data_5VSO # _entry.id 5VSO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5VSO pdb_00005vso 10.2210/pdb5vso/pdb WWPDB D_1000227528 ? ? BMRB 30293 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of Ydj1 J-domain, a cytosolic Hsp40 from Saccharomyces cerevisiae' _pdbx_database_related.db_id 30293 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5VSO _pdbx_database_status.recvd_initial_deposition_date 2017-05-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ciesielski, S.J.' 1 ? 'Tonelli, M.' 2 ? 'Lee, W.' 3 ? 'Cornilescu, G.' 4 ? 'Markley, J.L.' 5 ? 'Schilke, B.A.' 6 ? 'Ziegelhoffer, T.' 7 ? 'Craig, E.A.' 8 0000-0002-9381-4307 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'PLoS Genet.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7404 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first e1007084 _citation.page_last e1007084 _citation.title 'Broadening the functionality of a J-protein/Hsp70 molecular chaperone system.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pgen.1007084 _citation.pdbx_database_id_PubMed 29084221 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schilke, B.A.' 1 ? primary 'Ciesielski, S.J.' 2 ? primary 'Ziegelhoffer, T.' 3 ? primary 'Kamiya, E.' 4 ? primary 'Tonelli, M.' 5 ? primary 'Lee, W.' 6 ? primary 'Cornilescu, G.' 7 ? primary 'Hines, J.K.' 8 ? primary 'Markley, J.L.' 9 ? primary 'Craig, E.A.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Yeast dnaJ protein 1' _entity.formula_weight 8521.567 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 1-70' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ydj1, Mitochondrial protein import protein MAS5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GEFGSMVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFG _entity_poly.pdbx_seq_one_letter_code_can GEFGSMVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 PHE n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 VAL n 1 8 LYS n 1 9 GLU n 1 10 THR n 1 11 LYS n 1 12 PHE n 1 13 TYR n 1 14 ASP n 1 15 ILE n 1 16 LEU n 1 17 GLY n 1 18 VAL n 1 19 PRO n 1 20 VAL n 1 21 THR n 1 22 ALA n 1 23 THR n 1 24 ASP n 1 25 VAL n 1 26 GLU n 1 27 ILE n 1 28 LYS n 1 29 LYS n 1 30 ALA n 1 31 TYR n 1 32 ARG n 1 33 LYS n 1 34 CYS n 1 35 ALA n 1 36 LEU n 1 37 LYS n 1 38 TYR n 1 39 HIS n 1 40 PRO n 1 41 ASP n 1 42 LYS n 1 43 ASN n 1 44 PRO n 1 45 SER n 1 46 GLU n 1 47 GLU n 1 48 ALA n 1 49 ALA n 1 50 GLU n 1 51 LYS n 1 52 PHE n 1 53 LYS n 1 54 GLU n 1 55 ALA n 1 56 SER n 1 57 ALA n 1 58 ALA n 1 59 TYR n 1 60 GLU n 1 61 ILE n 1 62 LEU n 1 63 SER n 1 64 ASP n 1 65 PRO n 1 66 GLU n 1 67 LYS n 1 68 ARG n 1 69 ASP n 1 70 ILE n 1 71 TYR n 1 72 ASP n 1 73 GLN n 1 74 PHE n 1 75 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 75 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'YDJ1, MAS5, YNL064C, N2418, YNL2418C' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MAS5_YEAST _struct_ref.pdbx_db_accession P25491 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFG _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5VSO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P25491 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5VSO GLY A 1 ? UNP P25491 ? ? 'expression tag' 1 1 1 5VSO GLU A 2 ? UNP P25491 ? ? 'expression tag' 2 2 1 5VSO PHE A 3 ? UNP P25491 ? ? 'expression tag' 3 3 1 5VSO GLY A 4 ? UNP P25491 ? ? 'expression tag' 4 4 1 5VSO SER A 5 ? UNP P25491 ? ? 'expression tag' 5 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 3 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 3 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 3 isotropic 4 1 1 '3D HCCH-TOCSY' 3 isotropic 16 1 1 '3D CBCA(CO)NH' 2 isotropic 17 1 1 '3D HNCACB' 2 isotropic 18 1 1 '3D HNCO' 3 isotropic 5 1 1 '3D HBHA(CO)NH' 3 isotropic 10 1 1 '3D C(CO)NH' 3 isotropic 9 1 1 '3D H(CCO)NH' 3 isotropic 8 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 7 1 2 '3D 1H-13C NOESY aromatic' 1 isotropic 13 1 2 '2D 1H-15N HSQC' 3 isotropic 11 1 3 '2D 1H-15N HSQC' 3 isotropic 12 2 3 '2D 1H-15N HSQC' 3 isotropic 14 2 4 '2D 1H-15N HSQC' 4 anisotropic 15 2 4 '2D 1H-15N HSQC' 4 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 279 atm 1 7.5 '150 NaCl' '20 mM Tris, pH 7.5, 150 mM NaCl, 5 mM DTT with protease inhibitor tablets and 0.2% NaN3' ? mM conditions_1 ? pH ? ? K 2 283 atm 1 7.5 '150 NaCl' '20 mM Tris, pH 7.5, 150 mM NaCl, 5 mM DTT with protease inhibitor tablets and 0.2% NaN3' ? mM conditions_2 ? pH ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ? '93% H2O/7% D2O' '15N 13C' solution ? 2 ? '93% H2O/7% D2O' '15N 13C' solution ? 3 ? '93% H2O/7% D2O' 15N solution ? 4 ? '93% H2O/7% D2O' 15N 'gel solid' ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 900 ? 2 VXRS ? Varian 800 ? 3 VXRS ? Varian 600 ? 4 'AVANCE III' ? Bruker 600 ? # _pdbx_nmr_refine.entry_id 5VSO _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Final step with explicit water refinement' _pdbx_nmr_refine.software_ordinal 12 # _pdbx_nmr_ensemble.entry_id 5VSO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5VSO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 collection VNMR ? Varian 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'peak picking' NMRFAM-SPARKY 1.41 'Lee, Tonelli and Markley' 5 'peak picking' APES ? 'Shin, Lee and Lee' 6 'chemical shift assignment' NMRFAM-SPARKY 1.41 'Lee, Tonelli and Markley' 7 'chemical shift assignment' PINE ? 'Bahrami, Markley, Assadi, and Eghbalnia' 8 'chemical shift assignment' PINE-SPARKY ? 'Lee, Westler, Bahrami, Eghbalnia and Markley' 9 'structure calculation' PONDEROSA-C/S ? 'Lee, Stark and Markley' 10 'structure calculation' AUDANA ? 'Lee, Petit, Cornilescu, Stark and Markley' 11 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 12 refinement PONDEROSA-C/S ? 'Lee, Stark and Markley' 13 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VSO _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5VSO _struct.title 'NMR structure of Ydj1 J-domain, a cytosolic Hsp40 from Saccharomyces cerevisiae' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VSO _struct_keywords.text 'J-domain, J-protein, DnaJ, chaperone' _struct_keywords.pdbx_keywords CHAPERONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 10 ? GLY A 17 ? THR A 10 GLY A 17 1 ? 8 HELX_P HELX_P2 AA2 THR A 23 ? HIS A 39 ? THR A 23 HIS A 39 1 ? 17 HELX_P HELX_P3 AA3 SER A 45 ? SER A 63 ? SER A 45 SER A 63 1 ? 19 HELX_P HELX_P4 AA4 ASP A 64 ? GLY A 75 ? ASP A 64 GLY A 75 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5VSO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 GLY 75 75 75 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5280 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-01 2 'Structure model' 1 1 2017-11-15 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 3 'Structure model' '_pdbx_audit_support.funding_organization' 9 3 'Structure model' '_pdbx_nmr_software.name' 10 3 'Structure model' '_pdbx_nmr_spectrometer.model' 11 4 'Structure model' '_database_2.pdbx_DOI' 12 4 'Structure model' '_database_2.pdbx_database_accession' 13 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Ydj1 protein (1-70 residues)' 3.5 ? mg/mL '[U-15N] [U-13C]' 2 'Ydj1 protein (1-70 residues)' 4.0 ? mg/mL '[U-15N] [U-13C]' 3 'Ydj1 protein (1-70 residues)' 5.5 ? mg/mL '[U-15N]' 4 'Ydj1 protein (1-70 residues)' 5.5 ? mg/mL '[U-15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A GLU 9 ? ? HG1 A THR 10 ? ? 1.52 2 8 O A GLU 9 ? ? HG1 A THR 10 ? ? 1.53 3 12 O A GLU 9 ? ? HG1 A THR 10 ? ? 1.58 4 18 O A GLU 9 ? ? HG1 A THR 10 ? ? 1.59 5 19 O A GLU 9 ? ? HG1 A THR 10 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? 62.91 93.42 2 1 THR A 10 ? ? 76.89 -13.02 3 2 THR A 10 ? ? 71.98 -28.08 4 3 THR A 10 ? ? 70.40 44.60 5 4 GLU A 2 ? ? 65.25 82.43 6 4 LYS A 42 ? ? -133.50 -34.97 7 5 SER A 5 ? ? 67.68 85.08 8 5 THR A 10 ? ? 71.89 -37.09 9 6 LYS A 42 ? ? -138.15 -30.28 10 8 GLU A 9 ? ? -44.57 151.72 11 8 LYS A 42 ? ? -133.60 -34.62 12 9 GLU A 2 ? ? 57.28 73.07 13 12 VAL A 7 ? ? -103.71 45.05 14 12 GLU A 9 ? ? -36.11 136.31 15 12 THR A 10 ? ? 71.97 -36.37 16 13 VAL A 7 ? ? 57.75 70.61 17 14 GLU A 9 ? ? -31.04 141.65 18 14 THR A 10 ? ? 78.50 -37.03 19 14 LYS A 42 ? ? -133.54 -36.80 20 17 THR A 10 ? ? 56.40 4.31 21 19 VAL A 7 ? ? 63.13 94.48 22 19 THR A 10 ? ? 75.97 39.55 23 20 VAL A 7 ? ? 37.20 63.88 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM31107 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM27870 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #