1 23 ASP n 1 24 GLY n 1 25 ASN n 1 26 VAL n 1 27 ILE n 1 28 CYS n 1 29 TRP n 1 30 LEU n 1 31 CYS n 1 32 GLU n 1 33 ARG n 1 34 SER n 1 35 GLN n 1 36 GLU n 1 37 HIS n 1 38 ARG n 1 39 GLY n 1 40 HIS n 1 41 GLN n 1 42 THR n 1 43 PHE n 1 44 LEU n 1 45 VAL n 1 46 GLU n 1 47 GLU n 1 48 VAL n 1 49 ALA n 1 50 GLN n 1 51 LYS n 1 52 TYR n 1 53 ARG n 1 54 GLU n 1 55 LYS n 1 56 LEU n 1 57 GLN n 1 58 VAL n 1 59 ALA n 1 60 LEU n 1 61 GLU n 1 62 MET n 1 63 MET n 1 64 ARG n 1 65 GLN n 1 66 LYS n 1 67 GLN n 1 68 LYS n 1 69 ASP n 1 70 ALA n 1 71 GLU n 1 72 THR n 1 73 GLU n 1 74 CYS n 1 75 ASN n 1 76 GLN n 1 77 VAL n 1 78 ALA n 1 79 LYS n 1 80 ARG n 1 81 VAL n 1 82 PRO n 1 83 LYS n 1 84 ALA n 1 85 PRO n 1 86 PRO n 1 87 GLU n 1 88 GLU n 1 89 LYS n 1 90 GLU n 1 91 ALA n 1 92 LEU n 1 93 ILE n 1 94 ALA n 1 95 ARG n 1 96 GLY n 1 97 LYS n 1 98 ALA n 1 99 CYS n 1 100 GLY n 1 101 GLU n 1 102 GLN n 1 103 THR n 1 104 GLN n 1 105 SER n 1 106 VAL n 1 107 ARG n 1 108 VAL n 1 109 LEU n 1 110 ILE n 1 111 SER n 1 112 ASP n 1 113 LEU n 1 114 GLU n 1 115 HIS n 1 116 ARG n 1 117 LEU n 1 118 GLN n 1 119 GLY n 1 120 SER n 1 121 VAL n 1 122 MET n 1 123 GLU n 1 124 LEU n 1 125 LEU n 1 126 GLN n 1 127 GLY n 1 128 VAL n 1 129 ASP n 1 130 GLY n 1 131 VAL n 1 132 ILE n 1 133 LYS n 1 134 ARG n 1 135 ILE n 1 136 GLU n 1 137 LYS n 1 138 VAL n 1 139 THR n 1 140 LEU n 1 141 GLN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 71 'Three-striped night monkey' ? ? ? ? ? ? ? ? 'Aotus trivirgatus' 9505 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 72 101 ? ? 'serS, TT_C0520' ? 'HB27 / ATCC BAA-163 / DSM 7039' ? ? ? ? 'Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)' 262724 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 3 sample 'Biological sequence' 102 141 'Three-striped night monkey' ? ? ? ? ? ? ? ? 'Aotus trivirgatus' 9505 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q68KK2_AOTTR Q68KK2 ? 1 EEGQKVDHCAHHGEKLVLFCQQDGNVICWLCERSQEHRGHQTFLVEEVAQKYREKLQVALEMMRQKQKDAE 88 2 UNP SYS_THET2 P34945 ? 1 TERNQVAKRVPKAPPEEKEALIARGKALGE 49 3 UNP Q68KK2_AOTTR Q68KK2 ? 1 QTQSVRVLISDLEHRLQGSVMELLQGVDGVIKRIEKVTLQ 225 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5VA4 A 1 ? 71 ? Q68KK2 88 ? 158 ? 88 158 2 2 5VA4 A 72 ? 101 ? P34945 49 ? 78 ? 159 188 3 3 5VA4 A 102 ? 141 ? Q68KK2 225 ? 264 ? 189 228 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 5VA4 CYS A 74 ? UNP P34945 ARG 51 conflict 161 1 2 5VA4 CYS A 99 ? UNP P34945 LEU 76 conflict 186 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VA4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.36 _exptl_crystal.description 'cubes or prisms' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '17% PEG 3350, 0.4 M sodium/potassium tartrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details 'cryo stream' _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-02-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5VA4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8544 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.131 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.045 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1281 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.5 _reflns_shell.pdbx_Rsym_value 1.000 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.681 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5VA4 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8544 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.954 _refine.ls_d_res_high 2.306 _refine.ls_percent_reflns_obs 99.64 _refine.ls_R_factor_obs 0.2364 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2305 _refine.ls_R_factor_R_free 0.2874 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.09 _refine.ls_number_reflns_R_free 862 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 5EIU _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.35 _refine.pdbx_overall_phase_error 34.82 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 982 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 1010 _refine_hist.d_res_high 2.306 _refine_hist.d_res_low 27.954 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.008 ? ? 1002 'X-RAY DIFFRACTION' ? f_angle_d 0.375 ? ? 1324 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 13.365 ? ? 614 'X-RAY DIFFRACTION' ? f_chiral_restr 0.032 ? ? 148 'X-RAY DIFFRACTION' ? f_plane_restr 0.001 ? ? 173 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.3056 2.4500 1281 0.3071 100.00 0.3498 . . 144 . . . . 'X-RAY DIFFRACTION' . 2.4500 2.6391 1262 0.3051 100.00 0.3326 . . 140 . . . . 'X-RAY DIFFRACTION' . 2.6391 2.9044 1275 0.2975 100.00 0.3396 . . 143 . . . . 'X-RAY DIFFRACTION' . 2.9044 3.3241 1263 0.2832 100.00 0.3524 . . 137 . . . . 'X-RAY DIFFRACTION' . 3.3241 4.1857 1300 0.2321 100.00 0.2579 . . 150 . . . . 'X-RAY DIFFRACTION' . 4.1857 27.9565 1301 0.2008 98.00 0.2765 . . 148 . . . . # _struct.entry_id 5VA4 _struct.title 'TRIM-Cyclophilin A B-box 2 and coiled-coil chimera' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VA4 _struct_keywords.text 'B-box, trimer, self-assembly, zinc binding, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 28 ? SER A 34 ? CYS A 115 SER A 121 1 ? 7 HELX_P HELX_P2 AA2 GLN A 35 ? ARG A 38 ? GLN A 122 ARG A 125 5 ? 4 HELX_P HELX_P3 AA3 VAL A 45 ? VAL A 81 ? VAL A 132 VAL A 168 1 ? 37 HELX_P HELX_P4 AA4 LEU A 92 ? THR A 103 ? LEU A 179 THR A 190 1 ? 12 HELX_P HELX_P5 AA5 THR A 103 ? GLY A 119 ? THR A 190 GLY A 206 1 ? 17 HELX_P HELX_P6 AA6 SER A 120 ? GLN A 126 ? SER A 207 GLN A 213 1 ? 7 HELX_P HELX_P7 AA7 GLY A 127 ? VAL A 138 ? GLY A 214 VAL A 225 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 9 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 96 A ZN 702 1_555 ? ? ? ? ? ? ? 2.182 ? ? metalc2 metalc ? ? A HIS 11 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 98 A ZN 703 19_445 ? ? ? ? ? ? ? 2.359 ? ? metalc3 metalc ? ? A HIS 12 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 99 A ZN 702 1_555 ? ? ? ? ? ? ? 2.015 ? ? metalc4 metalc ? ? A CYS 20 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 107 A ZN 701 1_555 ? ? ? ? ? ? ? 2.222 ? ? metalc5 metalc ? ? A ASP 23 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 110 A ZN 701 1_555 ? ? ? ? ? ? ? 1.985 ? ? metalc6 metalc ? ? A CYS 28 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 115 A ZN 702 1_555 ? ? ? ? ? ? ? 2.217 ? ? metalc7 metalc ? ? A CYS 31 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 118 A ZN 702 1_555 ? ? ? ? ? ? ? 2.154 ? ? metalc8 metalc ? ? A HIS 37 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 124 A ZN 701 1_555 ? ? ? ? ? ? ? 2.016 ? ? metalc9 metalc ? ? A HIS 40 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 127 A ZN 701 1_555 ? ? ? ? ? ? ? 2.020 ? ? metalc10 metalc ? ? A GLU 71 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 158 A ZN 703 1_555 ? ? ? ? ? ? ? 2.023 ? ? metalc11 metalc ? ? A CYS 74 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 161 A ZN 703 1_555 ? ? ? ? ? ? ? 2.364 ? ? metalc12 metalc ? ? A CYS 99 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 186 A ZN 703 1_555 ? ? ? ? ? ? ? 2.362 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 26 ? ILE A 27 ? VAL A 113 ILE A 114 AA1 2 LEU A 18 ? CYS A 20 ? LEU A 105 CYS A 107 AA1 3 THR A 42 ? LEU A 44 ? THR A 129 LEU A 131 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 27 ? O ILE A 114 N LEU A 18 ? N LEU A 105 AA1 2 3 N PHE A 19 ? N PHE A 106 O PHE A 43 ? O PHE A 130 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 701 ? 4 'binding site for residue ZN A 701' AC2 Software A ZN 702 ? 4 'binding site for residue ZN A 702' AC3 Software A ZN 703 ? 4 'binding site for residue ZN A 703' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 20 ? CYS A 107 . ? 1_555 ? 2 AC1 4 ASP A 23 ? ASP A 110 . ? 1_555 ? 3 AC1 4 HIS A 37 ? HIS A 124 . ? 1_555 ? 4 AC1 4 HIS A 40 ? HIS A 127 . ? 1_555 ? 5 AC2 4 CYS A 9 ? CYS A 96 . ? 1_555 ? 6 AC2 4 HIS A 12 ? HIS A 99 . ? 1_555 ? 7 AC2 4 CYS A 28 ? CYS A 115 . ? 1_555 ? 8 AC2 4 CYS A 31 ? CYS A 118 . ? 1_555 ? 9 AC3 4 HIS A 11 ? HIS A 98 . ? 22_444 ? 10 AC3 4 GLU A 71 ? GLU A 158 . ? 1_555 ? 11 AC3 4 CYS A 74 ? CYS A 161 . ? 1_555 ? 12 AC3 4 CYS A 99 ? CYS A 186 . ? 1_555 ? # _atom_sites.entry_id 5VA4 _atom_sites.fract_transf_matrix[1][1] 0.009561 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009561 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009561 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N NA O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 88 ? ? ? A . n A 1 2 GLU 2 89 ? ? ? A . n A 1 3 GLY 3 90 ? ? ? A . n A 1 4 GLN 4 91 ? ? ? A . n A 1 5 LYS 5 92 ? ? ? A . n A 1 6 VAL 6 93 ? ? ? A . n A 1 7 ASP 7 94 95 ASP ASP A . n A 1 8 HIS 8 95 96 HIS HIS A . n A 1 9 CYS 9 96 97 CYS CYS A . n A 1 10 ALA 10 97 98 ALA ALA A . n A 1 11 HIS 11 98 99 HIS HIS A . n A 1 12 HIS 12 99 100 HIS HIS A . n A 1 13 GLY 13 100 101 GLY GLY A . n A 1 14 GLU 14 101 102 GLU GLU A . n A 1 15 LYS 15 102 103 LYS LYS A . n A 1 16 LEU 16 103 104 LEU LEU A . n A 1 17 VAL 17 104 105 VAL VAL A . n A 1 18 LEU 18 105 106 LEU LEU A . n A 1 19 PHE 19 106 107 PHE PHE A . n A 1 20 CYS 20 107 108 CYS CYS A . n A 1 21 GLN 21 108 109 GLN GLN A . n A 1 22 GLN 22 109 110 GLN GLN A . n A 1 23 ASP 23 110 111 ASP ASP A . n A 1 24 GLY 24 111 112 GLY GLY A . n A 1 25 ASN 25 112 113 ASN ASN A . n A 1 26 VAL 26 113 114 VAL VAL A . n A 1 27 ILE 27 114 115 ILE ILE A . n A 1 28 CYS 28 115 116 CYS CYS A . n A 1 29 TRP 29 116 117 TRP TRP A . n A 1 30 LEU 30 117 118 LEU LEU A . n A 1 31 CYS 31 118 119 CYS CYS A . n A 1 32 GLU 32 119 120 GLU GLU A . n A 1 33 ARG 33 120 121 ARG ARG A . n A 1 34 SER 34 121 122 SER SER A . n A 1 35 GLN 35 122 123 GLN GLN A . n A 1 36 GLU 36 123 124 GLU GLU A . n A 1 37 HIS 37 124 125 HIS HIS A . n A 1 38 ARG 38 125 126 ARG ARG A . n A 1 39 GLY 39 126 127 GLY GLY A . n A 1 40 HIS 40 127 128 HIS HIS A . n A 1 41 GLN 41 128 129 GLN GLN A . n A 1 42 THR 42 129 130 THR THR A . n A 1 43 PHE 43 130 131 PHE PHE A . n A 1 44 LEU 44 131 132 LEU LEU A . n A 1 45 VAL 45 132 133 VAL VAL A . n A 1 46 GLU 46 133 134 GLU GLU A . n A 1 47 GLU 47 134 135 GLU GLU A . n A 1 48 VAL 48 135 136 VAL VAL A . n A 1 49 ALA 49 136 137 ALA ALA A . n A 1 50 GLN 50 137 138 GLN GLN A . n A 1 51 LYS 51 138 139 LYS LYS A . n A 1 52 TYR 52 139 140 TYR TYR A . n A 1 53 ARG 53 140 141 ARG ARG A . n A 1 54 GLU 54 141 142 GLU GLU A . n A 1 55 LYS 55 142 143 LYS LYS A . n A 1 56 LEU 56 143 144 LEU LEU A . n A 1 57 GLN 57 144 145 GLN GLN A . n A 1 58 VAL 58 145 146 VAL VAL A . n A 1 59 ALA 59 146 147 ALA ALA A . n A 1 60 LEU 60 147 148 LEU LEU A . n A 1 61 GLU 61 148 149 GLU GLU A . n A 1 62 MET 62 149 150 MET MET A . n A 1 63 MET 63 150 151 MET MET A . n A 1 64 ARG 64 151 152 ARG ARG A . n A 1 65 GLN 65 152 153 GLN GLN A . n A 1 66 LYS 66 153 154 LYS LYS A . n A 1 67 GLN 67 154 155 GLN GLN A . n A 1 68 LYS 68 155 156 LYS LYS A . n A 1 69 ASP 69 156 157 ASP ASP A . n A 1 70 ALA 70 157 158 ALA ALA A . n A 1 71 GLU 71 158 159 GLU GLU A . n A 1 72 THR 72 159 160 THR THR A . n A 1 73 GLU 73 160 161 GLU GLU A . n A 1 74 CYS 74 161 162 CYS CYS A . n A 1 75 ASN 75 162 163 ASN ASN A . n A 1 76 GLN 76 163 164 GLN GLN A . n A 1 77 VAL 77 164 165 VAL VAL A . n A 1 78 ALA 78 165 166 ALA ALA A . n A 1 79 LYS 79 166 167 LYS LYS A . n A 1 80 ARG 80 167 168 ARG ARG A . n A 1 81 VAL 81 168 169 VAL VAL A . n A 1 82 PRO 82 169 ? ? ? A . n A 1 83 LYS 83 170 ? ? ? A . n A 1 84 ALA 84 171 ? ? ? A . n A 1 85 PRO 85 172 ? ? ? A . n A 1 86 PRO 86 173 ? ? ? A . n A 1 87 GLU 87 174 ? ? ? A . n A 1 88 GLU 88 175 ? ? ? A . n A 1 89 LYS 89 176 ? ? ? A . n A 1 90 GLU 90 177 ? ? ? A . n A 1 91 ALA 91 178 179 ALA ALA A . n A 1 92 LEU 92 179 180 LEU LEU A . n A 1 93 ILE 93 180 181 ILE ILE A . n A 1 94 ALA 94 181 182 ALA ALA A . n A 1 95 ARG 95 182 183 ARG ARG A . n A 1 96 GLY 96 183 184 GLY GLY A . n A 1 97 LYS 97 184 185 LYS LYS A . n A 1 98 ALA 98 185 186 ALA ALA A . n A 1 99 CYS 99 186 187 CYS CYS A . n A 1 100 GLY 100 187 188 GLY GLY A . n A 1 101 GLU 101 188 189 GLU GLU A . n A 1 102 GLN 102 189 190 GLN GLN A . n A 1 103 THR 103 190 191 THR THR A . n A 1 104 GLN 104 191 192 GLN GLN A . n A 1 105 SER 105 192 193 SER SER A . n A 1 106 VAL 106 193 194 VAL VAL A . n A 1 107 ARG 107 194 195 ARG ARG A . n A 1 108 VAL 108 195 196 VAL VAL A . n A 1 109 LEU 109 196 197 LEU LEU A . n A 1 110 ILE 110 197 198 ILE ILE A . n A 1 111 SER 111 198 199 SER SER A . n A 1 112 ASP 112 199 200 ASP ASP A . n A 1 113 LEU 113 200 201 LEU LEU A . n A 1 114 GLU 114 201 202 GLU GLU A . n A 1 115 HIS 115 202 203 HIS HIS A . n A 1 116 ARG 116 203 204 ARG ARG A . n A 1 117 LEU 117 204 205 LEU LEU A . n A 1 118 GLN 118 205 206 GLN GLN A . n A 1 119 GLY 119 206 207 GLY GLY A . n A 1 120 SER 120 207 208 SER SER A . n A 1 121 VAL 121 208 209 VAL VAL A . n A 1 122 MET 122 209 210 MET MET A . n A 1 123 GLU 123 210 211 GLU GLU A . n A 1 124 LEU 124 211 212 LEU LEU A . n A 1 125 LEU 125 212 213 LEU LEU A . n A 1 126 GLN 126 213 214 GLN GLN A . n A 1 127 GLY 127 214 215 GLY GLY A . n A 1 128 VAL 128 215 216 VAL VAL A . n A 1 129 ASP 129 216 217 ASP ASP A . n A 1 130 GLY 130 217 218 GLY GLY A . n A 1 131 VAL 131 218 219 VAL VAL A . n A 1 132 ILE 132 219 220 ILE ILE A . n A 1 133 LYS 133 220 221 LYS LYS A . n A 1 134 ARG 134 221 222 ARG ARG A . n A 1 135 ILE 135 222 223 ILE ILE A . n A 1 136 GLU 136 223 224 GLU GLU A . n A 1 137 LYS 137 224 225 LYS LYS A . n A 1 138 VAL 138 225 226 VAL VAL A . n A 1 139 THR 139 226 ? ? ? A . n A 1 140 LEU 140 227 ? ? ? A . n A 1 141 GLN 141 228 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 701 701 ZN ZN A . C 2 ZN 1 702 801 ZN ZN A . D 2 ZN 1 703 901 ZN ZN A . E 3 HOH 1 801 43 HOH HOH A . E 3 HOH 2 802 33 HOH HOH A . E 3 HOH 3 803 1 HOH HOH A . E 3 HOH 4 804 2 HOH HOH A . E 3 HOH 5 805 5 HOH HOH A . E 3 HOH 6 806 49 HOH HOH A . E 3 HOH 7 807 41 HOH HOH A . E 3 HOH 8 808 3 HOH HOH A . E 3 HOH 9 809 18 HOH HOH A . E 3 HOH 10 810 7 HOH HOH A . E 3 HOH 11 811 37 HOH HOH A . E 3 HOH 12 812 30 HOH HOH A . E 3 HOH 13 813 11 HOH HOH A . E 3 HOH 14 814 35 HOH HOH A . E 3 HOH 15 815 22 HOH HOH A . E 3 HOH 16 816 59 HOH HOH A . E 3 HOH 17 817 39 HOH HOH A . E 3 HOH 18 818 26 HOH HOH A . E 3 HOH 19 819 67 HOH HOH A . E 3 HOH 20 820 8 HOH HOH A . E 3 HOH 21 821 54 HOH HOH A . E 3 HOH 22 822 42 HOH HOH A . E 3 HOH 23 823 55 HOH HOH A . E 3 HOH 24 824 10 HOH HOH A . E 3 HOH 25 825 62 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2920 ? 1 MORE -106 ? 1 'SSA (A^2)' 22440 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 9 ? A CYS 96 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 ND1 ? A HIS 12 ? A HIS 99 ? 1_555 98.9 ? 2 SG ? A CYS 9 ? A CYS 96 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 SG ? A CYS 28 ? A CYS 115 ? 1_555 123.6 ? 3 ND1 ? A HIS 12 ? A HIS 99 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 SG ? A CYS 28 ? A CYS 115 ? 1_555 107.3 ? 4 SG ? A CYS 9 ? A CYS 96 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 SG ? A CYS 31 ? A CYS 118 ? 1_555 112.9 ? 5 ND1 ? A HIS 12 ? A HIS 99 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 SG ? A CYS 31 ? A CYS 118 ? 1_555 101.8 ? 6 SG ? A CYS 28 ? A CYS 115 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 SG ? A CYS 31 ? A CYS 118 ? 1_555 109.2 ? 7 NE2 ? A HIS 11 ? A HIS 98 ? 1_555 ZN ? D ZN . ? A ZN 703 ? 19_445 OE1 ? A GLU 71 ? A GLU 158 ? 1_555 126.1 ? 8 NE2 ? A HIS 11 ? A HIS 98 ? 1_555 ZN ? D ZN . ? A ZN 703 ? 19_445 SG ? A CYS 74 ? A CYS 161 ? 1_555 128.5 ? 9 OE1 ? A GLU 71 ? A GLU 158 ? 1_555 ZN ? D ZN . ? A ZN 703 ? 19_445 SG ? A CYS 74 ? A CYS 161 ? 1_555 3.7 ? 10 NE2 ? A HIS 11 ? A HIS 98 ? 1_555 ZN ? D ZN . ? A ZN 703 ? 19_445 SG ? A CYS 99 ? A CYS 186 ? 1_555 126.0 ? 11 OE1 ? A GLU 71 ? A GLU 158 ? 1_555 ZN ? D ZN . ? A ZN 703 ? 19_445 SG ? A CYS 99 ? A CYS 186 ? 1_555 5.6 ? 12 SG ? A CYS 74 ? A CYS 161 ? 1_555 ZN ? D ZN . ? A ZN 703 ? 19_445 SG ? A CYS 99 ? A CYS 186 ? 1_555 3.6 ? 13 SG ? A CYS 20 ? A CYS 107 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OD2 ? A ASP 23 ? A ASP 110 ? 1_555 114.0 ? 14 SG ? A CYS 20 ? A CYS 107 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 ND1 ? A HIS 37 ? A HIS 124 ? 1_555 133.9 ? 15 OD2 ? A ASP 23 ? A ASP 110 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 ND1 ? A HIS 37 ? A HIS 124 ? 1_555 81.7 ? 16 SG ? A CYS 20 ? A CYS 107 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 ND1 ? A HIS 40 ? A HIS 127 ? 1_555 99.8 ? 17 OD2 ? A ASP 23 ? A ASP 110 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 ND1 ? A HIS 40 ? A HIS 127 ? 1_555 104.2 ? 18 ND1 ? A HIS 37 ? A HIS 124 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 ND1 ? A HIS 40 ? A HIS 127 ? 1_555 118.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-22 2 'Structure model' 1 1 2017-12-13 3 'Structure model' 1 2 2018-02-14 4 'Structure model' 1 3 2020-01-01 5 'Structure model' 1 4 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model 9 5 'Structure model' pdbx_struct_conn_angle 10 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' 13 4 'Structure model' '_pdbx_audit_support.funding_organization' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 24 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 25 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 26 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 27 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 28 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 29 5 'Structure model' '_pdbx_struct_conn_angle.value' 30 5 'Structure model' '_struct_conn.pdbx_dist_value' 31 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 32 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 33 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 34 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 35 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 36 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 37 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 38 5 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 HE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HIS _pdbx_validate_symm_contact.auth_seq_id_1 98 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 ZN _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ZN _pdbx_validate_symm_contact.auth_seq_id_2 703 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 19_445 _pdbx_validate_symm_contact.dist 1.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 88 ? A GLU 1 2 1 Y 1 A GLU 89 ? A GLU 2 3 1 Y 1 A GLY 90 ? A GLY 3 4 1 Y 1 A GLN 91 ? A GLN 4 5 1 Y 1 A LYS 92 ? A LYS 5 6 1 Y 1 A VAL 93 ? A VAL 6 7 1 Y 1 A PRO 169 ? A PRO 82 8 1 Y 1 A LYS 170 ? A LYS 83 9 1 Y 1 A ALA 171 ? A ALA 84 10 1 Y 1 A PRO 172 ? A PRO 85 11 1 Y 1 A PRO 173 ? A PRO 86 12 1 Y 1 A GLU 174 ? A GLU 87 13 1 Y 1 A GLU 175 ? A GLU 88 14 1 Y 1 A LYS 176 ? A LYS 89 15 1 Y 1 A GLU 177 ? A GLU 90 16 1 Y 1 A THR 226 ? A THR 139 17 1 Y 1 A LEU 227 ? A LEU 140 18 1 Y 1 A GLN 228 ? A GLN 141 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZN ZN ZN N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01-GM112508 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' F32-GM115007 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5EIU _pdbx_initial_refinement_model.details ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 microscopy 'Negative stain electron microscopy of large hexagonal TRIM-cyclophilin A lattices.' 2 1 'light scattering' 'SECMALs of miniTRIM-cyclophilin A' #