data_5VCX # _entry.id 5VCX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5VCX WWPDB D_1000227244 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5VCV PDB . unspecified 5VCW PDB . unspecified 5VCY PDB . unspecified 5VCZ PDB . unspecified 5VD0 PDB . unspecified 5VD1 PDB . unspecified 5VD3 PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VCX _pdbx_database_status.recvd_initial_deposition_date 2017-04-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhu, J.-Y.' 1 ? 'Schonbrunn, E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 7863 _citation.page_last 7875 _citation.title 'Structural Basis of Wee Kinases Functionality and Inactivation by Diverse Small Molecule Inhibitors.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.7b00996 _citation.pdbx_database_id_PubMed 28792760 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhu, J.Y.' 1 primary 'Cuellar, R.A.' 2 primary 'Berndt, N.' 3 primary 'Lee, H.E.' 4 primary 'Olesen, S.H.' 5 primary 'Martin, M.P.' 6 primary 'Jensen, J.T.' 7 primary 'Georg, G.I.' 8 primary 'Schonbrunn, E.' 9 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5VCX _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.480 _cell.length_a_esd ? _cell.length_b 69.430 _cell.length_b_esd ? _cell.length_c 86.530 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VCX _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase' 34498.133 1 2.7.11.1 ? 'KINASE DOMAIN, UNP RESIDUES 75-362' ? 2 non-polymer syn 'N-(5-CHLORO-1,3-BENZODIOXOL-4-YL)-7-[2-(4-METHYLPIPERAZIN-1-YL)ETHOXY]-5-(TETRAHYDRO-2H-PYRAN-4-YLOXY)QUINAZOLIN-4-AMINE' 542.026 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 water nat water 18.015 32 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Myt1 kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGVDLGTENLYFQSMHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKE DGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVW GYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFS LGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSMHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKE DGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVW GYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFS LGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 MET n 1 24 HIS n 1 25 GLN n 1 26 LEU n 1 27 GLN n 1 28 PRO n 1 29 ARG n 1 30 ARG n 1 31 VAL n 1 32 SER n 1 33 PHE n 1 34 ARG n 1 35 GLY n 1 36 GLU n 1 37 ALA n 1 38 SER n 1 39 GLU n 1 40 THR n 1 41 LEU n 1 42 GLN n 1 43 SER n 1 44 PRO n 1 45 GLY n 1 46 TYR n 1 47 ASP n 1 48 PRO n 1 49 SER n 1 50 ARG n 1 51 PRO n 1 52 GLU n 1 53 SER n 1 54 PHE n 1 55 PHE n 1 56 GLN n 1 57 GLN n 1 58 SER n 1 59 PHE n 1 60 GLN n 1 61 ARG n 1 62 LEU n 1 63 SER n 1 64 ARG n 1 65 LEU n 1 66 GLY n 1 67 HIS n 1 68 GLY n 1 69 SER n 1 70 TYR n 1 71 GLY n 1 72 GLU n 1 73 VAL n 1 74 PHE n 1 75 LYS n 1 76 VAL n 1 77 ARG n 1 78 SER n 1 79 LYS n 1 80 GLU n 1 81 ASP n 1 82 GLY n 1 83 ARG n 1 84 LEU n 1 85 TYR n 1 86 ALA n 1 87 VAL n 1 88 LYS n 1 89 ARG n 1 90 SER n 1 91 MET n 1 92 SER n 1 93 PRO n 1 94 PHE n 1 95 ARG n 1 96 GLY n 1 97 PRO n 1 98 LYS n 1 99 ASP n 1 100 ARG n 1 101 ALA n 1 102 ARG n 1 103 LYS n 1 104 LEU n 1 105 ALA n 1 106 GLU n 1 107 VAL n 1 108 GLY n 1 109 SER n 1 110 HIS n 1 111 GLU n 1 112 LYS n 1 113 VAL n 1 114 GLY n 1 115 GLN n 1 116 HIS n 1 117 PRO n 1 118 CYS n 1 119 CYS n 1 120 VAL n 1 121 ARG n 1 122 LEU n 1 123 GLU n 1 124 GLN n 1 125 ALA n 1 126 TRP n 1 127 GLU n 1 128 GLU n 1 129 GLY n 1 130 GLY n 1 131 ILE n 1 132 LEU n 1 133 TYR n 1 134 LEU n 1 135 GLN n 1 136 THR n 1 137 GLU n 1 138 LEU n 1 139 CYS n 1 140 GLY n 1 141 PRO n 1 142 SER n 1 143 LEU n 1 144 GLN n 1 145 GLN n 1 146 HIS n 1 147 CYS n 1 148 GLU n 1 149 ALA n 1 150 TRP n 1 151 GLY n 1 152 ALA n 1 153 SER n 1 154 LEU n 1 155 PRO n 1 156 GLU n 1 157 ALA n 1 158 GLN n 1 159 VAL n 1 160 TRP n 1 161 GLY n 1 162 TYR n 1 163 LEU n 1 164 ARG n 1 165 ASP n 1 166 THR n 1 167 LEU n 1 168 LEU n 1 169 ALA n 1 170 LEU n 1 171 ALA n 1 172 HIS n 1 173 LEU n 1 174 HIS n 1 175 SER n 1 176 GLN n 1 177 GLY n 1 178 LEU n 1 179 VAL n 1 180 HIS n 1 181 LEU n 1 182 ASP n 1 183 VAL n 1 184 LYS n 1 185 PRO n 1 186 ALA n 1 187 ASN n 1 188 ILE n 1 189 PHE n 1 190 LEU n 1 191 GLY n 1 192 PRO n 1 193 ARG n 1 194 GLY n 1 195 ARG n 1 196 CYS n 1 197 LYS n 1 198 LEU n 1 199 GLY n 1 200 ASP n 1 201 PHE n 1 202 GLY n 1 203 LEU n 1 204 LEU n 1 205 VAL n 1 206 GLU n 1 207 LEU n 1 208 GLY n 1 209 THR n 1 210 ALA n 1 211 GLY n 1 212 ALA n 1 213 GLY n 1 214 GLU n 1 215 VAL n 1 216 GLN n 1 217 GLU n 1 218 GLY n 1 219 ASP n 1 220 PRO n 1 221 ARG n 1 222 TYR n 1 223 MET n 1 224 ALA n 1 225 PRO n 1 226 GLU n 1 227 LEU n 1 228 LEU n 1 229 GLN n 1 230 GLY n 1 231 SER n 1 232 TYR n 1 233 GLY n 1 234 THR n 1 235 ALA n 1 236 ALA n 1 237 ASP n 1 238 VAL n 1 239 PHE n 1 240 SER n 1 241 LEU n 1 242 GLY n 1 243 LEU n 1 244 THR n 1 245 ILE n 1 246 LEU n 1 247 GLU n 1 248 VAL n 1 249 ALA n 1 250 CYS n 1 251 ASN n 1 252 MET n 1 253 GLU n 1 254 LEU n 1 255 PRO n 1 256 HIS n 1 257 GLY n 1 258 GLY n 1 259 GLU n 1 260 GLY n 1 261 TRP n 1 262 GLN n 1 263 GLN n 1 264 LEU n 1 265 ARG n 1 266 GLN n 1 267 GLY n 1 268 TYR n 1 269 LEU n 1 270 PRO n 1 271 PRO n 1 272 GLU n 1 273 PHE n 1 274 THR n 1 275 ALA n 1 276 GLY n 1 277 LEU n 1 278 SER n 1 279 SER n 1 280 GLU n 1 281 LEU n 1 282 ARG n 1 283 SER n 1 284 VAL n 1 285 LEU n 1 286 VAL n 1 287 MET n 1 288 MET n 1 289 LEU n 1 290 GLU n 1 291 PRO n 1 292 ASP n 1 293 PRO n 1 294 LYS n 1 295 LEU n 1 296 ARG n 1 297 ALA n 1 298 THR n 1 299 ALA n 1 300 GLU n 1 301 ALA n 1 302 LEU n 1 303 LEU n 1 304 ALA n 1 305 LEU n 1 306 PRO n 1 307 VAL n 1 308 LEU n 1 309 ARG n 1 310 GLN n 1 311 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 311 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PKMYT1, MYT1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-RIPL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PNIC28-BSA4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PMYT1_HUMAN _struct_ref.pdbx_db_accession Q99640 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARK LAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDV KPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGGEGWQQ LRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP ; _struct_ref.pdbx_align_begin 75 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5VCX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 311 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99640 _struct_ref_seq.db_align_beg 75 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 362 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 75 _struct_ref_seq.pdbx_auth_seq_align_end 362 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5VCX MET A 1 ? UNP Q99640 ? ? 'initiating methionine' 52 1 1 5VCX HIS A 2 ? UNP Q99640 ? ? 'expression tag' 53 2 1 5VCX HIS A 3 ? UNP Q99640 ? ? 'expression tag' 54 3 1 5VCX HIS A 4 ? UNP Q99640 ? ? 'expression tag' 55 4 1 5VCX HIS A 5 ? UNP Q99640 ? ? 'expression tag' 56 5 1 5VCX HIS A 6 ? UNP Q99640 ? ? 'expression tag' 57 6 1 5VCX HIS A 7 ? UNP Q99640 ? ? 'expression tag' 58 7 1 5VCX SER A 8 ? UNP Q99640 ? ? 'expression tag' 59 8 1 5VCX SER A 9 ? UNP Q99640 ? ? 'expression tag' 60 9 1 5VCX GLY A 10 ? UNP Q99640 ? ? 'expression tag' 61 10 1 5VCX VAL A 11 ? UNP Q99640 ? ? 'expression tag' 62 11 1 5VCX ASP A 12 ? UNP Q99640 ? ? 'expression tag' 63 12 1 5VCX LEU A 13 ? UNP Q99640 ? ? 'expression tag' 64 13 1 5VCX GLY A 14 ? UNP Q99640 ? ? 'expression tag' 65 14 1 5VCX THR A 15 ? UNP Q99640 ? ? 'expression tag' 66 15 1 5VCX GLU A 16 ? UNP Q99640 ? ? 'expression tag' 67 16 1 5VCX ASN A 17 ? UNP Q99640 ? ? 'expression tag' 68 17 1 5VCX LEU A 18 ? UNP Q99640 ? ? 'expression tag' 69 18 1 5VCX TYR A 19 ? UNP Q99640 ? ? 'expression tag' 70 19 1 5VCX PHE A 20 ? UNP Q99640 ? ? 'expression tag' 71 20 1 5VCX GLN A 21 ? UNP Q99640 ? ? 'expression tag' 72 21 1 5VCX SER A 22 ? UNP Q99640 ? ? 'expression tag' 73 22 1 5VCX MET A 23 ? UNP Q99640 ? ? 'expression tag' 74 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 H8H non-polymer . 'N-(5-CHLORO-1,3-BENZODIOXOL-4-YL)-7-[2-(4-METHYLPIPERAZIN-1-YL)ETHOXY]-5-(TETRAHYDRO-2H-PYRAN-4-YLOXY)QUINAZOLIN-4-AMINE' SARACATINIB 'C27 H32 Cl N5 O5' 542.026 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VCX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;6.9 MG/ML MYT1, 25 mM HEPES, 100 MM SODIUM CHLORIDE, 0.5 mM DTT, 0.1 M CALCIUM CHLORIDE, 0.05 M TRIS pH 8.5, 10 % PEG 4000, 1 mM SARACATINIB ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-10-31 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'ROSENBAUM-ROCK DOUBLE-CRYSTAL' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 49.500 _reflns.entry_id 5VCX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.700 _reflns.d_resolution_low 43.814 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9718 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.655 _reflns.pdbx_Rmerge_I_obs 0.047 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.810 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.958 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.052 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.700 2.770 ? 4.840 ? ? ? ? 712 99.900 ? ? ? ? 0.328 ? ? ? ? ? ? ? ? 5.767 ? ? ? ? 0.361 ? ? 1 1 0.938 ? 2.770 2.850 ? 5.530 ? ? ? ? 676 100.000 ? ? ? ? 0.287 ? ? ? ? ? ? ? ? 5.700 ? ? ? ? 0.316 ? ? 2 1 0.952 ? 2.850 2.930 ? 7.350 ? ? ? ? 673 99.700 ? ? ? ? 0.216 ? ? ? ? ? ? ? ? 5.777 ? ? ? ? 0.237 ? ? 3 1 0.970 ? 2.930 3.020 ? 8.990 ? ? ? ? 659 99.800 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 5.724 ? ? ? ? 0.193 ? ? 4 1 0.983 ? 3.020 3.120 ? 12.480 ? ? ? ? 626 99.700 ? ? ? ? 0.131 ? ? ? ? ? ? ? ? 5.786 ? ? ? ? 0.143 ? ? 5 1 0.988 ? 3.120 3.230 ? 15.550 ? ? ? ? 622 99.700 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 5.688 ? ? ? ? 0.107 ? ? 6 1 0.993 ? 3.230 3.350 ? 18.770 ? ? ? ? 585 99.200 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 5.737 ? ? ? ? 0.090 ? ? 7 1 0.995 ? 3.350 3.490 ? 24.200 ? ? ? ? 572 99.800 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 5.733 ? ? ? ? 0.068 ? ? 8 1 0.997 ? 3.490 3.640 ? 29.210 ? ? ? ? 544 99.600 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 5.693 ? ? ? ? 0.055 ? ? 9 1 0.998 ? 3.640 3.820 ? 32.700 ? ? ? ? 541 99.600 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 5.680 ? ? ? ? 0.048 ? ? 10 1 0.998 ? 3.820 4.030 ? 39.360 ? ? ? ? 495 99.200 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 5.745 ? ? ? ? 0.040 ? ? 11 1 0.999 ? 4.030 4.270 ? 45.220 ? ? ? ? 479 99.200 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 5.628 ? ? ? ? 0.032 ? ? 12 1 0.999 ? 4.270 4.560 ? 49.280 ? ? ? ? 447 98.500 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 5.579 ? ? ? ? 0.032 ? ? 13 1 0.999 ? 4.560 4.930 ? 48.820 ? ? ? ? 425 98.800 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 5.525 ? ? ? ? 0.030 ? ? 14 1 0.999 ? 4.930 5.400 ? 47.640 ? ? ? ? 381 98.400 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 5.570 ? ? ? ? 0.032 ? ? 15 1 0.999 ? 5.400 6.040 ? 49.780 ? ? ? ? 355 98.900 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 5.513 ? ? ? ? 0.031 ? ? 16 1 0.999 ? 6.040 6.970 ? 51.120 ? ? ? ? 320 97.900 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 5.425 ? ? ? ? 0.031 ? ? 17 1 0.999 ? 6.970 8.540 ? 58.340 ? ? ? ? 261 97.000 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 5.433 ? ? ? ? 0.024 ? ? 18 1 0.999 ? 8.540 12.080 ? 72.010 ? ? ? ? 220 96.900 ? ? ? ? 0.017 ? ? ? ? ? ? ? ? 5.286 ? ? ? ? 0.019 ? ? 19 1 1.000 ? 12.080 43.814 ? 73.500 ? ? ? ? 125 91.900 ? ? ? ? 0.016 ? ? ? ? ? ? ? ? 4.728 ? ? ? ? 0.018 ? ? 20 1 1.000 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 214.710 _refine.B_iso_mean 54.6016 _refine.B_iso_min 16.970 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5VCX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7000 _refine.ls_d_res_low 43.8140 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9718 _refine.ls_number_reflns_R_free 486 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.1900 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2436 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2013 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5VCV _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.1100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.7000 _refine_hist.d_res_low 43.8140 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 2304 _refine_hist.pdbx_number_residues_total 287 _refine_hist.pdbx_B_iso_mean_ligand 40.91 _refine_hist.pdbx_B_iso_mean_solvent 33.32 _refine_hist.pdbx_number_atoms_protein 2230 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 2328 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.162 ? 3149 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.032 ? 326 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 413 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.616 ? 898 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7000 3.0907 3189 . 159 3030 100.0000 . . . 0.3125 0.0000 0.2645 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.0907 3.8935 3217 . 161 3056 100.0000 . . . 0.2618 0.0000 0.2140 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.8935 43.8196 3312 . 166 3146 98.0000 . . . 0.2198 0.0000 0.1728 . . . . . . 3 . . . # _struct.entry_id 5VCX _struct.title 'CRYSTAL STRUCTURE OF HUMAN MYT1 KINASE DOMAIN (UNTREATED) IN COMPLEX WITH SARACATINIB' _struct.pdbx_descriptor 'Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VCX _struct_keywords.text ;KINASE DOMAIN, CELL CYCLE, TYROSINE- AND THREONINE-SPECIFIC KINASE, MEMBRANE-ASSOCIATED PROTEIN KINASE, TRANSFERASE, INHIBITOR, TRANSFERASE-TRANSFERASE INHIBITOR complex ; _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 53 ? SER A 58 ? SER A 104 SER A 109 1 ? 6 HELX_P HELX_P2 AA2 GLY A 96 ? GLY A 114 ? GLY A 147 GLY A 165 1 ? 19 HELX_P HELX_P3 AA3 SER A 142 ? GLY A 151 ? SER A 193 GLY A 202 1 ? 10 HELX_P HELX_P4 AA4 PRO A 155 ? SER A 175 ? PRO A 206 SER A 226 1 ? 21 HELX_P HELX_P5 AA5 ASP A 219 ? MET A 223 ? ASP A 270 MET A 274 5 ? 5 HELX_P HELX_P6 AA6 ALA A 224 ? GLY A 230 ? ALA A 275 GLY A 281 5 ? 7 HELX_P HELX_P7 AA7 THR A 234 ? ASN A 251 ? THR A 285 ASN A 302 1 ? 18 HELX_P HELX_P8 AA8 GLY A 257 ? ARG A 265 ? GLY A 308 ARG A 316 1 ? 9 HELX_P HELX_P9 AA9 SER A 278 ? LEU A 289 ? SER A 329 LEU A 340 1 ? 12 HELX_P HELX_P10 AB1 THR A 298 ? ALA A 304 ? THR A 349 ALA A 355 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 192 A . ? PRO 243 A ARG 193 A ? ARG 244 A 1 -9.17 2 ARG 193 A . ? ARG 244 A GLY 194 A ? GLY 245 A 1 -7.61 3 ALA 210 A . ? ALA 261 A GLY 211 A ? GLY 262 A 1 -4.42 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 29 ? ARG A 30 ? ARG A 80 ARG A 81 AA1 2 LEU A 122 ? GLU A 128 ? LEU A 173 GLU A 179 AA1 3 ILE A 131 ? GLU A 137 ? ILE A 182 GLU A 188 AA1 4 LEU A 84 ? SER A 90 ? LEU A 135 SER A 141 AA1 5 GLY A 71 ? SER A 78 ? GLY A 122 SER A 129 AA1 6 PHE A 59 ? GLY A 68 ? PHE A 110 GLY A 119 AA2 1 LEU A 178 ? VAL A 179 ? LEU A 229 VAL A 230 AA2 2 VAL A 205 ? GLU A 206 ? VAL A 256 GLU A 257 AA3 1 ILE A 188 ? GLY A 191 ? ILE A 239 GLY A 242 AA3 2 ARG A 195 ? LEU A 198 ? ARG A 246 LEU A 249 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 29 ? N ARG A 80 O GLU A 127 ? O GLU A 178 AA1 2 3 N TRP A 126 ? N TRP A 177 O TYR A 133 ? O TYR A 184 AA1 3 4 O LEU A 134 ? O LEU A 185 N LYS A 88 ? N LYS A 139 AA1 4 5 O VAL A 87 ? O VAL A 138 N PHE A 74 ? N PHE A 125 AA1 5 6 O LYS A 75 ? O LYS A 126 N LEU A 62 ? N LEU A 113 AA2 1 2 N VAL A 179 ? N VAL A 230 O VAL A 205 ? O VAL A 256 AA3 1 2 N PHE A 189 ? N PHE A 240 O LYS A 197 ? O LYS A 248 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A H8H 401 ? 13 'binding site for residue H8H A 401' AC2 Software A EDO 402 ? 3 'binding site for residue EDO A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 LEU A 65 ? LEU A 116 . ? 1_555 ? 2 AC1 13 TYR A 70 ? TYR A 121 . ? 1_555 ? 3 AC1 13 VAL A 73 ? VAL A 124 . ? 1_555 ? 4 AC1 13 ALA A 86 ? ALA A 137 . ? 1_555 ? 5 AC1 13 LYS A 88 ? LYS A 139 . ? 1_555 ? 6 AC1 13 LEU A 134 ? LEU A 185 . ? 1_555 ? 7 AC1 13 THR A 136 ? THR A 187 . ? 1_555 ? 8 AC1 13 GLU A 137 ? GLU A 188 . ? 1_555 ? 9 AC1 13 CYS A 139 ? CYS A 190 . ? 1_555 ? 10 AC1 13 GLY A 140 ? GLY A 191 . ? 1_555 ? 11 AC1 13 PHE A 189 ? PHE A 240 . ? 1_555 ? 12 AC1 13 ASP A 200 ? ASP A 251 . ? 1_555 ? 13 AC1 13 HOH D . ? HOH A 523 . ? 1_555 ? 14 AC2 3 LYS A 184 ? LYS A 235 . ? 1_555 ? 15 AC2 3 ASN A 187 ? ASN A 238 . ? 1_555 ? 16 AC2 3 ASP A 200 ? ASP A 251 . ? 1_555 ? # _atom_sites.entry_id 5VCX _atom_sites.fract_transf_matrix[1][1] 0.017705 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014403 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011557 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 52 ? ? ? A . n A 1 2 HIS 2 53 ? ? ? A . n A 1 3 HIS 3 54 ? ? ? A . n A 1 4 HIS 4 55 ? ? ? A . n A 1 5 HIS 5 56 ? ? ? A . n A 1 6 HIS 6 57 ? ? ? A . n A 1 7 HIS 7 58 ? ? ? A . n A 1 8 SER 8 59 ? ? ? A . n A 1 9 SER 9 60 ? ? ? A . n A 1 10 GLY 10 61 ? ? ? A . n A 1 11 VAL 11 62 ? ? ? A . n A 1 12 ASP 12 63 ? ? ? A . n A 1 13 LEU 13 64 ? ? ? A . n A 1 14 GLY 14 65 ? ? ? A . n A 1 15 THR 15 66 ? ? ? A . n A 1 16 GLU 16 67 ? ? ? A . n A 1 17 ASN 17 68 ? ? ? A . n A 1 18 LEU 18 69 ? ? ? A . n A 1 19 TYR 19 70 ? ? ? A . n A 1 20 PHE 20 71 ? ? ? A . n A 1 21 GLN 21 72 ? ? ? A . n A 1 22 SER 22 73 ? ? ? A . n A 1 23 MET 23 74 ? ? ? A . n A 1 24 HIS 24 75 75 HIS HIS A . n A 1 25 GLN 25 76 76 GLN GLN A . n A 1 26 LEU 26 77 77 LEU LEU A . n A 1 27 GLN 27 78 78 GLN GLN A . n A 1 28 PRO 28 79 79 PRO PRO A . n A 1 29 ARG 29 80 80 ARG ARG A . n A 1 30 ARG 30 81 81 ARG ARG A . n A 1 31 VAL 31 82 82 VAL VAL A . n A 1 32 SER 32 83 83 SER SER A . n A 1 33 PHE 33 84 84 PHE PHE A . n A 1 34 ARG 34 85 85 ARG ARG A . n A 1 35 GLY 35 86 86 GLY GLY A . n A 1 36 GLU 36 87 87 GLU GLU A . n A 1 37 ALA 37 88 88 ALA ALA A . n A 1 38 SER 38 89 89 SER SER A . n A 1 39 GLU 39 90 90 GLU GLU A . n A 1 40 THR 40 91 91 THR THR A . n A 1 41 LEU 41 92 92 LEU LEU A . n A 1 42 GLN 42 93 93 GLN GLN A . n A 1 43 SER 43 94 94 SER SER A . n A 1 44 PRO 44 95 95 PRO PRO A . n A 1 45 GLY 45 96 96 GLY GLY A . n A 1 46 TYR 46 97 97 TYR TYR A . n A 1 47 ASP 47 98 98 ASP ASP A . n A 1 48 PRO 48 99 99 PRO PRO A . n A 1 49 SER 49 100 100 SER SER A . n A 1 50 ARG 50 101 101 ARG ARG A . n A 1 51 PRO 51 102 102 PRO PRO A . n A 1 52 GLU 52 103 103 GLU GLU A . n A 1 53 SER 53 104 104 SER SER A . n A 1 54 PHE 54 105 105 PHE PHE A . n A 1 55 PHE 55 106 106 PHE PHE A . n A 1 56 GLN 56 107 107 GLN GLN A . n A 1 57 GLN 57 108 108 GLN GLN A . n A 1 58 SER 58 109 109 SER SER A . n A 1 59 PHE 59 110 110 PHE PHE A . n A 1 60 GLN 60 111 111 GLN GLN A . n A 1 61 ARG 61 112 112 ARG ARG A . n A 1 62 LEU 62 113 113 LEU LEU A . n A 1 63 SER 63 114 114 SER SER A . n A 1 64 ARG 64 115 115 ARG ARG A . n A 1 65 LEU 65 116 116 LEU LEU A . n A 1 66 GLY 66 117 117 GLY GLY A . n A 1 67 HIS 67 118 118 HIS HIS A . n A 1 68 GLY 68 119 119 GLY GLY A . n A 1 69 SER 69 120 120 SER SER A . n A 1 70 TYR 70 121 121 TYR TYR A . n A 1 71 GLY 71 122 122 GLY GLY A . n A 1 72 GLU 72 123 123 GLU GLU A . n A 1 73 VAL 73 124 124 VAL VAL A . n A 1 74 PHE 74 125 125 PHE PHE A . n A 1 75 LYS 75 126 126 LYS LYS A . n A 1 76 VAL 76 127 127 VAL VAL A . n A 1 77 ARG 77 128 128 ARG ARG A . n A 1 78 SER 78 129 129 SER SER A . n A 1 79 LYS 79 130 130 LYS LYS A . n A 1 80 GLU 80 131 131 GLU GLU A . n A 1 81 ASP 81 132 132 ASP ASP A . n A 1 82 GLY 82 133 133 GLY GLY A . n A 1 83 ARG 83 134 134 ARG ARG A . n A 1 84 LEU 84 135 135 LEU LEU A . n A 1 85 TYR 85 136 136 TYR TYR A . n A 1 86 ALA 86 137 137 ALA ALA A . n A 1 87 VAL 87 138 138 VAL VAL A . n A 1 88 LYS 88 139 139 LYS LYS A . n A 1 89 ARG 89 140 140 ARG ARG A . n A 1 90 SER 90 141 141 SER SER A . n A 1 91 MET 91 142 142 MET MET A . n A 1 92 SER 92 143 143 SER SER A . n A 1 93 PRO 93 144 144 PRO PRO A . n A 1 94 PHE 94 145 145 PHE PHE A . n A 1 95 ARG 95 146 146 ARG ARG A . n A 1 96 GLY 96 147 147 GLY GLY A . n A 1 97 PRO 97 148 148 PRO PRO A . n A 1 98 LYS 98 149 149 LYS LYS A . n A 1 99 ASP 99 150 150 ASP ASP A . n A 1 100 ARG 100 151 151 ARG ARG A . n A 1 101 ALA 101 152 152 ALA ALA A . n A 1 102 ARG 102 153 153 ARG ARG A . n A 1 103 LYS 103 154 154 LYS LYS A . n A 1 104 LEU 104 155 155 LEU LEU A . n A 1 105 ALA 105 156 156 ALA ALA A . n A 1 106 GLU 106 157 157 GLU GLU A . n A 1 107 VAL 107 158 158 VAL VAL A . n A 1 108 GLY 108 159 159 GLY GLY A . n A 1 109 SER 109 160 160 SER SER A . n A 1 110 HIS 110 161 161 HIS HIS A . n A 1 111 GLU 111 162 162 GLU GLU A . n A 1 112 LYS 112 163 163 LYS LYS A . n A 1 113 VAL 113 164 164 VAL VAL A . n A 1 114 GLY 114 165 165 GLY GLY A . n A 1 115 GLN 115 166 166 GLN GLN A . n A 1 116 HIS 116 167 167 HIS HIS A . n A 1 117 PRO 117 168 168 PRO PRO A . n A 1 118 CYS 118 169 169 CYS CYS A . n A 1 119 CYS 119 170 170 CYS CYS A . n A 1 120 VAL 120 171 171 VAL VAL A . n A 1 121 ARG 121 172 172 ARG ARG A . n A 1 122 LEU 122 173 173 LEU LEU A . n A 1 123 GLU 123 174 174 GLU GLU A . n A 1 124 GLN 124 175 175 GLN GLN A . n A 1 125 ALA 125 176 176 ALA ALA A . n A 1 126 TRP 126 177 177 TRP TRP A . n A 1 127 GLU 127 178 178 GLU GLU A . n A 1 128 GLU 128 179 179 GLU GLU A . n A 1 129 GLY 129 180 180 GLY GLY A . n A 1 130 GLY 130 181 181 GLY GLY A . n A 1 131 ILE 131 182 182 ILE ILE A . n A 1 132 LEU 132 183 183 LEU LEU A . n A 1 133 TYR 133 184 184 TYR TYR A . n A 1 134 LEU 134 185 185 LEU LEU A . n A 1 135 GLN 135 186 186 GLN GLN A . n A 1 136 THR 136 187 187 THR THR A . n A 1 137 GLU 137 188 188 GLU GLU A . n A 1 138 LEU 138 189 189 LEU LEU A . n A 1 139 CYS 139 190 190 CYS CYS A . n A 1 140 GLY 140 191 191 GLY GLY A . n A 1 141 PRO 141 192 192 PRO PRO A . n A 1 142 SER 142 193 193 SER SER A . n A 1 143 LEU 143 194 194 LEU LEU A . n A 1 144 GLN 144 195 195 GLN GLN A . n A 1 145 GLN 145 196 196 GLN GLN A . n A 1 146 HIS 146 197 197 HIS HIS A . n A 1 147 CYS 147 198 198 CYS CYS A . n A 1 148 GLU 148 199 199 GLU GLU A . n A 1 149 ALA 149 200 200 ALA ALA A . n A 1 150 TRP 150 201 201 TRP TRP A . n A 1 151 GLY 151 202 202 GLY GLY A . n A 1 152 ALA 152 203 203 ALA ALA A . n A 1 153 SER 153 204 204 SER SER A . n A 1 154 LEU 154 205 205 LEU LEU A . n A 1 155 PRO 155 206 206 PRO PRO A . n A 1 156 GLU 156 207 207 GLU GLU A . n A 1 157 ALA 157 208 208 ALA ALA A . n A 1 158 GLN 158 209 209 GLN GLN A . n A 1 159 VAL 159 210 210 VAL VAL A . n A 1 160 TRP 160 211 211 TRP TRP A . n A 1 161 GLY 161 212 212 GLY GLY A . n A 1 162 TYR 162 213 213 TYR TYR A . n A 1 163 LEU 163 214 214 LEU LEU A . n A 1 164 ARG 164 215 215 ARG ARG A . n A 1 165 ASP 165 216 216 ASP ASP A . n A 1 166 THR 166 217 217 THR THR A . n A 1 167 LEU 167 218 218 LEU LEU A . n A 1 168 LEU 168 219 219 LEU LEU A . n A 1 169 ALA 169 220 220 ALA ALA A . n A 1 170 LEU 170 221 221 LEU LEU A . n A 1 171 ALA 171 222 222 ALA ALA A . n A 1 172 HIS 172 223 223 HIS HIS A . n A 1 173 LEU 173 224 224 LEU LEU A . n A 1 174 HIS 174 225 225 HIS HIS A . n A 1 175 SER 175 226 226 SER SER A . n A 1 176 GLN 176 227 227 GLN GLN A . n A 1 177 GLY 177 228 228 GLY GLY A . n A 1 178 LEU 178 229 229 LEU LEU A . n A 1 179 VAL 179 230 230 VAL VAL A . n A 1 180 HIS 180 231 231 HIS HIS A . n A 1 181 LEU 181 232 232 LEU LEU A . n A 1 182 ASP 182 233 233 ASP ASP A . n A 1 183 VAL 183 234 234 VAL VAL A . n A 1 184 LYS 184 235 235 LYS LYS A . n A 1 185 PRO 185 236 236 PRO PRO A . n A 1 186 ALA 186 237 237 ALA ALA A . n A 1 187 ASN 187 238 238 ASN ASN A . n A 1 188 ILE 188 239 239 ILE ILE A . n A 1 189 PHE 189 240 240 PHE PHE A . n A 1 190 LEU 190 241 241 LEU LEU A . n A 1 191 GLY 191 242 242 GLY GLY A . n A 1 192 PRO 192 243 243 PRO PRO A . n A 1 193 ARG 193 244 244 ARG ARG A . n A 1 194 GLY 194 245 245 GLY GLY A . n A 1 195 ARG 195 246 246 ARG ARG A . n A 1 196 CYS 196 247 247 CYS CYS A . n A 1 197 LYS 197 248 248 LYS LYS A . n A 1 198 LEU 198 249 249 LEU LEU A . n A 1 199 GLY 199 250 250 GLY GLY A . n A 1 200 ASP 200 251 251 ASP ASP A . n A 1 201 PHE 201 252 252 PHE PHE A . n A 1 202 GLY 202 253 253 GLY GLY A . n A 1 203 LEU 203 254 254 LEU LEU A . n A 1 204 LEU 204 255 255 LEU LEU A . n A 1 205 VAL 205 256 256 VAL VAL A . n A 1 206 GLU 206 257 257 GLU GLU A . n A 1 207 LEU 207 258 258 LEU LEU A . n A 1 208 GLY 208 259 259 GLY GLY A . n A 1 209 THR 209 260 260 THR THR A . n A 1 210 ALA 210 261 261 ALA ALA A . n A 1 211 GLY 211 262 262 GLY GLY A . n A 1 212 ALA 212 263 263 ALA ALA A . n A 1 213 GLY 213 264 264 GLY GLY A . n A 1 214 GLU 214 265 265 GLU GLU A . n A 1 215 VAL 215 266 266 VAL VAL A . n A 1 216 GLN 216 267 267 GLN GLN A . n A 1 217 GLU 217 268 268 GLU GLU A . n A 1 218 GLY 218 269 269 GLY GLY A . n A 1 219 ASP 219 270 270 ASP ASP A . n A 1 220 PRO 220 271 271 PRO PRO A . n A 1 221 ARG 221 272 272 ARG ARG A . n A 1 222 TYR 222 273 273 TYR TYR A . n A 1 223 MET 223 274 274 MET MET A . n A 1 224 ALA 224 275 275 ALA ALA A . n A 1 225 PRO 225 276 276 PRO PRO A . n A 1 226 GLU 226 277 277 GLU GLU A . n A 1 227 LEU 227 278 278 LEU LEU A . n A 1 228 LEU 228 279 279 LEU LEU A . n A 1 229 GLN 229 280 280 GLN GLN A . n A 1 230 GLY 230 281 281 GLY GLY A . n A 1 231 SER 231 282 282 SER SER A . n A 1 232 TYR 232 283 283 TYR TYR A . n A 1 233 GLY 233 284 284 GLY GLY A . n A 1 234 THR 234 285 285 THR THR A . n A 1 235 ALA 235 286 286 ALA ALA A . n A 1 236 ALA 236 287 287 ALA ALA A . n A 1 237 ASP 237 288 288 ASP ASP A . n A 1 238 VAL 238 289 289 VAL VAL A . n A 1 239 PHE 239 290 290 PHE PHE A . n A 1 240 SER 240 291 291 SER SER A . n A 1 241 LEU 241 292 292 LEU LEU A . n A 1 242 GLY 242 293 293 GLY GLY A . n A 1 243 LEU 243 294 294 LEU LEU A . n A 1 244 THR 244 295 295 THR THR A . n A 1 245 ILE 245 296 296 ILE ILE A . n A 1 246 LEU 246 297 297 LEU LEU A . n A 1 247 GLU 247 298 298 GLU GLU A . n A 1 248 VAL 248 299 299 VAL VAL A . n A 1 249 ALA 249 300 300 ALA ALA A . n A 1 250 CYS 250 301 301 CYS CYS A . n A 1 251 ASN 251 302 302 ASN ASN A . n A 1 252 MET 252 303 303 MET MET A . n A 1 253 GLU 253 304 304 GLU GLU A . n A 1 254 LEU 254 305 305 LEU LEU A . n A 1 255 PRO 255 306 306 PRO PRO A . n A 1 256 HIS 256 307 307 HIS HIS A . n A 1 257 GLY 257 308 308 GLY GLY A . n A 1 258 GLY 258 309 309 GLY GLY A . n A 1 259 GLU 259 310 310 GLU GLU A . n A 1 260 GLY 260 311 311 GLY GLY A . n A 1 261 TRP 261 312 312 TRP TRP A . n A 1 262 GLN 262 313 313 GLN GLN A . n A 1 263 GLN 263 314 314 GLN GLN A . n A 1 264 LEU 264 315 315 LEU LEU A . n A 1 265 ARG 265 316 316 ARG ARG A . n A 1 266 GLN 266 317 317 GLN GLN A . n A 1 267 GLY 267 318 318 GLY GLY A . n A 1 268 TYR 268 319 319 TYR TYR A . n A 1 269 LEU 269 320 320 LEU LEU A . n A 1 270 PRO 270 321 321 PRO PRO A . n A 1 271 PRO 271 322 322 PRO PRO A . n A 1 272 GLU 272 323 323 GLU GLU A . n A 1 273 PHE 273 324 324 PHE PHE A . n A 1 274 THR 274 325 325 THR THR A . n A 1 275 ALA 275 326 326 ALA ALA A . n A 1 276 GLY 276 327 327 GLY GLY A . n A 1 277 LEU 277 328 328 LEU LEU A . n A 1 278 SER 278 329 329 SER SER A . n A 1 279 SER 279 330 330 SER SER A . n A 1 280 GLU 280 331 331 GLU GLU A . n A 1 281 LEU 281 332 332 LEU LEU A . n A 1 282 ARG 282 333 333 ARG ARG A . n A 1 283 SER 283 334 334 SER SER A . n A 1 284 VAL 284 335 335 VAL VAL A . n A 1 285 LEU 285 336 336 LEU LEU A . n A 1 286 VAL 286 337 337 VAL VAL A . n A 1 287 MET 287 338 338 MET MET A . n A 1 288 MET 288 339 339 MET MET A . n A 1 289 LEU 289 340 340 LEU LEU A . n A 1 290 GLU 290 341 341 GLU GLU A . n A 1 291 PRO 291 342 342 PRO PRO A . n A 1 292 ASP 292 343 343 ASP ASP A . n A 1 293 PRO 293 344 344 PRO PRO A . n A 1 294 LYS 294 345 345 LYS LYS A . n A 1 295 LEU 295 346 346 LEU LEU A . n A 1 296 ARG 296 347 347 ARG ARG A . n A 1 297 ALA 297 348 348 ALA ALA A . n A 1 298 THR 298 349 349 THR THR A . n A 1 299 ALA 299 350 350 ALA ALA A . n A 1 300 GLU 300 351 351 GLU GLU A . n A 1 301 ALA 301 352 352 ALA ALA A . n A 1 302 LEU 302 353 353 LEU LEU A . n A 1 303 LEU 303 354 354 LEU LEU A . n A 1 304 ALA 304 355 355 ALA ALA A . n A 1 305 LEU 305 356 356 LEU LEU A . n A 1 306 PRO 306 357 357 PRO PRO A . n A 1 307 VAL 307 358 358 VAL VAL A . n A 1 308 LEU 308 359 359 LEU LEU A . n A 1 309 ARG 309 360 360 ARG ARG A . n A 1 310 GLN 310 361 361 GLN GLN A . n A 1 311 PRO 311 362 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 H8H 1 401 1 H8H H8H A . C 3 EDO 1 402 1 EDO EDO A . D 4 HOH 1 501 25 HOH HOH A . D 4 HOH 2 502 20 HOH HOH A . D 4 HOH 3 503 5 HOH HOH A . D 4 HOH 4 504 30 HOH HOH A . D 4 HOH 5 505 27 HOH HOH A . D 4 HOH 6 506 7 HOH HOH A . D 4 HOH 7 507 12 HOH HOH A . D 4 HOH 8 508 11 HOH HOH A . D 4 HOH 9 509 3 HOH HOH A . D 4 HOH 10 510 26 HOH HOH A . D 4 HOH 11 511 18 HOH HOH A . D 4 HOH 12 512 1 HOH HOH A . D 4 HOH 13 513 28 HOH HOH A . D 4 HOH 14 514 22 HOH HOH A . D 4 HOH 15 515 2 HOH HOH A . D 4 HOH 16 516 14 HOH HOH A . D 4 HOH 17 517 17 HOH HOH A . D 4 HOH 18 518 15 HOH HOH A . D 4 HOH 19 519 10 HOH HOH A . D 4 HOH 20 520 6 HOH HOH A . D 4 HOH 21 521 16 HOH HOH A . D 4 HOH 22 522 31 HOH HOH A . D 4 HOH 23 523 13 HOH HOH A . D 4 HOH 24 524 9 HOH HOH A . D 4 HOH 25 525 23 HOH HOH A . D 4 HOH 26 526 8 HOH HOH A . D 4 HOH 27 527 19 HOH HOH A . D 4 HOH 28 528 29 HOH HOH A . D 4 HOH 29 529 32 HOH HOH A . D 4 HOH 30 530 4 HOH HOH A . D 4 HOH 31 531 21 HOH HOH A . D 4 HOH 32 532 24 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1240 ? 1 MORE -5 ? 1 'SSA (A^2)' 14460 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-23 2 'Structure model' 1 1 2017-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.name' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 27.6729 -1.0843 1.2436 0.3419 0.3659 0.4216 -0.0479 0.0408 0.0450 1.8955 1.7751 1.8146 0.2507 0.8528 0.4031 -0.1406 0.1618 0.0029 0.0446 -0.0020 -0.3138 -0.1506 -0.1851 0.2240 'X-RAY DIFFRACTION' 2 ? refined 13.5736 -3.9069 -9.4178 0.4871 0.3670 0.3605 -0.0158 0.0173 0.0387 0.9608 0.2265 0.7971 -0.1375 0.8972 -0.1178 -0.2553 0.1867 -0.0194 0.0780 -0.1605 -0.1651 0.0422 -0.2683 0.0356 'X-RAY DIFFRACTION' 3 ? refined 2.1594 2.8416 -15.5731 0.7021 0.4809 0.4669 0.0325 -0.1155 0.0914 1.0381 0.1715 1.3027 0.1781 -0.8694 -0.1012 -0.4621 0.3261 -0.5648 0.3647 0.2736 0.3146 0.0985 -0.7824 -0.5643 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 75 A 227 ;chain 'A' and (resid 75 through 227 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 228 A 300 ;chain 'A' and (resid 228 through 300 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 301 A 361 ;chain 'A' and (resid 301 through 361 ) ; ? ? ? ? ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? SERGUI ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 PHE _pdbx_validate_rmsd_angle.auth_seq_id_1 324 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PHE _pdbx_validate_rmsd_angle.auth_seq_id_2 324 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PHE _pdbx_validate_rmsd_angle.auth_seq_id_3 324 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.12 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation 18.12 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 232 ? ? 70.27 -2.25 2 1 ASP A 233 ? ? -146.18 48.85 3 1 LEU A 241 ? ? -59.18 107.09 4 1 ASP A 251 ? ? 56.06 76.15 5 1 PHE A 324 ? ? 86.66 5.13 6 1 VAL A 358 ? ? -68.36 1.96 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 52 ? A MET 1 2 1 Y 1 A HIS 53 ? A HIS 2 3 1 Y 1 A HIS 54 ? A HIS 3 4 1 Y 1 A HIS 55 ? A HIS 4 5 1 Y 1 A HIS 56 ? A HIS 5 6 1 Y 1 A HIS 57 ? A HIS 6 7 1 Y 1 A HIS 58 ? A HIS 7 8 1 Y 1 A SER 59 ? A SER 8 9 1 Y 1 A SER 60 ? A SER 9 10 1 Y 1 A GLY 61 ? A GLY 10 11 1 Y 1 A VAL 62 ? A VAL 11 12 1 Y 1 A ASP 63 ? A ASP 12 13 1 Y 1 A LEU 64 ? A LEU 13 14 1 Y 1 A GLY 65 ? A GLY 14 15 1 Y 1 A THR 66 ? A THR 15 16 1 Y 1 A GLU 67 ? A GLU 16 17 1 Y 1 A ASN 68 ? A ASN 17 18 1 Y 1 A LEU 69 ? A LEU 18 19 1 Y 1 A TYR 70 ? A TYR 19 20 1 Y 1 A PHE 71 ? A PHE 20 21 1 Y 1 A GLN 72 ? A GLN 21 22 1 Y 1 A SER 73 ? A SER 22 23 1 Y 1 A MET 74 ? A MET 23 24 1 Y 1 A PRO 362 ? A PRO 311 # _pdbx_audit_support.funding_organization 'National Institutes of Health/Eunice Kennedy Shriver National Institute of Child Health & Human Development' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'UO1 HD076542' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-(5-CHLORO-1,3-BENZODIOXOL-4-YL)-7-[2-(4-METHYLPIPERAZIN-1-YL)ETHOXY]-5-(TETRAHYDRO-2H-PYRAN-4-YLOXY)QUINAZOLIN-4-AMINE' H8H 3 1,2-ETHANEDIOL EDO 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #