data_5VD5 # _entry.id 5VD5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5VD5 WWPDB D_1000227252 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 5VC3 PDB unspecified . 5VC4 PDB unspecified . 5VC5 PDB unspecified . 5VD2 PDB unspecified . 5VC6 PDB unspecified . 5VD9 PDB unspecified . 5VD8 PDB unspecified . 5VD7 PDB unspecified . 5VD4 PDB unspecified . 5VDA PDB unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VD5 _pdbx_database_status.recvd_initial_deposition_date 2017-04-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhu, J.-Y.' 1 ? 'Schonbrunn, E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'to be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural basis of Wee family kinase inhibition by small molecules' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, J.-Y.' 1 ? primary 'Schonbrunn, E.' 2 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 102.170 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5VD5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.240 _cell.length_a_esd ? _cell.length_b 44.580 _cell.length_b_esd ? _cell.length_c 64.650 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VD5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Wee1-like protein kinase' 32440.900 1 2.7.10.2 ? 'UNP RESIDUES 291-575' ? 2 non-polymer syn ;1-[6-(2-hydroxypropan-2-yl)pyridin-2-yl]-6-{[4-(morpholin-4-yl)phenyl]amino}-2-(prop-2-en-1-yl)-1,2-dihydro-3H-pyrazolo[3,4-d]pyrimidin-3-one ; 487.554 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 61 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'WEE1hu,Wee1A kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAGSMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAW AEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEE GDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEI RQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK ; _entity_poly.pdbx_seq_one_letter_code_can ;GAGSMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAW AEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEE GDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEI RQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 LYS n 1 7 SER n 1 8 ARG n 1 9 TYR n 1 10 THR n 1 11 THR n 1 12 GLU n 1 13 PHE n 1 14 HIS n 1 15 GLU n 1 16 LEU n 1 17 GLU n 1 18 LYS n 1 19 ILE n 1 20 GLY n 1 21 SER n 1 22 GLY n 1 23 GLU n 1 24 PHE n 1 25 GLY n 1 26 SER n 1 27 VAL n 1 28 PHE n 1 29 LYS n 1 30 CYS n 1 31 VAL n 1 32 LYS n 1 33 ARG n 1 34 LEU n 1 35 ASP n 1 36 GLY n 1 37 CYS n 1 38 ILE n 1 39 TYR n 1 40 ALA n 1 41 ILE n 1 42 LYS n 1 43 ARG n 1 44 SER n 1 45 LYS n 1 46 LYS n 1 47 PRO n 1 48 LEU n 1 49 ALA n 1 50 GLY n 1 51 SER n 1 52 VAL n 1 53 ASP n 1 54 GLU n 1 55 GLN n 1 56 ASN n 1 57 ALA n 1 58 LEU n 1 59 ARG n 1 60 GLU n 1 61 VAL n 1 62 TYR n 1 63 ALA n 1 64 HIS n 1 65 ALA n 1 66 VAL n 1 67 LEU n 1 68 GLY n 1 69 GLN n 1 70 HIS n 1 71 SER n 1 72 HIS n 1 73 VAL n 1 74 VAL n 1 75 ARG n 1 76 TYR n 1 77 PHE n 1 78 SER n 1 79 ALA n 1 80 TRP n 1 81 ALA n 1 82 GLU n 1 83 ASP n 1 84 ASP n 1 85 HIS n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 GLN n 1 90 ASN n 1 91 GLU n 1 92 TYR n 1 93 CYS n 1 94 ASN n 1 95 GLY n 1 96 GLY n 1 97 SER n 1 98 LEU n 1 99 ALA n 1 100 ASP n 1 101 ALA n 1 102 ILE n 1 103 SER n 1 104 GLU n 1 105 ASN n 1 106 TYR n 1 107 ARG n 1 108 ILE n 1 109 MET n 1 110 SER n 1 111 TYR n 1 112 PHE n 1 113 LYS n 1 114 GLU n 1 115 ALA n 1 116 GLU n 1 117 LEU n 1 118 LYS n 1 119 ASP n 1 120 LEU n 1 121 LEU n 1 122 LEU n 1 123 GLN n 1 124 VAL n 1 125 GLY n 1 126 ARG n 1 127 GLY n 1 128 LEU n 1 129 ARG n 1 130 TYR n 1 131 ILE n 1 132 HIS n 1 133 SER n 1 134 MET n 1 135 SER n 1 136 LEU n 1 137 VAL n 1 138 HIS n 1 139 MET n 1 140 ASP n 1 141 ILE n 1 142 LYS n 1 143 PRO n 1 144 SER n 1 145 ASN n 1 146 ILE n 1 147 PHE n 1 148 ILE n 1 149 SER n 1 150 ARG n 1 151 THR n 1 152 SER n 1 153 ILE n 1 154 PRO n 1 155 ASN n 1 156 ALA n 1 157 ALA n 1 158 SER n 1 159 GLU n 1 160 GLU n 1 161 GLY n 1 162 ASP n 1 163 GLU n 1 164 ASP n 1 165 ASP n 1 166 TRP n 1 167 ALA n 1 168 SER n 1 169 ASN n 1 170 LYS n 1 171 VAL n 1 172 MET n 1 173 PHE n 1 174 LYS n 1 175 ILE n 1 176 GLY n 1 177 ASP n 1 178 LEU n 1 179 GLY n 1 180 HIS n 1 181 VAL n 1 182 THR n 1 183 ARG n 1 184 ILE n 1 185 SER n 1 186 SER n 1 187 PRO n 1 188 GLN n 1 189 VAL n 1 190 GLU n 1 191 GLU n 1 192 GLY n 1 193 ASP n 1 194 SER n 1 195 ARG n 1 196 PHE n 1 197 LEU n 1 198 ALA n 1 199 ASN n 1 200 GLU n 1 201 VAL n 1 202 LEU n 1 203 GLN n 1 204 GLU n 1 205 ASN n 1 206 TYR n 1 207 THR n 1 208 HIS n 1 209 LEU n 1 210 PRO n 1 211 LYS n 1 212 ALA n 1 213 ASP n 1 214 ILE n 1 215 PHE n 1 216 ALA n 1 217 LEU n 1 218 ALA n 1 219 LEU n 1 220 THR n 1 221 VAL n 1 222 VAL n 1 223 CYS n 1 224 ALA n 1 225 ALA n 1 226 GLY n 1 227 ALA n 1 228 GLU n 1 229 PRO n 1 230 LEU n 1 231 PRO n 1 232 ARG n 1 233 ASN n 1 234 GLY n 1 235 ASP n 1 236 GLN n 1 237 TRP n 1 238 HIS n 1 239 GLU n 1 240 ILE n 1 241 ARG n 1 242 GLN n 1 243 GLY n 1 244 ARG n 1 245 LEU n 1 246 PRO n 1 247 ARG n 1 248 ILE n 1 249 PRO n 1 250 GLN n 1 251 VAL n 1 252 LEU n 1 253 SER n 1 254 GLN n 1 255 GLU n 1 256 PHE n 1 257 THR n 1 258 GLU n 1 259 LEU n 1 260 LEU n 1 261 LYS n 1 262 VAL n 1 263 MET n 1 264 ILE n 1 265 HIS n 1 266 PRO n 1 267 ASP n 1 268 PRO n 1 269 GLU n 1 270 ARG n 1 271 ARG n 1 272 PRO n 1 273 SER n 1 274 ALA n 1 275 MET n 1 276 ALA n 1 277 LEU n 1 278 VAL n 1 279 LYS n 1 280 HIS n 1 281 SER n 1 282 VAL n 1 283 LEU n 1 284 LEU n 1 285 SER n 1 286 ALA n 1 287 SER n 1 288 ARG n 1 289 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 289 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene WEE1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-RIPL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code WEE1_HUMAN _struct_ref.pdbx_db_accession P30291 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDD HMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDED DWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGR LPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK ; _struct_ref.pdbx_align_begin 291 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5VD5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 289 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P30291 _struct_ref_seq.db_align_beg 291 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 575 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 291 _struct_ref_seq.pdbx_auth_seq_align_end 575 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5VD5 GLY A 1 ? UNP P30291 ? ? 'expression tag' 287 1 1 5VD5 ALA A 2 ? UNP P30291 ? ? 'expression tag' 288 2 1 5VD5 GLY A 3 ? UNP P30291 ? ? 'expression tag' 289 3 1 5VD5 SER A 4 ? UNP P30291 ? ? 'expression tag' 290 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 99M non-polymer . ;1-[6-(2-hydroxypropan-2-yl)pyridin-2-yl]-6-{[4-(morpholin-4-yl)phenyl]amino}-2-(prop-2-en-1-yl)-1,2-dihydro-3H-pyrazolo[3,4-d]pyrimidin-3-one ; RAC-IV-050 'C26 H29 N7 O3' 487.554 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VD5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '5.0 MG/ML WEE1, 25 mM Na/K phosphate, 1 mM DTT, 0.05 M ammonium sulfate, 0.05 M Bis-tris (pH 5.5), 7.5 % PEG 3350, 1 mM RAC-IV-050' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-08-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'ROSENBAUM-ROCK DOUBLE-CRYSTAL' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 30.360 _reflns.entry_id 5VD5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.050 _reflns.d_resolution_low 36.428 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17725 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.672 _reflns.pdbx_Rmerge_I_obs 0.042 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.540 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.994 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.050 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.050 2.100 ? 4.470 ? ? ? ? 1316 99.400 ? ? ? ? 0.322 ? ? ? ? ? ? ? ? 3.548 ? ? ? ? 0.379 ? ? 1 1 0.931 ? 2.100 2.160 ? 5.500 ? ? ? ? 1252 99.800 ? ? ? ? 0.247 ? ? ? ? ? ? ? ? 3.573 ? ? ? ? 0.290 ? ? 2 1 0.956 ? 2.160 2.220 ? 6.950 ? ? ? ? 1252 99.600 ? ? ? ? 0.193 ? ? ? ? ? ? ? ? 3.594 ? ? ? ? 0.227 ? ? 3 1 0.970 ? 2.220 2.290 ? 7.930 ? ? ? ? 1205 99.700 ? ? ? ? 0.165 ? ? ? ? ? ? ? ? 3.681 ? ? ? ? 0.194 ? ? 4 1 0.978 ? 2.290 2.370 ? 9.690 ? ? ? ? 1149 99.700 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 3.739 ? ? ? ? 0.160 ? ? 5 1 0.985 ? 2.370 2.450 ? 11.320 ? ? ? ? 1117 99.200 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 3.776 ? ? ? ? 0.137 ? ? 6 1 0.987 ? 2.450 2.540 ? 12.910 ? ? ? ? 1081 99.500 ? ? ? ? 0.099 ? ? ? ? ? ? ? ? 3.774 ? ? ? ? 0.115 ? ? 7 1 0.991 ? 2.540 2.650 ? 15.120 ? ? ? ? 1050 99.400 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 3.759 ? ? ? ? 0.096 ? ? 8 1 0.993 ? 2.650 2.760 ? 17.450 ? ? ? ? 1006 99.700 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 3.745 ? ? ? ? 0.080 ? ? 9 1 0.995 ? 2.760 2.900 ? 20.440 ? ? ? ? 958 99.400 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 3.737 ? ? ? ? 0.068 ? ? 10 1 0.996 ? 2.900 3.060 ? 24.340 ? ? ? ? 921 99.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 3.717 ? ? ? ? 0.052 ? ? 11 1 0.997 ? 3.060 3.240 ? 28.590 ? ? ? ? 864 99.500 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 3.677 ? ? ? ? 0.045 ? ? 12 1 0.998 ? 3.240 3.470 ? 32.020 ? ? ? ? 805 99.500 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 3.683 ? ? ? ? 0.040 ? ? 13 1 0.998 ? 3.470 3.740 ? 36.550 ? ? ? ? 771 99.100 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 3.668 ? ? ? ? 0.033 ? ? 14 1 0.999 ? 3.740 4.100 ? 38.900 ? ? ? ? 702 100.000 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 3.641 ? ? ? ? 0.031 ? ? 15 1 0.999 ? 4.100 4.580 ? 42.500 ? ? ? ? 636 98.600 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 3.668 ? ? ? ? 0.032 ? ? 16 1 0.999 ? 4.580 5.290 ? 41.590 ? ? ? ? 564 99.500 ? ? ? ? 0.024 ? ? ? ? ? ? ? ? 3.651 ? ? ? ? 0.029 ? ? 17 1 0.999 ? 5.290 6.480 ? 40.490 ? ? ? ? 486 99.000 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 3.621 ? ? ? ? 0.030 ? ? 18 1 0.999 ? 6.480 9.170 ? 44.100 ? ? ? ? 376 99.200 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 3.553 ? ? ? ? 0.028 ? ? 19 1 0.999 ? 9.170 36.428 ? 44.290 ? ? ? ? 214 97.700 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 3.201 ? ? ? ? 0.028 ? ? 20 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 295.890 _refine.B_iso_mean 50.0282 _refine.B_iso_min 14.530 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5VD5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0500 _refine.ls_d_res_low 36.4280 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17720 _refine.ls_number_reflns_R_free 886 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4600 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2341 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1952 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5V5Y _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.0600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.0500 _refine_hist.d_res_low 36.4280 _refine_hist.pdbx_number_atoms_ligand 66 _refine_hist.number_atoms_solvent 61 _refine_hist.number_atoms_total 2197 _refine_hist.pdbx_number_residues_total 260 _refine_hist.pdbx_B_iso_mean_ligand 31.15 _refine_hist.pdbx_B_iso_mean_solvent 35.68 _refine_hist.pdbx_number_atoms_protein 2070 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 2154 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.923 ? 2910 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.034 ? 312 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 372 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.802 ? 806 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0500 2.1784 2934 . 147 2787 99.0000 . . . 0.3156 0.0000 0.2304 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.1784 2.3465 2939 . 147 2792 100.0000 . . . 0.2345 0.0000 0.2120 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.3465 2.5826 2937 . 147 2790 100.0000 . . . 0.2473 0.0000 0.2137 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.5826 2.9562 2936 . 147 2789 99.0000 . . . 0.2562 0.0000 0.2102 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.9562 3.7239 2959 . 148 2811 99.0000 . . . 0.2393 0.0000 0.1954 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.7239 36.4341 3015 . 150 2865 99.0000 . . . 0.2149 0.0000 0.1701 . . . . . . 6 . . . # _struct.entry_id 5VD5 _struct.title 'CRYSTAL STRUCTURE OF HUMAN WEE1 KINASE DOMAIN IN COMPLEX WITH RAC-IV-050, a MK1775 analougue' _struct.pdbx_descriptor 'Wee1-like protein kinase (E.C.2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VD5 _struct_keywords.text 'KINASE DOMAIN, CELL CYCLE, WEE1, TRANSFERASE, INHIBITOR, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? GLU A 12 ? SER A 293 GLU A 298 1 ? 6 HELX_P HELX_P2 AA2 SER A 51 ? GLY A 68 ? SER A 337 GLY A 354 1 ? 18 HELX_P HELX_P3 AA3 SER A 97 ? ILE A 108 ? SER A 383 ILE A 394 1 ? 12 HELX_P HELX_P4 AA4 LYS A 113 ? MET A 134 ? LYS A 399 MET A 420 1 ? 22 HELX_P HELX_P5 AA5 LYS A 142 ? SER A 144 ? LYS A 428 SER A 430 5 ? 3 HELX_P HELX_P6 AA6 ASP A 177 ? VAL A 181 ? ASP A 463 VAL A 467 5 ? 5 HELX_P HELX_P7 AA7 ASP A 193 ? LEU A 197 ? ASP A 479 LEU A 483 5 ? 5 HELX_P HELX_P8 AA8 ALA A 198 ? GLN A 203 ? ALA A 484 GLN A 489 1 ? 6 HELX_P HELX_P9 AA9 HIS A 208 ? ALA A 225 ? HIS A 494 ALA A 511 1 ? 18 HELX_P HELX_P10 AB1 GLY A 234 ? GLN A 242 ? GLY A 520 GLN A 528 1 ? 9 HELX_P HELX_P11 AB2 SER A 253 ? ILE A 264 ? SER A 539 ILE A 550 1 ? 12 HELX_P HELX_P12 AB3 SER A 273 ? LYS A 279 ? SER A 559 LYS A 565 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 284 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 570 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 SER _struct_mon_prot_cis.pdbx_label_seq_id_2 285 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 SER _struct_mon_prot_cis.pdbx_auth_seq_id_2 571 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.33 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 13 ? GLY A 22 ? PHE A 299 GLY A 308 AA1 2 GLY A 25 ? LYS A 32 ? GLY A 311 LYS A 318 AA1 3 ILE A 38 ? LYS A 45 ? ILE A 324 LYS A 331 AA1 4 HIS A 85 ? GLU A 91 ? HIS A 371 GLU A 377 AA1 5 TYR A 76 ? GLU A 82 ? TYR A 362 GLU A 368 AA2 1 LEU A 136 ? VAL A 137 ? LEU A 422 VAL A 423 AA2 2 THR A 182 ? ARG A 183 ? THR A 468 ARG A 469 AA3 1 ILE A 146 ? SER A 149 ? ILE A 432 SER A 435 AA3 2 MET A 172 ? ILE A 175 ? MET A 458 ILE A 461 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 17 ? N GLU A 303 O LYS A 29 ? O LYS A 315 AA1 2 3 N SER A 26 ? N SER A 312 O ARG A 43 ? O ARG A 329 AA1 3 4 N ALA A 40 ? N ALA A 326 O ASN A 90 ? O ASN A 376 AA1 4 5 O LEU A 87 ? O LEU A 373 N TRP A 80 ? N TRP A 366 AA2 1 2 N VAL A 137 ? N VAL A 423 O THR A 182 ? O THR A 468 AA3 1 2 N PHE A 147 ? N PHE A 433 O LYS A 174 ? O LYS A 460 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 99M _struct_site.pdbx_auth_seq_id 601 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'binding site for residue 99M A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 ILE A 19 ? ILE A 305 . ? 1_555 ? 2 AC1 12 PHE A 24 ? PHE A 310 . ? 1_555 ? 3 AC1 12 ALA A 40 ? ALA A 326 . ? 1_555 ? 4 AC1 12 VAL A 74 ? VAL A 360 . ? 1_555 ? 5 AC1 12 ASN A 90 ? ASN A 376 . ? 1_555 ? 6 AC1 12 GLU A 91 ? GLU A 377 . ? 1_555 ? 7 AC1 12 TYR A 92 ? TYR A 378 . ? 1_555 ? 8 AC1 12 CYS A 93 ? CYS A 379 . ? 1_555 ? 9 AC1 12 GLY A 96 ? GLY A 382 . ? 1_555 ? 10 AC1 12 PHE A 147 ? PHE A 433 . ? 1_555 ? 11 AC1 12 ASP A 177 ? ASP A 463 . ? 1_555 ? 12 AC1 12 HOH D . ? HOH A 739 . ? 1_555 ? # _atom_sites.entry_id 5VD5 _atom_sites.fract_transf_matrix[1][1] 0.019904 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004293 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022432 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015824 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 287 ? ? ? A . n A 1 2 ALA 2 288 ? ? ? A . n A 1 3 GLY 3 289 ? ? ? A . n A 1 4 SER 4 290 ? ? ? A . n A 1 5 MET 5 291 ? ? ? A . n A 1 6 LYS 6 292 ? ? ? A . n A 1 7 SER 7 293 293 SER SER A . n A 1 8 ARG 8 294 294 ARG ARG A . n A 1 9 TYR 9 295 295 TYR TYR A . n A 1 10 THR 10 296 296 THR THR A . n A 1 11 THR 11 297 297 THR THR A . n A 1 12 GLU 12 298 298 GLU GLU A . n A 1 13 PHE 13 299 299 PHE PHE A . n A 1 14 HIS 14 300 300 HIS HIS A . n A 1 15 GLU 15 301 301 GLU GLU A . n A 1 16 LEU 16 302 302 LEU LEU A . n A 1 17 GLU 17 303 303 GLU GLU A . n A 1 18 LYS 18 304 304 LYS LYS A . n A 1 19 ILE 19 305 305 ILE ILE A . n A 1 20 GLY 20 306 306 GLY GLY A . n A 1 21 SER 21 307 307 SER SER A . n A 1 22 GLY 22 308 308 GLY GLY A . n A 1 23 GLU 23 309 309 GLU GLU A . n A 1 24 PHE 24 310 310 PHE PHE A . n A 1 25 GLY 25 311 311 GLY GLY A . n A 1 26 SER 26 312 312 SER SER A . n A 1 27 VAL 27 313 313 VAL VAL A . n A 1 28 PHE 28 314 314 PHE PHE A . n A 1 29 LYS 29 315 315 LYS LYS A . n A 1 30 CYS 30 316 316 CYS CYS A . n A 1 31 VAL 31 317 317 VAL VAL A . n A 1 32 LYS 32 318 318 LYS LYS A . n A 1 33 ARG 33 319 319 ARG ARG A . n A 1 34 LEU 34 320 320 LEU LEU A . n A 1 35 ASP 35 321 321 ASP ASP A . n A 1 36 GLY 36 322 322 GLY GLY A . n A 1 37 CYS 37 323 323 CYS CYS A . n A 1 38 ILE 38 324 324 ILE ILE A . n A 1 39 TYR 39 325 325 TYR TYR A . n A 1 40 ALA 40 326 326 ALA ALA A . n A 1 41 ILE 41 327 327 ILE ILE A . n A 1 42 LYS 42 328 328 LYS LYS A . n A 1 43 ARG 43 329 329 ARG ARG A . n A 1 44 SER 44 330 330 SER SER A . n A 1 45 LYS 45 331 331 LYS LYS A . n A 1 46 LYS 46 332 332 LYS LYS A . n A 1 47 PRO 47 333 333 PRO PRO A . n A 1 48 LEU 48 334 334 LEU LEU A . n A 1 49 ALA 49 335 335 ALA ALA A . n A 1 50 GLY 50 336 336 GLY GLY A . n A 1 51 SER 51 337 337 SER SER A . n A 1 52 VAL 52 338 338 VAL VAL A . n A 1 53 ASP 53 339 339 ASP ASP A . n A 1 54 GLU 54 340 340 GLU GLU A . n A 1 55 GLN 55 341 341 GLN GLN A . n A 1 56 ASN 56 342 342 ASN ASN A . n A 1 57 ALA 57 343 343 ALA ALA A . n A 1 58 LEU 58 344 344 LEU LEU A . n A 1 59 ARG 59 345 345 ARG ARG A . n A 1 60 GLU 60 346 346 GLU GLU A . n A 1 61 VAL 61 347 347 VAL VAL A . n A 1 62 TYR 62 348 348 TYR TYR A . n A 1 63 ALA 63 349 349 ALA ALA A . n A 1 64 HIS 64 350 350 HIS HIS A . n A 1 65 ALA 65 351 351 ALA ALA A . n A 1 66 VAL 66 352 352 VAL VAL A . n A 1 67 LEU 67 353 353 LEU LEU A . n A 1 68 GLY 68 354 354 GLY GLY A . n A 1 69 GLN 69 355 355 GLN GLN A . n A 1 70 HIS 70 356 356 HIS HIS A . n A 1 71 SER 71 357 357 SER SER A . n A 1 72 HIS 72 358 358 HIS HIS A . n A 1 73 VAL 73 359 359 VAL VAL A . n A 1 74 VAL 74 360 360 VAL VAL A . n A 1 75 ARG 75 361 361 ARG ARG A . n A 1 76 TYR 76 362 362 TYR TYR A . n A 1 77 PHE 77 363 363 PHE PHE A . n A 1 78 SER 78 364 364 SER SER A . n A 1 79 ALA 79 365 365 ALA ALA A . n A 1 80 TRP 80 366 366 TRP TRP A . n A 1 81 ALA 81 367 367 ALA ALA A . n A 1 82 GLU 82 368 368 GLU GLU A . n A 1 83 ASP 83 369 369 ASP ASP A . n A 1 84 ASP 84 370 370 ASP ASP A . n A 1 85 HIS 85 371 371 HIS HIS A . n A 1 86 MET 86 372 372 MET MET A . n A 1 87 LEU 87 373 373 LEU LEU A . n A 1 88 ILE 88 374 374 ILE ILE A . n A 1 89 GLN 89 375 375 GLN GLN A . n A 1 90 ASN 90 376 376 ASN ASN A . n A 1 91 GLU 91 377 377 GLU GLU A . n A 1 92 TYR 92 378 378 TYR TYR A . n A 1 93 CYS 93 379 379 CYS CYS A . n A 1 94 ASN 94 380 380 ASN ASN A . n A 1 95 GLY 95 381 381 GLY GLY A . n A 1 96 GLY 96 382 382 GLY GLY A . n A 1 97 SER 97 383 383 SER SER A . n A 1 98 LEU 98 384 384 LEU LEU A . n A 1 99 ALA 99 385 385 ALA ALA A . n A 1 100 ASP 100 386 386 ASP ASP A . n A 1 101 ALA 101 387 387 ALA ALA A . n A 1 102 ILE 102 388 388 ILE ILE A . n A 1 103 SER 103 389 389 SER SER A . n A 1 104 GLU 104 390 390 GLU GLU A . n A 1 105 ASN 105 391 391 ASN ASN A . n A 1 106 TYR 106 392 392 TYR TYR A . n A 1 107 ARG 107 393 393 ARG ARG A . n A 1 108 ILE 108 394 394 ILE ILE A . n A 1 109 MET 109 395 395 MET MET A . n A 1 110 SER 110 396 396 SER SER A . n A 1 111 TYR 111 397 397 TYR TYR A . n A 1 112 PHE 112 398 398 PHE PHE A . n A 1 113 LYS 113 399 399 LYS LYS A . n A 1 114 GLU 114 400 400 GLU GLU A . n A 1 115 ALA 115 401 401 ALA ALA A . n A 1 116 GLU 116 402 402 GLU GLU A . n A 1 117 LEU 117 403 403 LEU LEU A . n A 1 118 LYS 118 404 404 LYS LYS A . n A 1 119 ASP 119 405 405 ASP ASP A . n A 1 120 LEU 120 406 406 LEU LEU A . n A 1 121 LEU 121 407 407 LEU LEU A . n A 1 122 LEU 122 408 408 LEU LEU A . n A 1 123 GLN 123 409 409 GLN GLN A . n A 1 124 VAL 124 410 410 VAL VAL A . n A 1 125 GLY 125 411 411 GLY GLY A . n A 1 126 ARG 126 412 412 ARG ARG A . n A 1 127 GLY 127 413 413 GLY GLY A . n A 1 128 LEU 128 414 414 LEU LEU A . n A 1 129 ARG 129 415 415 ARG ARG A . n A 1 130 TYR 130 416 416 TYR TYR A . n A 1 131 ILE 131 417 417 ILE ILE A . n A 1 132 HIS 132 418 418 HIS HIS A . n A 1 133 SER 133 419 419 SER SER A . n A 1 134 MET 134 420 420 MET MET A . n A 1 135 SER 135 421 421 SER SER A . n A 1 136 LEU 136 422 422 LEU LEU A . n A 1 137 VAL 137 423 423 VAL VAL A . n A 1 138 HIS 138 424 424 HIS HIS A . n A 1 139 MET 139 425 425 MET MET A . n A 1 140 ASP 140 426 426 ASP ASP A . n A 1 141 ILE 141 427 427 ILE ILE A . n A 1 142 LYS 142 428 428 LYS LYS A . n A 1 143 PRO 143 429 429 PRO PRO A . n A 1 144 SER 144 430 430 SER SER A . n A 1 145 ASN 145 431 431 ASN ASN A . n A 1 146 ILE 146 432 432 ILE ILE A . n A 1 147 PHE 147 433 433 PHE PHE A . n A 1 148 ILE 148 434 434 ILE ILE A . n A 1 149 SER 149 435 435 SER SER A . n A 1 150 ARG 150 436 436 ARG ARG A . n A 1 151 THR 151 437 ? ? ? A . n A 1 152 SER 152 438 ? ? ? A . n A 1 153 ILE 153 439 ? ? ? A . n A 1 154 PRO 154 440 ? ? ? A . n A 1 155 ASN 155 441 ? ? ? A . n A 1 156 ALA 156 442 ? ? ? A . n A 1 157 ALA 157 443 ? ? ? A . n A 1 158 SER 158 444 ? ? ? A . n A 1 159 GLU 159 445 ? ? ? A . n A 1 160 GLU 160 446 ? ? ? A . n A 1 161 GLY 161 447 ? ? ? A . n A 1 162 ASP 162 448 ? ? ? A . n A 1 163 GLU 163 449 ? ? ? A . n A 1 164 ASP 164 450 ? ? ? A . n A 1 165 ASP 165 451 ? ? ? A . n A 1 166 TRP 166 452 ? ? ? A . n A 1 167 ALA 167 453 ? ? ? A . n A 1 168 SER 168 454 ? ? ? A . n A 1 169 ASN 169 455 ? ? ? A . n A 1 170 LYS 170 456 456 LYS LYS A . n A 1 171 VAL 171 457 457 VAL VAL A . n A 1 172 MET 172 458 458 MET MET A . n A 1 173 PHE 173 459 459 PHE PHE A . n A 1 174 LYS 174 460 460 LYS LYS A . n A 1 175 ILE 175 461 461 ILE ILE A . n A 1 176 GLY 176 462 462 GLY GLY A . n A 1 177 ASP 177 463 463 ASP ASP A . n A 1 178 LEU 178 464 464 LEU LEU A . n A 1 179 GLY 179 465 465 GLY GLY A . n A 1 180 HIS 180 466 466 HIS HIS A . n A 1 181 VAL 181 467 467 VAL VAL A . n A 1 182 THR 182 468 468 THR THR A . n A 1 183 ARG 183 469 469 ARG ARG A . n A 1 184 ILE 184 470 470 ILE ILE A . n A 1 185 SER 185 471 471 SER SER A . n A 1 186 SER 186 472 472 SER SER A . n A 1 187 PRO 187 473 473 PRO PRO A . n A 1 188 GLN 188 474 474 GLN GLN A . n A 1 189 VAL 189 475 475 VAL VAL A . n A 1 190 GLU 190 476 476 GLU GLU A . n A 1 191 GLU 191 477 477 GLU GLU A . n A 1 192 GLY 192 478 478 GLY GLY A . n A 1 193 ASP 193 479 479 ASP ASP A . n A 1 194 SER 194 480 480 SER SER A . n A 1 195 ARG 195 481 481 ARG ARG A . n A 1 196 PHE 196 482 482 PHE PHE A . n A 1 197 LEU 197 483 483 LEU LEU A . n A 1 198 ALA 198 484 484 ALA ALA A . n A 1 199 ASN 199 485 485 ASN ASN A . n A 1 200 GLU 200 486 486 GLU GLU A . n A 1 201 VAL 201 487 487 VAL VAL A . n A 1 202 LEU 202 488 488 LEU LEU A . n A 1 203 GLN 203 489 489 GLN GLN A . n A 1 204 GLU 204 490 490 GLU GLU A . n A 1 205 ASN 205 491 491 ASN ASN A . n A 1 206 TYR 206 492 492 TYR TYR A . n A 1 207 THR 207 493 493 THR THR A . n A 1 208 HIS 208 494 494 HIS HIS A . n A 1 209 LEU 209 495 495 LEU LEU A . n A 1 210 PRO 210 496 496 PRO PRO A . n A 1 211 LYS 211 497 497 LYS LYS A . n A 1 212 ALA 212 498 498 ALA ALA A . n A 1 213 ASP 213 499 499 ASP ASP A . n A 1 214 ILE 214 500 500 ILE ILE A . n A 1 215 PHE 215 501 501 PHE PHE A . n A 1 216 ALA 216 502 502 ALA ALA A . n A 1 217 LEU 217 503 503 LEU LEU A . n A 1 218 ALA 218 504 504 ALA ALA A . n A 1 219 LEU 219 505 505 LEU LEU A . n A 1 220 THR 220 506 506 THR THR A . n A 1 221 VAL 221 507 507 VAL VAL A . n A 1 222 VAL 222 508 508 VAL VAL A . n A 1 223 CYS 223 509 509 CYS CYS A . n A 1 224 ALA 224 510 510 ALA ALA A . n A 1 225 ALA 225 511 511 ALA ALA A . n A 1 226 GLY 226 512 512 GLY GLY A . n A 1 227 ALA 227 513 513 ALA ALA A . n A 1 228 GLU 228 514 514 GLU GLU A . n A 1 229 PRO 229 515 515 PRO PRO A . n A 1 230 LEU 230 516 516 LEU LEU A . n A 1 231 PRO 231 517 517 PRO PRO A . n A 1 232 ARG 232 518 518 ARG ARG A . n A 1 233 ASN 233 519 519 ASN ASN A . n A 1 234 GLY 234 520 520 GLY GLY A . n A 1 235 ASP 235 521 521 ASP ASP A . n A 1 236 GLN 236 522 522 GLN GLN A . n A 1 237 TRP 237 523 523 TRP TRP A . n A 1 238 HIS 238 524 524 HIS HIS A . n A 1 239 GLU 239 525 525 GLU GLU A . n A 1 240 ILE 240 526 526 ILE ILE A . n A 1 241 ARG 241 527 527 ARG ARG A . n A 1 242 GLN 242 528 528 GLN GLN A . n A 1 243 GLY 243 529 529 GLY GLY A . n A 1 244 ARG 244 530 530 ARG ARG A . n A 1 245 LEU 245 531 531 LEU LEU A . n A 1 246 PRO 246 532 532 PRO PRO A . n A 1 247 ARG 247 533 533 ARG ARG A . n A 1 248 ILE 248 534 534 ILE ILE A . n A 1 249 PRO 249 535 535 PRO PRO A . n A 1 250 GLN 250 536 536 GLN GLN A . n A 1 251 VAL 251 537 537 VAL VAL A . n A 1 252 LEU 252 538 538 LEU LEU A . n A 1 253 SER 253 539 539 SER SER A . n A 1 254 GLN 254 540 540 GLN GLN A . n A 1 255 GLU 255 541 541 GLU GLU A . n A 1 256 PHE 256 542 542 PHE PHE A . n A 1 257 THR 257 543 543 THR THR A . n A 1 258 GLU 258 544 544 GLU GLU A . n A 1 259 LEU 259 545 545 LEU LEU A . n A 1 260 LEU 260 546 546 LEU LEU A . n A 1 261 LYS 261 547 547 LYS LYS A . n A 1 262 VAL 262 548 548 VAL VAL A . n A 1 263 MET 263 549 549 MET MET A . n A 1 264 ILE 264 550 550 ILE ILE A . n A 1 265 HIS 265 551 551 HIS HIS A . n A 1 266 PRO 266 552 552 PRO PRO A . n A 1 267 ASP 267 553 553 ASP ASP A . n A 1 268 PRO 268 554 554 PRO PRO A . n A 1 269 GLU 269 555 555 GLU GLU A . n A 1 270 ARG 270 556 556 ARG ARG A . n A 1 271 ARG 271 557 557 ARG ARG A . n A 1 272 PRO 272 558 558 PRO PRO A . n A 1 273 SER 273 559 559 SER SER A . n A 1 274 ALA 274 560 560 ALA ALA A . n A 1 275 MET 275 561 561 MET MET A . n A 1 276 ALA 276 562 562 ALA ALA A . n A 1 277 LEU 277 563 563 LEU LEU A . n A 1 278 VAL 278 564 564 VAL VAL A . n A 1 279 LYS 279 565 565 LYS LYS A . n A 1 280 HIS 280 566 566 HIS HIS A . n A 1 281 SER 281 567 567 SER SER A . n A 1 282 VAL 282 568 568 VAL VAL A . n A 1 283 LEU 283 569 569 LEU LEU A . n A 1 284 LEU 284 570 570 LEU LEU A . n A 1 285 SER 285 571 571 SER SER A . n A 1 286 ALA 286 572 ? ? ? A . n A 1 287 SER 287 573 ? ? ? A . n A 1 288 ARG 288 574 ? ? ? A . n A 1 289 LYS 289 575 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 99M 1 601 1 99M LIG A . C 3 CL 1 602 1 CL CL A . D 4 HOH 1 701 46 HOH HOH A . D 4 HOH 2 702 43 HOH HOH A . D 4 HOH 3 703 49 HOH HOH A . D 4 HOH 4 704 57 HOH HOH A . D 4 HOH 5 705 38 HOH HOH A . D 4 HOH 6 706 26 HOH HOH A . D 4 HOH 7 707 55 HOH HOH A . D 4 HOH 8 708 54 HOH HOH A . D 4 HOH 9 709 9 HOH HOH A . D 4 HOH 10 710 17 HOH HOH A . D 4 HOH 11 711 37 HOH HOH A . D 4 HOH 12 712 36 HOH HOH A . D 4 HOH 13 713 35 HOH HOH A . D 4 HOH 14 714 47 HOH HOH A . D 4 HOH 15 715 8 HOH HOH A . D 4 HOH 16 716 22 HOH HOH A . D 4 HOH 17 717 20 HOH HOH A . D 4 HOH 18 718 12 HOH HOH A . D 4 HOH 19 719 13 HOH HOH A . D 4 HOH 20 720 24 HOH HOH A . D 4 HOH 21 721 52 HOH HOH A . D 4 HOH 22 722 19 HOH HOH A . D 4 HOH 23 723 16 HOH HOH A . D 4 HOH 24 724 14 HOH HOH A . D 4 HOH 25 725 28 HOH HOH A . D 4 HOH 26 726 7 HOH HOH A . D 4 HOH 27 727 1 HOH HOH A . D 4 HOH 28 728 25 HOH HOH A . D 4 HOH 29 729 6 HOH HOH A . D 4 HOH 30 730 41 HOH HOH A . D 4 HOH 31 731 30 HOH HOH A . D 4 HOH 32 732 11 HOH HOH A . D 4 HOH 33 733 4 HOH HOH A . D 4 HOH 34 734 18 HOH HOH A . D 4 HOH 35 735 29 HOH HOH A . D 4 HOH 36 736 39 HOH HOH A . D 4 HOH 37 737 10 HOH HOH A . D 4 HOH 38 738 56 HOH HOH A . D 4 HOH 39 739 15 HOH HOH A . D 4 HOH 40 740 2 HOH HOH A . D 4 HOH 41 741 42 HOH HOH A . D 4 HOH 42 742 50 HOH HOH A . D 4 HOH 43 743 27 HOH HOH A . D 4 HOH 44 744 45 HOH HOH A . D 4 HOH 45 745 5 HOH HOH A . D 4 HOH 46 746 34 HOH HOH A . D 4 HOH 47 747 58 HOH HOH A . D 4 HOH 48 748 33 HOH HOH A . D 4 HOH 49 749 3 HOH HOH A . D 4 HOH 50 750 23 HOH HOH A . D 4 HOH 51 751 51 HOH HOH A . D 4 HOH 52 752 48 HOH HOH A . D 4 HOH 53 753 40 HOH HOH A . D 4 HOH 54 754 21 HOH HOH A . D 4 HOH 55 755 60 HOH HOH A . D 4 HOH 56 756 61 HOH HOH A . D 4 HOH 57 757 53 HOH HOH A . D 4 HOH 58 758 59 HOH HOH A . D 4 HOH 59 759 32 HOH HOH A . D 4 HOH 60 760 31 HOH HOH A . D 4 HOH 61 761 44 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-04 2 'Structure model' 1 1 2019-12-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_audit_support # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -11.5393 -2.2101 7.6051 0.2376 0.2241 0.3318 -0.0181 -0.0321 0.0421 2.6700 6.9666 5.9361 1.7795 -2.0307 -1.9252 -0.3258 0.1220 0.2321 0.4179 -0.6690 -0.1531 -0.5893 0.2795 -0.3616 'X-RAY DIFFRACTION' 2 ? refined -7.1839 -6.4486 9.3777 0.3050 0.2026 0.2439 -0.0461 -0.0207 0.0454 4.0634 3.8691 3.3089 -3.0213 -0.6466 1.6664 -0.1234 0.2222 -0.0469 -0.2011 -0.2860 0.4089 -0.3730 0.1597 0.2822 'X-RAY DIFFRACTION' 3 ? refined 5.8895 -9.2775 13.6143 0.6173 0.3094 0.5941 0.0118 -0.1243 -0.1102 3.3871 2.4177 4.7616 -0.8230 1.4658 -0.5776 0.4174 0.0690 0.9932 0.3781 -1.3949 0.3033 -0.2473 0.0861 -0.6787 'X-RAY DIFFRACTION' 4 ? refined -3.8539 -4.7802 19.5470 0.3464 0.2600 0.2668 0.0556 -0.0236 0.1202 3.8313 2.1215 0.5165 2.0942 0.9323 -0.0228 0.4917 -0.1707 0.0815 -0.6916 -0.7069 -0.4641 0.2895 0.3936 -0.3207 'X-RAY DIFFRACTION' 5 ? refined -6.2764 -2.1236 11.4096 0.2914 0.2096 0.1986 0.0373 0.0027 0.0960 4.9591 6.1467 3.3189 1.1882 1.2655 1.2893 -0.1583 0.2411 -0.1391 0.0300 -0.0531 0.2802 -0.5946 0.3042 0.1594 'X-RAY DIFFRACTION' 6 ? refined -0.6989 22.0103 12.7612 0.6840 0.2600 0.4761 0.0728 -0.1342 0.0196 3.3945 0.5243 0.6434 0.1877 -1.1619 0.2924 -0.2177 -0.0194 -0.2833 0.2135 1.0493 -0.1599 0.3677 -1.6037 -0.4472 'X-RAY DIFFRACTION' 7 ? refined 4.8397 7.9666 22.5380 0.2967 0.2451 0.1698 0.0379 -0.0527 -0.0135 2.3593 2.5985 2.0081 0.1254 0.4857 -0.1799 -0.2249 -0.0762 -0.0264 -0.4242 0.1895 -0.2035 0.4877 -0.3570 -0.0647 'X-RAY DIFFRACTION' 8 ? refined 13.8105 -0.7887 13.5692 0.3713 0.3771 0.3825 0.0579 0.0085 0.0610 5.4943 4.3774 4.9344 1.0472 -0.6567 -1.9512 0.0327 -0.2491 0.0460 0.6590 -0.5086 -0.4273 -0.7797 0.6965 0.3164 'X-RAY DIFFRACTION' 9 ? refined 17.9624 13.7997 18.8200 0.3905 0.3484 0.5752 -0.0559 -0.1546 0.0709 4.1897 3.3137 1.7468 -0.7501 0.1132 -0.4233 -0.1555 -0.2347 -0.5074 -0.1064 0.9383 -0.9632 0.2873 -0.3665 0.4780 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 293 A 318 ;chain 'A' and (resid 293 through 318 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 319 A 337 ;chain 'A' and (resid 319 through 337 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 338 A 353 ;chain 'A' and (resid 338 through 353 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 354 A 368 ;chain 'A' and (resid 354 through 368 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 369 A 383 ;chain 'A' and (resid 369 through 383 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 384 A 399 ;chain 'A' and (resid 384 through 399 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 400 A 461 ;chain 'A' and (resid 400 through 461 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 462 A 484 ;chain 'A' and (resid 462 through 484 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 485 A 571 ;chain 'A' and (resid 485 through 571 ) ; ? ? ? ? ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? SERGUI ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASN 342 ? ? HH21 A ARG 345 ? ? 1.41 2 1 H A ILE 534 ? ? O A HOH 702 ? ? 1.50 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 HH12 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 319 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 490 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_455 _pdbx_validate_symm_contact.dist 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 396 ? ? -112.85 -167.99 2 1 ASP A 426 ? ? -151.56 44.86 3 1 ASP A 463 ? ? 54.99 76.73 4 1 SER A 472 ? ? -114.32 68.28 5 1 HIS A 494 ? ? -142.68 48.36 6 1 ASN A 519 ? ? -179.13 -173.20 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 287 ? A GLY 1 2 1 Y 1 A ALA 288 ? A ALA 2 3 1 Y 1 A GLY 289 ? A GLY 3 4 1 Y 1 A SER 290 ? A SER 4 5 1 Y 1 A MET 291 ? A MET 5 6 1 Y 1 A LYS 292 ? A LYS 6 7 1 Y 1 A THR 437 ? A THR 151 8 1 Y 1 A SER 438 ? A SER 152 9 1 Y 1 A ILE 439 ? A ILE 153 10 1 Y 1 A PRO 440 ? A PRO 154 11 1 Y 1 A ASN 441 ? A ASN 155 12 1 Y 1 A ALA 442 ? A ALA 156 13 1 Y 1 A ALA 443 ? A ALA 157 14 1 Y 1 A SER 444 ? A SER 158 15 1 Y 1 A GLU 445 ? A GLU 159 16 1 Y 1 A GLU 446 ? A GLU 160 17 1 Y 1 A GLY 447 ? A GLY 161 18 1 Y 1 A ASP 448 ? A ASP 162 19 1 Y 1 A GLU 449 ? A GLU 163 20 1 Y 1 A ASP 450 ? A ASP 164 21 1 Y 1 A ASP 451 ? A ASP 165 22 1 Y 1 A TRP 452 ? A TRP 166 23 1 Y 1 A ALA 453 ? A ALA 167 24 1 Y 1 A SER 454 ? A SER 168 25 1 Y 1 A ASN 455 ? A ASN 169 26 1 Y 1 A ALA 572 ? A ALA 286 27 1 Y 1 A SER 573 ? A SER 287 28 1 Y 1 A ARG 574 ? A ARG 288 29 1 Y 1 A LYS 575 ? A LYS 289 # _pdbx_audit_support.funding_organization 'National Institutes of Health/Eunice Kennedy Shriver National Institute of Child Health & Human Development (NIH/NICHD)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'UO1 HD076542' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;1-[6-(2-hydroxypropan-2-yl)pyridin-2-yl]-6-{[4-(morpholin-4-yl)phenyl]amino}-2-(prop-2-en-1-yl)-1,2-dihydro-3H-pyrazolo[3,4-d]pyrimidin-3-one ; 99M 3 'CHLORIDE ION' CL 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #