data_5VD9 # _entry.id 5VD9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5VD9 WWPDB D_1000227255 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 5VC3 PDB unspecified . 5VC4 PDB unspecified . 5VC5 PDB unspecified . 5VD2 PDB unspecified . 5VC6 PDB unspecified . 5VD8 PDB unspecified . 5VD7 PDB unspecified . 5VD5 PDB unspecified . 5VD4 PDB unspecified . 5VDA PDB unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VD9 _pdbx_database_status.recvd_initial_deposition_date 2017-04-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhu, J.-Y.' 1 ? 'Schonbrunn, E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'to be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural basis of Wee family kinase inhibition by small molecules' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, J.-Y.' 1 ? primary 'Schonbrunn, E.' 2 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 102.140 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5VD9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.370 _cell.length_a_esd ? _cell.length_b 44.590 _cell.length_b_esd ? _cell.length_c 64.590 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VD9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Wee1-like protein kinase' 32440.900 1 2.7.10.2 ? 'UNP RESIDUES 291-575' ? 2 non-polymer syn ;1-{6-[(1R)-1-hydroxyethyl]pyridin-2-yl}-6-{[4-(4-methylpiperazin-1-yl)phenyl]amino}-2-(prop-2-en-1-yl)-1,2-dihydro-3H-pyrazolo[3,4-d]pyrimidin-3-one ; 486.569 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 5 water nat water 18.015 62 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'WEE1hu,Wee1A kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAGSMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAW AEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEE GDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEI RQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK ; _entity_poly.pdbx_seq_one_letter_code_can ;GAGSMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAW AEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEE GDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEI RQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 LYS n 1 7 SER n 1 8 ARG n 1 9 TYR n 1 10 THR n 1 11 THR n 1 12 GLU n 1 13 PHE n 1 14 HIS n 1 15 GLU n 1 16 LEU n 1 17 GLU n 1 18 LYS n 1 19 ILE n 1 20 GLY n 1 21 SER n 1 22 GLY n 1 23 GLU n 1 24 PHE n 1 25 GLY n 1 26 SER n 1 27 VAL n 1 28 PHE n 1 29 LYS n 1 30 CYS n 1 31 VAL n 1 32 LYS n 1 33 ARG n 1 34 LEU n 1 35 ASP n 1 36 GLY n 1 37 CYS n 1 38 ILE n 1 39 TYR n 1 40 ALA n 1 41 ILE n 1 42 LYS n 1 43 ARG n 1 44 SER n 1 45 LYS n 1 46 LYS n 1 47 PRO n 1 48 LEU n 1 49 ALA n 1 50 GLY n 1 51 SER n 1 52 VAL n 1 53 ASP n 1 54 GLU n 1 55 GLN n 1 56 ASN n 1 57 ALA n 1 58 LEU n 1 59 ARG n 1 60 GLU n 1 61 VAL n 1 62 TYR n 1 63 ALA n 1 64 HIS n 1 65 ALA n 1 66 VAL n 1 67 LEU n 1 68 GLY n 1 69 GLN n 1 70 HIS n 1 71 SER n 1 72 HIS n 1 73 VAL n 1 74 VAL n 1 75 ARG n 1 76 TYR n 1 77 PHE n 1 78 SER n 1 79 ALA n 1 80 TRP n 1 81 ALA n 1 82 GLU n 1 83 ASP n 1 84 ASP n 1 85 HIS n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 GLN n 1 90 ASN n 1 91 GLU n 1 92 TYR n 1 93 CYS n 1 94 ASN n 1 95 GLY n 1 96 GLY n 1 97 SER n 1 98 LEU n 1 99 ALA n 1 100 ASP n 1 101 ALA n 1 102 ILE n 1 103 SER n 1 104 GLU n 1 105 ASN n 1 106 TYR n 1 107 ARG n 1 108 ILE n 1 109 MET n 1 110 SER n 1 111 TYR n 1 112 PHE n 1 113 LYS n 1 114 GLU n 1 115 ALA n 1 116 GLU n 1 117 LEU n 1 118 LYS n 1 119 ASP n 1 120 LEU n 1 121 LEU n 1 122 LEU n 1 123 GLN n 1 124 VAL n 1 125 GLY n 1 126 ARG n 1 127 GLY n 1 128 LEU n 1 129 ARG n 1 130 TYR n 1 131 ILE n 1 132 HIS n 1 133 SER n 1 134 MET n 1 135 SER n 1 136 LEU n 1 137 VAL n 1 138 HIS n 1 139 MET n 1 140 ASP n 1 141 ILE n 1 142 LYS n 1 143 PRO n 1 144 SER n 1 145 ASN n 1 146 ILE n 1 147 PHE n 1 148 ILE n 1 149 SER n 1 150 ARG n 1 151 THR n 1 152 SER n 1 153 ILE n 1 154 PRO n 1 155 ASN n 1 156 ALA n 1 157 ALA n 1 158 SER n 1 159 GLU n 1 160 GLU n 1 161 GLY n 1 162 ASP n 1 163 GLU n 1 164 ASP n 1 165 ASP n 1 166 TRP n 1 167 ALA n 1 168 SER n 1 169 ASN n 1 170 LYS n 1 171 VAL n 1 172 MET n 1 173 PHE n 1 174 LYS n 1 175 ILE n 1 176 GLY n 1 177 ASP n 1 178 LEU n 1 179 GLY n 1 180 HIS n 1 181 VAL n 1 182 THR n 1 183 ARG n 1 184 ILE n 1 185 SER n 1 186 SER n 1 187 PRO n 1 188 GLN n 1 189 VAL n 1 190 GLU n 1 191 GLU n 1 192 GLY n 1 193 ASP n 1 194 SER n 1 195 ARG n 1 196 PHE n 1 197 LEU n 1 198 ALA n 1 199 ASN n 1 200 GLU n 1 201 VAL n 1 202 LEU n 1 203 GLN n 1 204 GLU n 1 205 ASN n 1 206 TYR n 1 207 THR n 1 208 HIS n 1 209 LEU n 1 210 PRO n 1 211 LYS n 1 212 ALA n 1 213 ASP n 1 214 ILE n 1 215 PHE n 1 216 ALA n 1 217 LEU n 1 218 ALA n 1 219 LEU n 1 220 THR n 1 221 VAL n 1 222 VAL n 1 223 CYS n 1 224 ALA n 1 225 ALA n 1 226 GLY n 1 227 ALA n 1 228 GLU n 1 229 PRO n 1 230 LEU n 1 231 PRO n 1 232 ARG n 1 233 ASN n 1 234 GLY n 1 235 ASP n 1 236 GLN n 1 237 TRP n 1 238 HIS n 1 239 GLU n 1 240 ILE n 1 241 ARG n 1 242 GLN n 1 243 GLY n 1 244 ARG n 1 245 LEU n 1 246 PRO n 1 247 ARG n 1 248 ILE n 1 249 PRO n 1 250 GLN n 1 251 VAL n 1 252 LEU n 1 253 SER n 1 254 GLN n 1 255 GLU n 1 256 PHE n 1 257 THR n 1 258 GLU n 1 259 LEU n 1 260 LEU n 1 261 LYS n 1 262 VAL n 1 263 MET n 1 264 ILE n 1 265 HIS n 1 266 PRO n 1 267 ASP n 1 268 PRO n 1 269 GLU n 1 270 ARG n 1 271 ARG n 1 272 PRO n 1 273 SER n 1 274 ALA n 1 275 MET n 1 276 ALA n 1 277 LEU n 1 278 VAL n 1 279 LYS n 1 280 HIS n 1 281 SER n 1 282 VAL n 1 283 LEU n 1 284 LEU n 1 285 SER n 1 286 ALA n 1 287 SER n 1 288 ARG n 1 289 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 289 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene WEE1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-RIPL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code WEE1_HUMAN _struct_ref.pdbx_db_accession P30291 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDD HMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDED DWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGR LPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK ; _struct_ref.pdbx_align_begin 291 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5VD9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 289 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P30291 _struct_ref_seq.db_align_beg 291 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 575 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 291 _struct_ref_seq.pdbx_auth_seq_align_end 575 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5VD9 GLY A 1 ? UNP P30291 ? ? 'expression tag' 287 1 1 5VD9 ALA A 2 ? UNP P30291 ? ? 'expression tag' 288 2 1 5VD9 GLY A 3 ? UNP P30291 ? ? 'expression tag' 289 3 1 5VD9 SER A 4 ? UNP P30291 ? ? 'expression tag' 290 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 98G non-polymer . ;1-{6-[(1R)-1-hydroxyethyl]pyridin-2-yl}-6-{[4-(4-methylpiperazin-1-yl)phenyl]amino}-2-(prop-2-en-1-yl)-1,2-dihydro-3H-pyrazolo[3,4-d]pyrimidin-3-one ; ? 'C26 H30 N8 O2' 486.569 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VD9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '5.0 MG/ML WEE1, 25 mM Na/K phosphate, 1 mM DTT, 0.05 M ammonium sulfate, 0.05 M Bis-tris (pH 5.5), 7.5 % PEG 3350, 1 mM RAC-IV-097' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'ROSENBAUM-ROCK DOUBLE-CRYSTAL' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 29.070 _reflns.entry_id 5VD9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.870 _reflns.d_resolution_low 33.053 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23118 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 98.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.678 _reflns.pdbx_Rmerge_I_obs 0.044 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.770 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.996 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.052 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.870 1.920 ? 4.790 ? ? ? ? 1686 98.800 ? ? ? ? 0.280 ? ? ? ? ? ? ? ? 3.604 ? ? ? ? 0.329 ? ? 1 1 0.949 ? 1.920 1.970 ? 6.100 ? ? ? ? 1643 98.100 ? ? ? ? 0.222 ? ? ? ? ? ? ? ? 3.624 ? ? ? ? 0.261 ? ? 2 1 0.962 ? 1.970 2.030 ? 7.550 ? ? ? ? 1594 97.900 ? ? ? ? 0.173 ? ? ? ? ? ? ? ? 3.599 ? ? ? ? 0.204 ? ? 3 1 0.974 ? 2.030 2.090 ? 8.970 ? ? ? ? 1590 99.500 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 3.596 ? ? ? ? 0.170 ? ? 4 1 0.984 ? 2.090 2.160 ? 10.770 ? ? ? ? 1486 98.500 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 3.602 ? ? ? ? 0.133 ? ? 5 1 0.987 ? 2.160 2.240 ? 12.660 ? ? ? ? 1476 98.300 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 3.695 ? ? ? ? 0.114 ? ? 6 1 0.992 ? 2.240 2.320 ? 14.460 ? ? ? ? 1431 99.700 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 3.753 ? ? ? ? 0.097 ? ? 7 1 0.994 ? 2.320 2.410 ? 16.540 ? ? ? ? 1352 98.900 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 3.766 ? ? ? ? 0.082 ? ? 8 1 0.994 ? 2.410 2.520 ? 18.370 ? ? ? ? 1326 98.500 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 3.758 ? ? ? ? 0.073 ? ? 9 1 0.995 ? 2.520 2.640 ? 19.900 ? ? ? ? 1249 99.000 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 3.758 ? ? ? ? 0.067 ? ? 10 1 0.995 ? 2.640 2.790 ? 22.060 ? ? ? ? 1220 99.000 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 3.734 ? ? ? ? 0.058 ? ? 11 1 0.996 ? 2.790 2.960 ? 24.770 ? ? ? ? 1121 98.800 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 3.738 ? ? ? ? 0.054 ? ? 12 1 0.997 ? 2.960 3.160 ? 27.460 ? ? ? ? 1071 98.800 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 3.731 ? ? ? ? 0.048 ? ? 13 1 0.996 ? 3.160 3.410 ? 29.690 ? ? ? ? 989 98.500 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 3.723 ? ? ? ? 0.046 ? ? 14 1 0.996 ? 3.410 3.740 ? 31.560 ? ? ? ? 923 99.400 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 3.709 ? ? ? ? 0.042 ? ? 15 1 0.997 ? 3.740 4.180 ? 32.270 ? ? ? ? 821 98.900 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 3.688 ? ? ? ? 0.044 ? ? 16 1 0.996 ? 4.180 4.830 ? 33.230 ? ? ? ? 740 98.500 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 3.707 ? ? ? ? 0.040 ? ? 17 1 0.997 ? 4.830 5.910 ? 32.600 ? ? ? ? 628 99.100 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 3.623 ? ? ? ? 0.039 ? ? 18 1 0.997 ? 5.910 8.360 ? 33.100 ? ? ? ? 503 98.400 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 3.616 ? ? ? ? 0.038 ? ? 19 1 0.997 ? 8.360 33.053 ? 32.240 ? ? ? ? 269 94.100 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 3.257 ? ? ? ? 0.049 ? ? 20 1 0.996 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 220.830 _refine.B_iso_mean 55.3207 _refine.B_iso_min 16.880 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5VD9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8700 _refine.ls_d_res_low 33.0530 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23118 _refine.ls_number_reflns_R_free 1156 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.7600 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2529 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2016 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5V5Y _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.8200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.8700 _refine_hist.d_res_low 33.0530 _refine_hist.pdbx_number_atoms_ligand 77 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 2218 _refine_hist.pdbx_number_residues_total 261 _refine_hist.pdbx_B_iso_mean_ligand 43.22 _refine_hist.pdbx_B_iso_mean_solvent 38.43 _refine_hist.pdbx_number_atoms_protein 2079 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 ? 2166 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.462 ? 2922 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.059 ? 314 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 373 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.927 ? 816 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8699 1.9550 2826 . 141 2685 98.0000 . . . 0.3024 0.0000 0.2428 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 1.9550 2.0580 2860 . 143 2717 99.0000 . . . 0.2988 0.0000 0.2281 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.0580 2.1870 2897 . 145 2752 99.0000 . . . 0.2700 0.0000 0.2169 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.1870 2.3558 2853 . 142 2711 99.0000 . . . 0.2493 0.0000 0.2193 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.3558 2.5928 2908 . 146 2762 99.0000 . . . 0.2903 0.0000 0.2213 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.5928 2.9677 2902 . 145 2757 99.0000 . . . 0.2512 0.0000 0.2280 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.9677 3.7382 2910 . 145 2765 99.0000 . . . 0.2544 0.0000 0.2012 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 3.7382 33.0583 2962 . 149 2813 99.0000 . . . 0.2325 0.0000 0.1712 . . . . . . 8 . . . # _struct.entry_id 5VD9 _struct.title 'Crystal structure of human WEE1 kinase domain in complex with RAC-IV-097, a MK1775 analogue' _struct.pdbx_descriptor 'Wee1-like protein kinase (E.C.2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VD9 _struct_keywords.text 'KINASE DOMAIN, CELL CYCLE, WEE1, TRANSFERASE, INHIBITOR, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? GLU A 12 ? SER A 293 GLU A 298 1 ? 6 HELX_P HELX_P2 AA2 SER A 51 ? GLY A 68 ? SER A 337 GLY A 354 1 ? 18 HELX_P HELX_P3 AA3 SER A 97 ? MET A 109 ? SER A 383 MET A 395 1 ? 13 HELX_P HELX_P4 AA4 LYS A 113 ? MET A 134 ? LYS A 399 MET A 420 1 ? 22 HELX_P HELX_P5 AA5 LYS A 142 ? SER A 144 ? LYS A 428 SER A 430 5 ? 3 HELX_P HELX_P6 AA6 ALA A 198 ? GLN A 203 ? ALA A 484 GLN A 489 1 ? 6 HELX_P HELX_P7 AA7 HIS A 208 ? ALA A 225 ? HIS A 494 ALA A 511 1 ? 18 HELX_P HELX_P8 AA8 GLY A 234 ? GLN A 242 ? GLY A 520 GLN A 528 1 ? 9 HELX_P HELX_P9 AA9 SER A 253 ? ILE A 264 ? SER A 539 ILE A 550 1 ? 12 HELX_P HELX_P10 AB1 ASP A 267 ? ARG A 271 ? ASP A 553 ARG A 557 5 ? 5 HELX_P HELX_P11 AB2 SER A 273 ? LYS A 279 ? SER A 559 LYS A 565 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 13 ? GLY A 22 ? PHE A 299 GLY A 308 AA1 2 GLY A 25 ? LYS A 32 ? GLY A 311 LYS A 318 AA1 3 ILE A 38 ? LYS A 45 ? ILE A 324 LYS A 331 AA1 4 HIS A 85 ? GLU A 91 ? HIS A 371 GLU A 377 AA1 5 TYR A 76 ? GLU A 82 ? TYR A 362 GLU A 368 AA2 1 LEU A 136 ? VAL A 137 ? LEU A 422 VAL A 423 AA2 2 THR A 182 ? ARG A 183 ? THR A 468 ARG A 469 AA3 1 ILE A 146 ? SER A 149 ? ILE A 432 SER A 435 AA3 2 MET A 172 ? ILE A 175 ? MET A 458 ILE A 461 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 16 ? N LEU A 302 O LYS A 29 ? O LYS A 315 AA1 2 3 N SER A 26 ? N SER A 312 O ARG A 43 ? O ARG A 329 AA1 3 4 N ALA A 40 ? N ALA A 326 O ASN A 90 ? O ASN A 376 AA1 4 5 O LEU A 87 ? O LEU A 373 N TRP A 80 ? N TRP A 366 AA2 1 2 N VAL A 137 ? N VAL A 423 O THR A 182 ? O THR A 468 AA3 1 2 N PHE A 147 ? N PHE A 433 O LYS A 174 ? O LYS A 460 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 98G 601 ? 14 'binding site for residue 98G A 601' AC2 Software A CL 602 ? 1 'binding site for residue CL A 602' AC3 Software A EDO 603 ? 2 'binding site for residue EDO A 603' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 ILE A 19 ? ILE A 305 . ? 1_555 ? 2 AC1 14 PHE A 24 ? PHE A 310 . ? 1_555 ? 3 AC1 14 VAL A 27 ? VAL A 313 . ? 1_555 ? 4 AC1 14 ALA A 40 ? ALA A 326 . ? 1_555 ? 5 AC1 14 VAL A 74 ? VAL A 360 . ? 1_555 ? 6 AC1 14 ASN A 90 ? ASN A 376 . ? 1_555 ? 7 AC1 14 GLU A 91 ? GLU A 377 . ? 1_555 ? 8 AC1 14 TYR A 92 ? TYR A 378 . ? 1_555 ? 9 AC1 14 CYS A 93 ? CYS A 379 . ? 1_555 ? 10 AC1 14 GLY A 96 ? GLY A 382 . ? 1_555 ? 11 AC1 14 PHE A 147 ? PHE A 433 . ? 1_555 ? 12 AC1 14 ASP A 177 ? ASP A 463 . ? 1_555 ? 13 AC1 14 HOH E . ? HOH A 718 . ? 1_555 ? 14 AC1 14 HOH E . ? HOH A 732 . ? 1_555 ? 15 AC2 1 HIS A 208 ? HIS A 494 . ? 1_555 ? 16 AC3 2 ARG A 43 ? ARG A 329 . ? 1_555 ? 17 AC3 2 HIS A 85 ? HIS A 371 . ? 1_555 ? # _atom_sites.entry_id 5VD9 _atom_sites.fract_transf_matrix[1][1] 0.019853 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004270 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022427 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015836 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 287 ? ? ? A . n A 1 2 ALA 2 288 ? ? ? A . n A 1 3 GLY 3 289 ? ? ? A . n A 1 4 SER 4 290 ? ? ? A . n A 1 5 MET 5 291 ? ? ? A . n A 1 6 LYS 6 292 292 LYS LYS A . n A 1 7 SER 7 293 293 SER SER A . n A 1 8 ARG 8 294 294 ARG ARG A . n A 1 9 TYR 9 295 295 TYR TYR A . n A 1 10 THR 10 296 296 THR THR A . n A 1 11 THR 11 297 297 THR THR A . n A 1 12 GLU 12 298 298 GLU GLU A . n A 1 13 PHE 13 299 299 PHE PHE A . n A 1 14 HIS 14 300 300 HIS HIS A . n A 1 15 GLU 15 301 301 GLU GLU A . n A 1 16 LEU 16 302 302 LEU LEU A . n A 1 17 GLU 17 303 303 GLU GLU A . n A 1 18 LYS 18 304 304 LYS LYS A . n A 1 19 ILE 19 305 305 ILE ILE A . n A 1 20 GLY 20 306 306 GLY GLY A . n A 1 21 SER 21 307 307 SER SER A . n A 1 22 GLY 22 308 308 GLY GLY A . n A 1 23 GLU 23 309 309 GLU GLU A . n A 1 24 PHE 24 310 310 PHE PHE A . n A 1 25 GLY 25 311 311 GLY GLY A . n A 1 26 SER 26 312 312 SER SER A . n A 1 27 VAL 27 313 313 VAL VAL A . n A 1 28 PHE 28 314 314 PHE PHE A . n A 1 29 LYS 29 315 315 LYS LYS A . n A 1 30 CYS 30 316 316 CYS CYS A . n A 1 31 VAL 31 317 317 VAL VAL A . n A 1 32 LYS 32 318 318 LYS LYS A . n A 1 33 ARG 33 319 319 ARG ARG A . n A 1 34 LEU 34 320 320 LEU LEU A . n A 1 35 ASP 35 321 321 ASP ASP A . n A 1 36 GLY 36 322 322 GLY GLY A . n A 1 37 CYS 37 323 323 CYS CYS A . n A 1 38 ILE 38 324 324 ILE ILE A . n A 1 39 TYR 39 325 325 TYR TYR A . n A 1 40 ALA 40 326 326 ALA ALA A . n A 1 41 ILE 41 327 327 ILE ILE A . n A 1 42 LYS 42 328 328 LYS LYS A . n A 1 43 ARG 43 329 329 ARG ARG A . n A 1 44 SER 44 330 330 SER SER A . n A 1 45 LYS 45 331 331 LYS LYS A . n A 1 46 LYS 46 332 332 LYS LYS A . n A 1 47 PRO 47 333 333 PRO PRO A . n A 1 48 LEU 48 334 334 LEU LEU A . n A 1 49 ALA 49 335 335 ALA ALA A . n A 1 50 GLY 50 336 336 GLY GLY A . n A 1 51 SER 51 337 337 SER SER A . n A 1 52 VAL 52 338 338 VAL VAL A . n A 1 53 ASP 53 339 339 ASP ASP A . n A 1 54 GLU 54 340 340 GLU GLU A . n A 1 55 GLN 55 341 341 GLN GLN A . n A 1 56 ASN 56 342 342 ASN ASN A . n A 1 57 ALA 57 343 343 ALA ALA A . n A 1 58 LEU 58 344 344 LEU LEU A . n A 1 59 ARG 59 345 345 ARG ARG A . n A 1 60 GLU 60 346 346 GLU GLU A . n A 1 61 VAL 61 347 347 VAL VAL A . n A 1 62 TYR 62 348 348 TYR TYR A . n A 1 63 ALA 63 349 349 ALA ALA A . n A 1 64 HIS 64 350 350 HIS HIS A . n A 1 65 ALA 65 351 351 ALA ALA A . n A 1 66 VAL 66 352 352 VAL VAL A . n A 1 67 LEU 67 353 353 LEU LEU A . n A 1 68 GLY 68 354 354 GLY GLY A . n A 1 69 GLN 69 355 355 GLN GLN A . n A 1 70 HIS 70 356 356 HIS HIS A . n A 1 71 SER 71 357 357 SER SER A . n A 1 72 HIS 72 358 358 HIS HIS A . n A 1 73 VAL 73 359 359 VAL VAL A . n A 1 74 VAL 74 360 360 VAL VAL A . n A 1 75 ARG 75 361 361 ARG ARG A . n A 1 76 TYR 76 362 362 TYR TYR A . n A 1 77 PHE 77 363 363 PHE PHE A . n A 1 78 SER 78 364 364 SER SER A . n A 1 79 ALA 79 365 365 ALA ALA A . n A 1 80 TRP 80 366 366 TRP TRP A . n A 1 81 ALA 81 367 367 ALA ALA A . n A 1 82 GLU 82 368 368 GLU GLU A . n A 1 83 ASP 83 369 369 ASP ASP A . n A 1 84 ASP 84 370 370 ASP ASP A . n A 1 85 HIS 85 371 371 HIS HIS A . n A 1 86 MET 86 372 372 MET MET A . n A 1 87 LEU 87 373 373 LEU LEU A . n A 1 88 ILE 88 374 374 ILE ILE A . n A 1 89 GLN 89 375 375 GLN GLN A . n A 1 90 ASN 90 376 376 ASN ASN A . n A 1 91 GLU 91 377 377 GLU GLU A . n A 1 92 TYR 92 378 378 TYR TYR A . n A 1 93 CYS 93 379 379 CYS CYS A . n A 1 94 ASN 94 380 380 ASN ASN A . n A 1 95 GLY 95 381 381 GLY GLY A . n A 1 96 GLY 96 382 382 GLY GLY A . n A 1 97 SER 97 383 383 SER SER A . n A 1 98 LEU 98 384 384 LEU LEU A . n A 1 99 ALA 99 385 385 ALA ALA A . n A 1 100 ASP 100 386 386 ASP ASP A . n A 1 101 ALA 101 387 387 ALA ALA A . n A 1 102 ILE 102 388 388 ILE ILE A . n A 1 103 SER 103 389 389 SER SER A . n A 1 104 GLU 104 390 390 GLU GLU A . n A 1 105 ASN 105 391 391 ASN ASN A . n A 1 106 TYR 106 392 392 TYR TYR A . n A 1 107 ARG 107 393 393 ARG ARG A . n A 1 108 ILE 108 394 394 ILE ILE A . n A 1 109 MET 109 395 395 MET MET A . n A 1 110 SER 110 396 396 SER SER A . n A 1 111 TYR 111 397 397 TYR TYR A . n A 1 112 PHE 112 398 398 PHE PHE A . n A 1 113 LYS 113 399 399 LYS LYS A . n A 1 114 GLU 114 400 400 GLU GLU A . n A 1 115 ALA 115 401 401 ALA ALA A . n A 1 116 GLU 116 402 402 GLU GLU A . n A 1 117 LEU 117 403 403 LEU LEU A . n A 1 118 LYS 118 404 404 LYS LYS A . n A 1 119 ASP 119 405 405 ASP ASP A . n A 1 120 LEU 120 406 406 LEU LEU A . n A 1 121 LEU 121 407 407 LEU LEU A . n A 1 122 LEU 122 408 408 LEU LEU A . n A 1 123 GLN 123 409 409 GLN GLN A . n A 1 124 VAL 124 410 410 VAL VAL A . n A 1 125 GLY 125 411 411 GLY GLY A . n A 1 126 ARG 126 412 412 ARG ARG A . n A 1 127 GLY 127 413 413 GLY GLY A . n A 1 128 LEU 128 414 414 LEU LEU A . n A 1 129 ARG 129 415 415 ARG ARG A . n A 1 130 TYR 130 416 416 TYR TYR A . n A 1 131 ILE 131 417 417 ILE ILE A . n A 1 132 HIS 132 418 418 HIS HIS A . n A 1 133 SER 133 419 419 SER SER A . n A 1 134 MET 134 420 420 MET MET A . n A 1 135 SER 135 421 421 SER SER A . n A 1 136 LEU 136 422 422 LEU LEU A . n A 1 137 VAL 137 423 423 VAL VAL A . n A 1 138 HIS 138 424 424 HIS HIS A . n A 1 139 MET 139 425 425 MET MET A . n A 1 140 ASP 140 426 426 ASP ASP A . n A 1 141 ILE 141 427 427 ILE ILE A . n A 1 142 LYS 142 428 428 LYS LYS A . n A 1 143 PRO 143 429 429 PRO PRO A . n A 1 144 SER 144 430 430 SER SER A . n A 1 145 ASN 145 431 431 ASN ASN A . n A 1 146 ILE 146 432 432 ILE ILE A . n A 1 147 PHE 147 433 433 PHE PHE A . n A 1 148 ILE 148 434 434 ILE ILE A . n A 1 149 SER 149 435 435 SER SER A . n A 1 150 ARG 150 436 436 ARG ARG A . n A 1 151 THR 151 437 ? ? ? A . n A 1 152 SER 152 438 ? ? ? A . n A 1 153 ILE 153 439 ? ? ? A . n A 1 154 PRO 154 440 ? ? ? A . n A 1 155 ASN 155 441 ? ? ? A . n A 1 156 ALA 156 442 ? ? ? A . n A 1 157 ALA 157 443 ? ? ? A . n A 1 158 SER 158 444 ? ? ? A . n A 1 159 GLU 159 445 ? ? ? A . n A 1 160 GLU 160 446 ? ? ? A . n A 1 161 GLY 161 447 ? ? ? A . n A 1 162 ASP 162 448 ? ? ? A . n A 1 163 GLU 163 449 ? ? ? A . n A 1 164 ASP 164 450 ? ? ? A . n A 1 165 ASP 165 451 ? ? ? A . n A 1 166 TRP 166 452 ? ? ? A . n A 1 167 ALA 167 453 ? ? ? A . n A 1 168 SER 168 454 ? ? ? A . n A 1 169 ASN 169 455 ? ? ? A . n A 1 170 LYS 170 456 456 LYS LYS A . n A 1 171 VAL 171 457 457 VAL VAL A . n A 1 172 MET 172 458 458 MET MET A . n A 1 173 PHE 173 459 459 PHE PHE A . n A 1 174 LYS 174 460 460 LYS LYS A . n A 1 175 ILE 175 461 461 ILE ILE A . n A 1 176 GLY 176 462 462 GLY GLY A . n A 1 177 ASP 177 463 463 ASP ASP A . n A 1 178 LEU 178 464 464 LEU LEU A . n A 1 179 GLY 179 465 465 GLY GLY A . n A 1 180 HIS 180 466 466 HIS HIS A . n A 1 181 VAL 181 467 467 VAL VAL A . n A 1 182 THR 182 468 468 THR THR A . n A 1 183 ARG 183 469 469 ARG ARG A . n A 1 184 ILE 184 470 470 ILE ILE A . n A 1 185 SER 185 471 471 SER SER A . n A 1 186 SER 186 472 472 SER SER A . n A 1 187 PRO 187 473 473 PRO PRO A . n A 1 188 GLN 188 474 474 GLN GLN A . n A 1 189 VAL 189 475 475 VAL VAL A . n A 1 190 GLU 190 476 476 GLU GLU A . n A 1 191 GLU 191 477 477 GLU GLU A . n A 1 192 GLY 192 478 478 GLY GLY A . n A 1 193 ASP 193 479 479 ASP ASP A . n A 1 194 SER 194 480 480 SER SER A . n A 1 195 ARG 195 481 481 ARG ARG A . n A 1 196 PHE 196 482 482 PHE PHE A . n A 1 197 LEU 197 483 483 LEU LEU A . n A 1 198 ALA 198 484 484 ALA ALA A . n A 1 199 ASN 199 485 485 ASN ASN A . n A 1 200 GLU 200 486 486 GLU GLU A . n A 1 201 VAL 201 487 487 VAL VAL A . n A 1 202 LEU 202 488 488 LEU LEU A . n A 1 203 GLN 203 489 489 GLN GLN A . n A 1 204 GLU 204 490 490 GLU GLU A . n A 1 205 ASN 205 491 491 ASN ASN A . n A 1 206 TYR 206 492 492 TYR TYR A . n A 1 207 THR 207 493 493 THR THR A . n A 1 208 HIS 208 494 494 HIS HIS A . n A 1 209 LEU 209 495 495 LEU LEU A . n A 1 210 PRO 210 496 496 PRO PRO A . n A 1 211 LYS 211 497 497 LYS LYS A . n A 1 212 ALA 212 498 498 ALA ALA A . n A 1 213 ASP 213 499 499 ASP ASP A . n A 1 214 ILE 214 500 500 ILE ILE A . n A 1 215 PHE 215 501 501 PHE PHE A . n A 1 216 ALA 216 502 502 ALA ALA A . n A 1 217 LEU 217 503 503 LEU LEU A . n A 1 218 ALA 218 504 504 ALA ALA A . n A 1 219 LEU 219 505 505 LEU LEU A . n A 1 220 THR 220 506 506 THR THR A . n A 1 221 VAL 221 507 507 VAL VAL A . n A 1 222 VAL 222 508 508 VAL VAL A . n A 1 223 CYS 223 509 509 CYS CYS A . n A 1 224 ALA 224 510 510 ALA ALA A . n A 1 225 ALA 225 511 511 ALA ALA A . n A 1 226 GLY 226 512 512 GLY GLY A . n A 1 227 ALA 227 513 513 ALA ALA A . n A 1 228 GLU 228 514 514 GLU GLU A . n A 1 229 PRO 229 515 515 PRO PRO A . n A 1 230 LEU 230 516 516 LEU LEU A . n A 1 231 PRO 231 517 517 PRO PRO A . n A 1 232 ARG 232 518 518 ARG ARG A . n A 1 233 ASN 233 519 519 ASN ASN A . n A 1 234 GLY 234 520 520 GLY GLY A . n A 1 235 ASP 235 521 521 ASP ASP A . n A 1 236 GLN 236 522 522 GLN GLN A . n A 1 237 TRP 237 523 523 TRP TRP A . n A 1 238 HIS 238 524 524 HIS HIS A . n A 1 239 GLU 239 525 525 GLU GLU A . n A 1 240 ILE 240 526 526 ILE ILE A . n A 1 241 ARG 241 527 527 ARG ARG A . n A 1 242 GLN 242 528 528 GLN GLN A . n A 1 243 GLY 243 529 529 GLY GLY A . n A 1 244 ARG 244 530 530 ARG ARG A . n A 1 245 LEU 245 531 531 LEU LEU A . n A 1 246 PRO 246 532 532 PRO PRO A . n A 1 247 ARG 247 533 533 ARG ARG A . n A 1 248 ILE 248 534 534 ILE ILE A . n A 1 249 PRO 249 535 535 PRO PRO A . n A 1 250 GLN 250 536 536 GLN GLN A . n A 1 251 VAL 251 537 537 VAL VAL A . n A 1 252 LEU 252 538 538 LEU LEU A . n A 1 253 SER 253 539 539 SER SER A . n A 1 254 GLN 254 540 540 GLN GLN A . n A 1 255 GLU 255 541 541 GLU GLU A . n A 1 256 PHE 256 542 542 PHE PHE A . n A 1 257 THR 257 543 543 THR THR A . n A 1 258 GLU 258 544 544 GLU GLU A . n A 1 259 LEU 259 545 545 LEU LEU A . n A 1 260 LEU 260 546 546 LEU LEU A . n A 1 261 LYS 261 547 547 LYS LYS A . n A 1 262 VAL 262 548 548 VAL VAL A . n A 1 263 MET 263 549 549 MET MET A . n A 1 264 ILE 264 550 550 ILE ILE A . n A 1 265 HIS 265 551 551 HIS HIS A . n A 1 266 PRO 266 552 552 PRO PRO A . n A 1 267 ASP 267 553 553 ASP ASP A . n A 1 268 PRO 268 554 554 PRO PRO A . n A 1 269 GLU 269 555 555 GLU GLU A . n A 1 270 ARG 270 556 556 ARG ARG A . n A 1 271 ARG 271 557 557 ARG ARG A . n A 1 272 PRO 272 558 558 PRO PRO A . n A 1 273 SER 273 559 559 SER SER A . n A 1 274 ALA 274 560 560 ALA ALA A . n A 1 275 MET 275 561 561 MET MET A . n A 1 276 ALA 276 562 562 ALA ALA A . n A 1 277 LEU 277 563 563 LEU LEU A . n A 1 278 VAL 278 564 564 VAL VAL A . n A 1 279 LYS 279 565 565 LYS LYS A . n A 1 280 HIS 280 566 566 HIS HIS A . n A 1 281 SER 281 567 567 SER SER A . n A 1 282 VAL 282 568 568 VAL VAL A . n A 1 283 LEU 283 569 569 LEU LEU A . n A 1 284 LEU 284 570 570 LEU LEU A . n A 1 285 SER 285 571 571 SER SER A . n A 1 286 ALA 286 572 ? ? ? A . n A 1 287 SER 287 573 ? ? ? A . n A 1 288 ARG 288 574 ? ? ? A . n A 1 289 LYS 289 575 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 98G 1 601 1 98G LIG A . C 3 CL 1 602 1 CL CL A . D 4 EDO 1 603 1 EDO EDO A . E 5 HOH 1 701 48 HOH HOH A . E 5 HOH 2 702 42 HOH HOH A . E 5 HOH 3 703 58 HOH HOH A . E 5 HOH 4 704 25 HOH HOH A . E 5 HOH 5 705 23 HOH HOH A . E 5 HOH 6 706 41 HOH HOH A . E 5 HOH 7 707 44 HOH HOH A . E 5 HOH 8 708 39 HOH HOH A . E 5 HOH 9 709 26 HOH HOH A . E 5 HOH 10 710 8 HOH HOH A . E 5 HOH 11 711 7 HOH HOH A . E 5 HOH 12 712 17 HOH HOH A . E 5 HOH 13 713 45 HOH HOH A . E 5 HOH 14 714 5 HOH HOH A . E 5 HOH 15 715 18 HOH HOH A . E 5 HOH 16 716 2 HOH HOH A . E 5 HOH 17 717 55 HOH HOH A . E 5 HOH 18 718 3 HOH HOH A . E 5 HOH 19 719 61 HOH HOH A . E 5 HOH 20 720 43 HOH HOH A . E 5 HOH 21 721 9 HOH HOH A . E 5 HOH 22 722 51 HOH HOH A . E 5 HOH 23 723 60 HOH HOH A . E 5 HOH 24 724 11 HOH HOH A . E 5 HOH 25 725 52 HOH HOH A . E 5 HOH 26 726 20 HOH HOH A . E 5 HOH 27 727 19 HOH HOH A . E 5 HOH 28 728 54 HOH HOH A . E 5 HOH 29 729 22 HOH HOH A . E 5 HOH 30 730 4 HOH HOH A . E 5 HOH 31 731 28 HOH HOH A . E 5 HOH 32 732 57 HOH HOH A . E 5 HOH 33 733 10 HOH HOH A . E 5 HOH 34 734 1 HOH HOH A . E 5 HOH 35 735 21 HOH HOH A . E 5 HOH 36 736 50 HOH HOH A . E 5 HOH 37 737 14 HOH HOH A . E 5 HOH 38 738 35 HOH HOH A . E 5 HOH 39 739 13 HOH HOH A . E 5 HOH 40 740 12 HOH HOH A . E 5 HOH 41 741 53 HOH HOH A . E 5 HOH 42 742 37 HOH HOH A . E 5 HOH 43 743 15 HOH HOH A . E 5 HOH 44 744 16 HOH HOH A . E 5 HOH 45 745 49 HOH HOH A . E 5 HOH 46 746 27 HOH HOH A . E 5 HOH 47 747 46 HOH HOH A . E 5 HOH 48 748 38 HOH HOH A . E 5 HOH 49 749 34 HOH HOH A . E 5 HOH 50 750 6 HOH HOH A . E 5 HOH 51 751 24 HOH HOH A . E 5 HOH 52 752 31 HOH HOH A . E 5 HOH 53 753 47 HOH HOH A . E 5 HOH 54 754 40 HOH HOH A . E 5 HOH 55 755 29 HOH HOH A . E 5 HOH 56 756 36 HOH HOH A . E 5 HOH 57 757 62 HOH HOH A . E 5 HOH 58 758 56 HOH HOH A . E 5 HOH 59 759 32 HOH HOH A . E 5 HOH 60 760 33 HOH HOH A . E 5 HOH 61 761 59 HOH HOH A . E 5 HOH 62 762 30 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-04 2 'Structure model' 1 1 2019-12-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_audit_support # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -10.0716 -4.1363 8.2099 0.2977 0.2729 0.2758 -0.0197 -0.0099 0.0692 5.5189 3.8491 2.4967 -2.2794 -0.9923 1.6954 -0.1228 0.1443 -0.0920 0.2965 -0.4852 0.2908 -0.3305 0.4061 -0.1953 'X-RAY DIFFRACTION' 2 ? refined 1.3040 4.4873 17.6147 0.2080 0.1857 0.1413 0.0248 0.0350 0.0374 3.2856 3.0530 3.2604 -0.1025 1.5696 -0.8625 -0.1299 0.0917 -0.0684 -0.3188 0.0782 -0.0989 0.2482 -0.2022 -0.1519 'X-RAY DIFFRACTION' 3 ? refined 13.6004 -0.6745 13.4977 0.2507 0.3980 0.4134 0.0796 0.0592 0.1169 2.5939 2.2331 4.1800 2.1008 0.2831 -1.2597 0.3197 -0.3845 0.3917 0.9742 -0.2677 -0.6837 -0.4662 0.6818 0.6678 'X-RAY DIFFRACTION' 4 ? refined 17.9884 13.8503 18.7740 0.4115 0.3761 0.6734 -0.0591 -0.1737 0.0961 3.3898 3.1662 1.5097 -0.6074 0.5141 -0.5265 -0.3138 -0.2551 -0.6253 0.0319 1.0519 -1.3165 0.4576 -0.4119 0.4517 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 292 A 337 ;chain 'A' and (resid 292 through 337 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 338 A 461 ;chain 'A' and (resid 338 through 461 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 462 A 484 ;chain 'A' and (resid 462 through 484 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 485 A 571 ;chain 'A' and (resid 485 through 571 ) ; ? ? ? ? ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? SERGUI ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB2 A SER 293 ? ? OE1 A GLU 368 ? ? 1.43 2 1 H A LYS 399 ? ? O A HOH 703 ? ? 1.49 3 1 H A GLY 336 ? ? OE1 A GLU 340 ? ? 1.53 4 1 O A THR 296 ? ? HH12 A ARG 319 ? ? 1.60 5 1 O A PRO 473 ? ? O A HOH 701 ? ? 2.15 6 1 O A GLY 354 ? ? O A HOH 702 ? ? 2.17 7 1 OE1 A GLU 402 ? ? O A HOH 703 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 303 ? ? -175.24 133.70 2 1 ASP A 369 ? ? 61.67 -131.93 3 1 MET A 395 ? ? 38.66 71.71 4 1 SER A 396 ? ? -107.90 -158.33 5 1 ASP A 426 ? ? -146.93 45.96 6 1 ASP A 463 ? ? 62.10 74.03 7 1 ASN A 519 ? ? -177.01 -174.83 8 1 LEU A 570 ? ? -58.52 106.85 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 287 ? A GLY 1 2 1 Y 1 A ALA 288 ? A ALA 2 3 1 Y 1 A GLY 289 ? A GLY 3 4 1 Y 1 A SER 290 ? A SER 4 5 1 Y 1 A MET 291 ? A MET 5 6 1 Y 1 A THR 437 ? A THR 151 7 1 Y 1 A SER 438 ? A SER 152 8 1 Y 1 A ILE 439 ? A ILE 153 9 1 Y 1 A PRO 440 ? A PRO 154 10 1 Y 1 A ASN 441 ? A ASN 155 11 1 Y 1 A ALA 442 ? A ALA 156 12 1 Y 1 A ALA 443 ? A ALA 157 13 1 Y 1 A SER 444 ? A SER 158 14 1 Y 1 A GLU 445 ? A GLU 159 15 1 Y 1 A GLU 446 ? A GLU 160 16 1 Y 1 A GLY 447 ? A GLY 161 17 1 Y 1 A ASP 448 ? A ASP 162 18 1 Y 1 A GLU 449 ? A GLU 163 19 1 Y 1 A ASP 450 ? A ASP 164 20 1 Y 1 A ASP 451 ? A ASP 165 21 1 Y 1 A TRP 452 ? A TRP 166 22 1 Y 1 A ALA 453 ? A ALA 167 23 1 Y 1 A SER 454 ? A SER 168 24 1 Y 1 A ASN 455 ? A ASN 169 25 1 Y 1 A ALA 572 ? A ALA 286 26 1 Y 1 A SER 573 ? A SER 287 27 1 Y 1 A ARG 574 ? A ARG 288 28 1 Y 1 A LYS 575 ? A LYS 289 # _pdbx_audit_support.funding_organization 'National Institutes of Health/Eunice Kennedy Shriver National Institute of Child Health & Human Development (NIH/NICHD)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'UO1 HD076542' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;1-{6-[(1R)-1-hydroxyethyl]pyridin-2-yl}-6-{[4-(4-methylpiperazin-1-yl)phenyl]amino}-2-(prop-2-en-1-yl)-1,2-dihydro-3H-pyrazolo[3,4-d]pyrimidin-3-one ; 98G 3 'CHLORIDE ION' CL 4 1,2-ETHANEDIOL EDO 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #