data_5VSX # _entry.id 5VSX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5VSX pdb_00005vsx 10.2210/pdb5vsx/pdb WWPDB D_1000227956 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-05-31 2 'Structure model' 1 1 2018-07-11 3 'Structure model' 1 2 2018-08-29 4 'Structure model' 1 3 2023-10-04 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Refinement description' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' struct_conn 10 5 'Structure model' pdbx_entry_details 11 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation.title' 14 3 'Structure model' '_citation_author.identifier_ORCID' 15 4 'Structure model' '_database_2.pdbx_DOI' 16 4 'Structure model' '_database_2.pdbx_database_accession' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VSX _pdbx_database_status.recvd_initial_deposition_date 2017-05-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Trempe, J.-F.' 1 ? 'Pande, H.' 2 ? 'Shenker, S.' 3 ? 'Gehring, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 293 _citation.language ? _citation.page_first 12832 _citation.page_last 12842 _citation.title 'Structures of ubiquitin-like (Ubl) and Hsp90-like domains of sacsin provide insight into pathological mutations.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA118.003939 _citation.pdbx_database_id_PubMed 29945973 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Menade, M.' 1 ? primary 'Kozlov, G.' 2 ? primary 'Trempe, J.F.' 3 ? primary 'Pande, H.' 4 ? primary 'Shenker, S.' 5 ? primary 'Wickremasinghe, S.' 6 ? primary 'Li, X.' 7 ? primary 'Hojjat, H.' 8 ? primary 'Dicaire, M.J.' 9 ? primary 'Brais, B.' 10 ? primary 'McPherson, P.S.' 11 ? primary 'Wong, M.J.H.' 12 ? primary 'Young, J.C.' 13 ? primary 'Gehring, K.' 14 0000-0001-6500-1184 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Sacsin 9868.347 2 ? ? 'Ubl domain (UNP residues 2-85)' ? 2 water nat water 18.015 59 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DnaJ homolog subfamily C member 29,DNAJC29' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSETKENRWVPVTVLPGCVGCRTVAALASWTVRDVKERIFAETGFPVSEQRLWRGGRELSDWIKIGDLTSKNCHLFV NLQSKGLKG ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSETKENRWVPVTVLPGCVGCRTVAALASWTVRDVKERIFAETGFPVSEQRLWRGGRELSDWIKIGDLTSKNCHLFV NLQSKGLKG ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 GLU n 1 7 THR n 1 8 LYS n 1 9 GLU n 1 10 ASN n 1 11 ARG n 1 12 TRP n 1 13 VAL n 1 14 PRO n 1 15 VAL n 1 16 THR n 1 17 VAL n 1 18 LEU n 1 19 PRO n 1 20 GLY n 1 21 CYS n 1 22 VAL n 1 23 GLY n 1 24 CYS n 1 25 ARG n 1 26 THR n 1 27 VAL n 1 28 ALA n 1 29 ALA n 1 30 LEU n 1 31 ALA n 1 32 SER n 1 33 TRP n 1 34 THR n 1 35 VAL n 1 36 ARG n 1 37 ASP n 1 38 VAL n 1 39 LYS n 1 40 GLU n 1 41 ARG n 1 42 ILE n 1 43 PHE n 1 44 ALA n 1 45 GLU n 1 46 THR n 1 47 GLY n 1 48 PHE n 1 49 PRO n 1 50 VAL n 1 51 SER n 1 52 GLU n 1 53 GLN n 1 54 ARG n 1 55 LEU n 1 56 TRP n 1 57 ARG n 1 58 GLY n 1 59 GLY n 1 60 ARG n 1 61 GLU n 1 62 LEU n 1 63 SER n 1 64 ASP n 1 65 TRP n 1 66 ILE n 1 67 LYS n 1 68 ILE n 1 69 GLY n 1 70 ASP n 1 71 LEU n 1 72 THR n 1 73 SER n 1 74 LYS n 1 75 ASN n 1 76 CYS n 1 77 HIS n 1 78 LEU n 1 79 PHE n 1 80 VAL n 1 81 ASN n 1 82 LEU n 1 83 GLN n 1 84 SER n 1 85 LYS n 1 86 GLY n 1 87 LEU n 1 88 LYS n 1 89 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 89 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SACS, KIAA0730' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-6p1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 ? ? ? A . n A 1 2 PRO 2 -2 ? ? ? A . n A 1 3 LEU 3 -1 ? ? ? A . n A 1 4 GLY 4 0 ? ? ? A . n A 1 5 SER 5 1 ? ? ? A . n A 1 6 GLU 6 2 ? ? ? A . n A 1 7 THR 7 3 ? ? ? A . n A 1 8 LYS 8 4 ? ? ? A . n A 1 9 GLU 9 5 ? ? ? A . n A 1 10 ASN 10 6 6 ASN ASN A . n A 1 11 ARG 11 7 7 ARG ARG A . n A 1 12 TRP 12 8 8 TRP TRP A . n A 1 13 VAL 13 9 9 VAL VAL A . n A 1 14 PRO 14 10 10 PRO PRO A . n A 1 15 VAL 15 11 11 VAL VAL A . n A 1 16 THR 16 12 12 THR THR A . n A 1 17 VAL 17 13 13 VAL VAL A . n A 1 18 LEU 18 14 14 LEU LEU A . n A 1 19 PRO 19 15 15 PRO PRO A . n A 1 20 GLY 20 16 16 GLY GLY A . n A 1 21 CYS 21 17 17 CYS CYS A . n A 1 22 VAL 22 18 18 VAL VAL A . n A 1 23 GLY 23 19 19 GLY GLY A . n A 1 24 CYS 24 20 20 CYS CYS A . n A 1 25 ARG 25 21 21 ARG ARG A . n A 1 26 THR 26 22 22 THR THR A . n A 1 27 VAL 27 23 23 VAL VAL A . n A 1 28 ALA 28 24 24 ALA ALA A . n A 1 29 ALA 29 25 25 ALA ALA A . n A 1 30 LEU 30 26 26 LEU LEU A . n A 1 31 ALA 31 27 27 ALA ALA A . n A 1 32 SER 32 28 28 SER SER A . n A 1 33 TRP 33 29 29 TRP TRP A . n A 1 34 THR 34 30 30 THR THR A . n A 1 35 VAL 35 31 31 VAL VAL A . n A 1 36 ARG 36 32 32 ARG ARG A . n A 1 37 ASP 37 33 33 ASP ASP A . n A 1 38 VAL 38 34 34 VAL VAL A . n A 1 39 LYS 39 35 35 LYS LYS A . n A 1 40 GLU 40 36 36 GLU GLU A . n A 1 41 ARG 41 37 37 ARG ARG A . n A 1 42 ILE 42 38 38 ILE ILE A . n A 1 43 PHE 43 39 39 PHE PHE A . n A 1 44 ALA 44 40 40 ALA ALA A . n A 1 45 GLU 45 41 41 GLU GLU A . n A 1 46 THR 46 42 42 THR THR A . n A 1 47 GLY 47 43 43 GLY GLY A . n A 1 48 PHE 48 44 44 PHE PHE A . n A 1 49 PRO 49 45 45 PRO PRO A . n A 1 50 VAL 50 46 46 VAL VAL A . n A 1 51 SER 51 47 47 SER SER A . n A 1 52 GLU 52 48 48 GLU GLU A . n A 1 53 GLN 53 49 49 GLN GLN A . n A 1 54 ARG 54 50 50 ARG ARG A . n A 1 55 LEU 55 51 51 LEU LEU A . n A 1 56 TRP 56 52 52 TRP TRP A . n A 1 57 ARG 57 53 53 ARG ARG A . n A 1 58 GLY 58 54 54 GLY GLY A . n A 1 59 GLY 59 55 55 GLY GLY A . n A 1 60 ARG 60 56 56 ARG ARG A . n A 1 61 GLU 61 57 57 GLU GLU A . n A 1 62 LEU 62 58 58 LEU LEU A . n A 1 63 SER 63 59 59 SER SER A . n A 1 64 ASP 64 60 60 ASP ASP A . n A 1 65 TRP 65 61 61 TRP TRP A . n A 1 66 ILE 66 62 62 ILE ILE A . n A 1 67 LYS 67 63 63 LYS LYS A . n A 1 68 ILE 68 64 64 ILE ILE A . n A 1 69 GLY 69 65 65 GLY GLY A . n A 1 70 ASP 70 66 66 ASP ASP A . n A 1 71 LEU 71 67 67 LEU LEU A . n A 1 72 THR 72 68 68 THR THR A . n A 1 73 SER 73 69 ? ? ? A . n A 1 74 LYS 74 70 ? ? ? A . n A 1 75 ASN 75 71 71 ASN ASN A . n A 1 76 CYS 76 72 72 CYS CYS A . n A 1 77 HIS 77 73 73 HIS HIS A . n A 1 78 LEU 78 74 74 LEU LEU A . n A 1 79 PHE 79 75 75 PHE PHE A . n A 1 80 VAL 80 76 76 VAL VAL A . n A 1 81 ASN 81 77 77 ASN ASN A . n A 1 82 LEU 82 78 78 LEU LEU A . n A 1 83 GLN 83 79 79 GLN GLN A . n A 1 84 SER 84 80 80 SER SER A . n A 1 85 LYS 85 81 81 LYS LYS A . n A 1 86 GLY 86 82 ? ? ? A . n A 1 87 LEU 87 83 ? ? ? A . n A 1 88 LYS 88 84 ? ? ? A . n A 1 89 GLY 89 85 ? ? ? A . n B 1 1 GLY 1 -3 ? ? ? B . n B 1 2 PRO 2 -2 ? ? ? B . n B 1 3 LEU 3 -1 ? ? ? B . n B 1 4 GLY 4 0 ? ? ? B . n B 1 5 SER 5 1 ? ? ? B . n B 1 6 GLU 6 2 ? ? ? B . n B 1 7 THR 7 3 ? ? ? B . n B 1 8 LYS 8 4 ? ? ? B . n B 1 9 GLU 9 5 5 GLU GLU B . n B 1 10 ASN 10 6 6 ASN ASN B . n B 1 11 ARG 11 7 7 ARG ARG B . n B 1 12 TRP 12 8 8 TRP TRP B . n B 1 13 VAL 13 9 9 VAL VAL B . n B 1 14 PRO 14 10 10 PRO PRO B . n B 1 15 VAL 15 11 11 VAL VAL B . n B 1 16 THR 16 12 12 THR THR B . n B 1 17 VAL 17 13 13 VAL VAL B . n B 1 18 LEU 18 14 14 LEU LEU B . n B 1 19 PRO 19 15 15 PRO PRO B . n B 1 20 GLY 20 16 16 GLY GLY B . n B 1 21 CYS 21 17 17 CYS CYS B . n B 1 22 VAL 22 18 18 VAL VAL B . n B 1 23 GLY 23 19 19 GLY GLY B . n B 1 24 CYS 24 20 20 CYS CYS B . n B 1 25 ARG 25 21 21 ARG ARG B . n B 1 26 THR 26 22 22 THR THR B . n B 1 27 VAL 27 23 23 VAL VAL B . n B 1 28 ALA 28 24 24 ALA ALA B . n B 1 29 ALA 29 25 25 ALA ALA B . n B 1 30 LEU 30 26 26 LEU LEU B . n B 1 31 ALA 31 27 27 ALA ALA B . n B 1 32 SER 32 28 28 SER SER B . n B 1 33 TRP 33 29 29 TRP TRP B . n B 1 34 THR 34 30 30 THR THR B . n B 1 35 VAL 35 31 31 VAL VAL B . n B 1 36 ARG 36 32 32 ARG ARG B . n B 1 37 ASP 37 33 33 ASP ASP B . n B 1 38 VAL 38 34 34 VAL VAL B . n B 1 39 LYS 39 35 35 LYS LYS B . n B 1 40 GLU 40 36 36 GLU GLU B . n B 1 41 ARG 41 37 37 ARG ARG B . n B 1 42 ILE 42 38 38 ILE ILE B . n B 1 43 PHE 43 39 39 PHE PHE B . n B 1 44 ALA 44 40 40 ALA ALA B . n B 1 45 GLU 45 41 41 GLU GLU B . n B 1 46 THR 46 42 42 THR THR B . n B 1 47 GLY 47 43 43 GLY GLY B . n B 1 48 PHE 48 44 44 PHE PHE B . n B 1 49 PRO 49 45 45 PRO PRO B . n B 1 50 VAL 50 46 46 VAL VAL B . n B 1 51 SER 51 47 47 SER SER B . n B 1 52 GLU 52 48 48 GLU GLU B . n B 1 53 GLN 53 49 49 GLN GLN B . n B 1 54 ARG 54 50 50 ARG ARG B . n B 1 55 LEU 55 51 51 LEU LEU B . n B 1 56 TRP 56 52 52 TRP TRP B . n B 1 57 ARG 57 53 53 ARG ARG B . n B 1 58 GLY 58 54 54 GLY GLY B . n B 1 59 GLY 59 55 55 GLY GLY B . n B 1 60 ARG 60 56 56 ARG ARG B . n B 1 61 GLU 61 57 57 GLU GLU B . n B 1 62 LEU 62 58 58 LEU LEU B . n B 1 63 SER 63 59 59 SER SER B . n B 1 64 ASP 64 60 60 ASP ASP B . n B 1 65 TRP 65 61 61 TRP TRP B . n B 1 66 ILE 66 62 62 ILE ILE B . n B 1 67 LYS 67 63 63 LYS LYS B . n B 1 68 ILE 68 64 64 ILE ILE B . n B 1 69 GLY 69 65 65 GLY GLY B . n B 1 70 ASP 70 66 66 ASP ASP B . n B 1 71 LEU 71 67 67 LEU LEU B . n B 1 72 THR 72 68 68 THR THR B . n B 1 73 SER 73 69 69 SER SER B . n B 1 74 LYS 74 70 ? ? ? B . n B 1 75 ASN 75 71 ? ? ? B . n B 1 76 CYS 76 72 ? ? ? B . n B 1 77 HIS 77 73 73 HIS HIS B . n B 1 78 LEU 78 74 74 LEU LEU B . n B 1 79 PHE 79 75 75 PHE PHE B . n B 1 80 VAL 80 76 76 VAL VAL B . n B 1 81 ASN 81 77 77 ASN ASN B . n B 1 82 LEU 82 78 78 LEU LEU B . n B 1 83 GLN 83 79 79 GLN GLN B . n B 1 84 SER 84 80 80 SER SER B . n B 1 85 LYS 85 81 81 LYS LYS B . n B 1 86 GLY 86 82 ? ? ? B . n B 1 87 LEU 87 83 ? ? ? B . n B 1 88 LYS 88 84 ? ? ? B . n B 1 89 GLY 89 85 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 41 HOH HOH A . C 2 HOH 2 102 55 HOH HOH A . C 2 HOH 3 103 48 HOH HOH A . C 2 HOH 4 104 47 HOH HOH A . C 2 HOH 5 105 17 HOH HOH A . C 2 HOH 6 106 52 HOH HOH A . C 2 HOH 7 107 35 HOH HOH A . C 2 HOH 8 108 10 HOH HOH A . C 2 HOH 9 109 19 HOH HOH A . C 2 HOH 10 110 5 HOH HOH A . C 2 HOH 11 111 1 HOH HOH A . C 2 HOH 12 112 12 HOH HOH A . C 2 HOH 13 113 16 HOH HOH A . C 2 HOH 14 114 38 HOH HOH A . C 2 HOH 15 115 6 HOH HOH A . C 2 HOH 16 116 2 HOH HOH A . C 2 HOH 17 117 53 HOH HOH A . C 2 HOH 18 118 25 HOH HOH A . C 2 HOH 19 119 14 HOH HOH A . C 2 HOH 20 120 29 HOH HOH A . C 2 HOH 21 121 3 HOH HOH A . C 2 HOH 22 122 54 HOH HOH A . C 2 HOH 23 123 8 HOH HOH A . C 2 HOH 24 124 13 HOH HOH A . C 2 HOH 25 125 27 HOH HOH A . C 2 HOH 26 126 37 HOH HOH A . C 2 HOH 27 127 22 HOH HOH A . C 2 HOH 28 128 26 HOH HOH A . C 2 HOH 29 129 44 HOH HOH A . C 2 HOH 30 130 4 HOH HOH A . C 2 HOH 31 131 59 HOH HOH A . C 2 HOH 32 132 36 HOH HOH A . C 2 HOH 33 133 58 HOH HOH A . C 2 HOH 34 134 50 HOH HOH A . C 2 HOH 35 135 57 HOH HOH A . C 2 HOH 36 136 28 HOH HOH A . D 2 HOH 1 101 31 HOH HOH B . D 2 HOH 2 102 18 HOH HOH B . D 2 HOH 3 103 42 HOH HOH B . D 2 HOH 4 104 11 HOH HOH B . D 2 HOH 5 105 7 HOH HOH B . D 2 HOH 6 106 51 HOH HOH B . D 2 HOH 7 107 32 HOH HOH B . D 2 HOH 8 108 45 HOH HOH B . D 2 HOH 9 109 23 HOH HOH B . D 2 HOH 10 110 46 HOH HOH B . D 2 HOH 11 111 24 HOH HOH B . D 2 HOH 12 112 15 HOH HOH B . D 2 HOH 13 113 43 HOH HOH B . D 2 HOH 14 114 49 HOH HOH B . D 2 HOH 15 115 20 HOH HOH B . D 2 HOH 16 116 9 HOH HOH B . D 2 HOH 17 117 33 HOH HOH B . D 2 HOH 18 118 40 HOH HOH B . D 2 HOH 19 119 21 HOH HOH B . D 2 HOH 20 120 34 HOH HOH B . D 2 HOH 21 121 30 HOH HOH B . D 2 HOH 22 122 39 HOH HOH B . D 2 HOH 23 123 56 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B ARG 56 ? CG ? B ARG 60 CG 2 1 Y 1 B ARG 56 ? CD ? B ARG 60 CD 3 1 Y 1 B ARG 56 ? NE ? B ARG 60 NE 4 1 Y 1 B ARG 56 ? CZ ? B ARG 60 CZ 5 1 Y 1 B ARG 56 ? NH1 ? B ARG 60 NH1 6 1 Y 1 B ARG 56 ? NH2 ? B ARG 60 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5VSX _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.901 _cell.length_a_esd ? _cell.length_b 62.606 _cell.length_b_esd ? _cell.length_c 90.834 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VSX _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VSX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bicine pH 8.7, 0.2 M NaCl, 20% sucrose' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2009-07-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5VSX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8861 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.400 _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.989 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 92223 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.100 2.140 ? ? ? ? ? ? ? 82.100 ? ? ? ? 0.289 ? ? ? ? ? ? ? ? 8.100 ? 0.917 ? ? ? ? ? 1 1 ? ? 2.140 2.180 ? ? ? ? ? ? ? 97.300 ? ? ? ? 0.272 ? ? ? ? ? ? ? ? 9.100 ? 0.892 ? ? ? ? ? 2 1 ? ? 2.180 2.220 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.260 ? ? ? ? ? ? ? ? 10.400 ? 0.901 ? ? ? ? ? 3 1 ? ? 2.220 2.260 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.241 ? ? ? ? ? ? ? ? 10.300 ? 0.939 ? ? ? ? ? 4 1 ? ? 2.260 2.310 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.196 ? ? ? ? ? ? ? ? 10.800 ? 0.994 ? ? ? ? ? 5 1 ? ? 2.310 2.370 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.181 ? ? ? ? ? ? ? ? 10.500 ? 1.053 ? ? ? ? ? 6 1 ? ? 2.370 2.420 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.153 ? ? ? ? ? ? ? ? 10.600 ? 1.079 ? ? ? ? ? 7 1 ? ? 2.420 2.490 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 10.900 ? 1.084 ? ? ? ? ? 8 1 ? ? 2.490 2.560 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.129 ? ? ? ? ? ? ? ? 10.500 ? 1.068 ? ? ? ? ? 9 1 ? ? 2.560 2.650 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 10.800 ? 0.998 ? ? ? ? ? 10 1 ? ? 2.650 2.740 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 10.700 ? 1.081 ? ? ? ? ? 11 1 ? ? 2.740 2.850 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 10.700 ? 0.969 ? ? ? ? ? 12 1 ? ? 2.850 2.980 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 10.700 ? 0.980 ? ? ? ? ? 13 1 ? ? 2.980 3.140 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 10.700 ? 1.012 ? ? ? ? ? 14 1 ? ? 3.140 3.330 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 10.800 ? 1.031 ? ? ? ? ? 15 1 ? ? 3.330 3.590 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 10.800 ? 0.941 ? ? ? ? ? 16 1 ? ? 3.590 3.950 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 10.600 ? 0.968 ? ? ? ? ? 17 1 ? ? 3.950 4.520 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 10.500 ? 0.940 ? ? ? ? ? 18 1 ? ? 4.520 5.700 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 10.500 ? 0.880 ? ? ? ? ? 19 1 ? ? 5.700 50.000 ? ? ? ? ? ? ? 96.200 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 9.700 ? 1.009 ? ? ? ? ? 20 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 94.970 _refine.B_iso_mean 41.1680 _refine.B_iso_min 18.650 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5VSX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 25.9510 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8842 _refine.ls_number_reflns_R_free 421 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.8500 _refine.ls_percent_reflns_R_free 4.7600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1895 _refine.ls_R_factor_R_free 0.2473 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1866 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '5VSZ, SeMet-L78M mutant' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.9900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 25.9510 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 59 _refine_hist.number_atoms_total 1234 _refine_hist.pdbx_number_residues_total 148 _refine_hist.pdbx_B_iso_mean_solvent 45.22 _refine_hist.pdbx_number_atoms_protein 1175 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 1269 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.270 ? 1730 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 191 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 216 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.600 ? 456 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0997 2.4034 2840 . 129 2711 97.0000 . . . 0.2892 0.0000 0.2009 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.4034 3.0273 2944 . 146 2798 100.0000 . . . 0.3091 0.0000 0.2242 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.0273 25.9525 3058 . 146 2912 100.0000 . . . 0.2171 0.0000 0.1697 . . . . . . 3 . . . # _struct.entry_id 5VSX _struct.title 'Structure of the Ubl domain of Sacsin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VSX _struct_keywords.text 'ubiquitin-like, chaperone' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SACS_HUMAN _struct_ref.pdbx_db_accession Q9NZJ4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ETKENRWVPVTVLPGCVGCRTVAALASWTVRDVKERIFAETGFPVSEQRLWRGGRELSDWIKIGDLTSKNCHLFVNLQSK GLKG ; _struct_ref.pdbx_align_begin 2 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5VSX A 6 ? 89 ? Q9NZJ4 2 ? 85 ? 2 85 2 1 5VSX B 6 ? 89 ? Q9NZJ4 2 ? 85 ? 2 85 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5VSX GLY A 1 ? UNP Q9NZJ4 ? ? 'expression tag' -3 1 1 5VSX PRO A 2 ? UNP Q9NZJ4 ? ? 'expression tag' -2 2 1 5VSX LEU A 3 ? UNP Q9NZJ4 ? ? 'expression tag' -1 3 1 5VSX GLY A 4 ? UNP Q9NZJ4 ? ? 'expression tag' 0 4 1 5VSX SER A 5 ? UNP Q9NZJ4 ? ? 'expression tag' 1 5 2 5VSX GLY B 1 ? UNP Q9NZJ4 ? ? 'expression tag' -3 6 2 5VSX PRO B 2 ? UNP Q9NZJ4 ? ? 'expression tag' -2 7 2 5VSX LEU B 3 ? UNP Q9NZJ4 ? ? 'expression tag' -1 8 2 5VSX GLY B 4 ? UNP Q9NZJ4 ? ? 'expression tag' 0 9 2 5VSX SER B 5 ? UNP Q9NZJ4 ? ? 'expression tag' 1 10 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 2 1 B,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ;While the isolated Ubl domain forms swapped-exchange dimer as observed in the crystal structure, SAXS data of the Ubl-SR1 domain revealed an entirely monomeric structure. ; # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 34 ? GLY A 47 ? THR A 30 GLY A 43 1 ? 14 HELX_P HELX_P2 AA2 PRO A 49 ? GLN A 53 ? PRO A 45 GLN A 49 5 ? 5 HELX_P HELX_P3 AA3 LYS A 67 ? THR A 72 ? LYS A 63 THR A 68 5 ? 6 HELX_P HELX_P4 AA4 THR B 34 ? GLY B 47 ? THR B 30 GLY B 43 1 ? 14 HELX_P HELX_P5 AA5 PRO B 49 ? GLN B 53 ? PRO B 45 GLN B 49 5 ? 5 HELX_P HELX_P6 AA6 LYS B 67 ? THR B 72 ? LYS B 63 THR B 68 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 17 A CYS 20 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf2 disulf ? ? A CYS 76 SG ? ? ? 1_555 A CYS 76 SG ? ? A CYS 72 A CYS 72 3_655 ? ? ? ? ? ? ? 2.055 ? ? disulf3 disulf ? ? B CYS 21 SG ? ? ? 1_555 B CYS 24 SG ? ? B CYS 17 B CYS 20 1_555 ? ? ? ? ? ? ? 2.037 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 21 ? CYS A 24 ? CYS A 17 ? 1_555 CYS A 20 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 76 ? CYS A 76 ? CYS A 72 ? 1_555 CYS A 72 ? 3_655 SG SG . . . None 'Disulfide bridge' 3 CYS B 21 ? CYS B 24 ? CYS B 17 ? 1_555 CYS B 20 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 60 ? GLU A 61 ? ARG A 56 GLU A 57 AA1 2 ARG A 54 ? ARG A 57 ? ARG A 50 ARG A 53 AA1 3 ASN A 81 ? GLN A 83 ? ASN A 77 GLN A 79 AA2 1 ARG B 60 ? GLU B 61 ? ARG B 56 GLU B 57 AA2 2 ARG B 54 ? ARG B 57 ? ARG B 50 ARG B 53 AA2 3 ASN B 81 ? GLN B 83 ? ASN B 77 GLN B 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 60 ? O ARG A 56 N ARG A 57 ? N ARG A 53 AA1 2 3 N TRP A 56 ? N TRP A 52 O ASN A 81 ? O ASN A 77 AA2 1 2 O ARG B 60 ? O ARG B 56 N ARG B 57 ? N ARG B 53 AA2 2 3 N ARG B 54 ? N ARG B 50 O GLN B 83 ? O GLN B 79 # _pdbx_entry_details.entry_id 5VSX _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 125 ? ? O A HOH 128 ? ? 1.89 2 1 O A HOH 124 ? ? O A HOH 131 ? ? 2.03 3 1 O A HOH 106 ? ? O A HOH 135 ? ? 2.09 4 1 O A GLN 79 ? ? O A HOH 101 ? ? 2.10 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 80 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -65.34 _pdbx_validate_torsion.psi -177.21 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 29.1892 3.5622 31.7676 0.2266 0.2177 0.3027 0.0212 0.0157 -0.0570 6.0249 5.1511 4.4048 -0.5591 -0.1239 1.2672 0.2620 -0.2673 -0.0415 0.4752 -0.5141 0.1150 0.4304 0.6112 0.0173 'X-RAY DIFFRACTION' 2 ? refined 23.6067 7.6584 10.7383 0.2526 0.1688 0.2297 0.0008 0.0399 0.0386 3.3458 6.0014 4.8132 -0.6979 -0.2433 3.5086 0.0688 0.0627 -0.1130 0.2738 0.0955 0.0584 -0.2964 -0.5474 0.0008 'X-RAY DIFFRACTION' 3 ? refined 27.0193 14.3073 4.9527 0.2235 0.2473 0.1928 -0.0125 0.0259 0.0224 2.4649 7.4843 5.1116 -1.2746 1.0211 0.7590 -0.1070 -0.1245 0.1959 0.0191 0.0654 0.0478 -0.5419 0.1129 -0.2913 'X-RAY DIFFRACTION' 4 ? refined 35.3218 5.0804 11.4163 0.2558 0.3171 0.3771 0.0702 0.0100 0.0848 3.4773 6.0486 5.2965 1.3306 -0.6188 0.5483 0.0251 -0.3351 0.2408 -0.0609 -0.8862 -0.8931 0.0142 0.5401 0.9737 'X-RAY DIFFRACTION' 5 ? refined 27.6882 5.7729 17.5007 0.3682 0.2898 0.2916 0.0340 -0.0809 -0.0039 7.7206 8.4504 7.5998 1.2325 -1.9957 -1.0241 -0.0564 -0.0055 -0.0279 0.1301 -1.1208 -0.7554 0.8168 0.8598 0.3850 'X-RAY DIFFRACTION' 6 ? refined 0.4403 4.4101 -9.2120 0.2309 0.1685 0.2389 -0.0202 0.0473 -0.0110 5.5185 7.3358 1.8327 -3.5108 -2.5976 -0.2573 -0.6069 0.6808 -0.1002 -0.1545 -0.6570 0.5815 0.3623 -0.1828 -0.2971 'X-RAY DIFFRACTION' 7 ? refined 4.3250 -3.0288 11.9183 0.2885 0.3178 0.1684 -0.0162 -0.0030 -0.0283 5.3825 1.1684 3.8984 0.0092 -4.2432 -0.6390 0.1169 0.0225 -0.1298 -0.5515 0.1353 -0.0044 0.0573 -0.1690 0.5294 'X-RAY DIFFRACTION' 8 ? refined 10.2752 1.4552 17.6850 0.3003 0.2929 0.1272 0.0216 -0.0049 0.0084 9.3406 4.2373 5.6038 -1.6087 1.1813 0.3631 0.2876 0.0795 -0.3261 -1.0432 -0.1305 -0.0033 0.6129 0.3559 0.2433 'X-RAY DIFFRACTION' 9 ? refined -0.0169 7.7691 10.9174 0.3897 0.3127 0.4404 0.0795 0.1067 0.0195 7.1118 2.1135 4.2303 0.3994 -0.5866 -1.1117 -0.0394 0.3125 -0.1380 0.1398 1.8070 0.6796 0.4345 -0.7555 -0.7512 'X-RAY DIFFRACTION' 10 ? refined 2.7710 1.3555 4.8579 0.3124 0.4904 0.3068 0.0134 0.0312 0.1546 5.9944 4.1885 5.4508 -1.6683 0.3568 1.8976 -0.2011 0.3842 -0.2521 1.2247 0.0729 0.7459 -0.1484 -0.0261 -0.3341 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 6 A 16 ;chain 'A' and (resid 6 through 16 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 17 A 32 ;chain 'A' and (resid 17 through 32 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 33 A 49 ;chain 'A' and (resid 33 through 49 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 50 A 66 ;chain 'A' and (resid 50 through 66 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 67 A 79 ;chain 'A' and (resid 67 through 79 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 B 5 B 16 ;chain 'B' and (resid 5 through 16 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 B 17 B 32 ;chain 'B' and (resid 17 through 32 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 B 33 B 49 ;chain 'B' and (resid 33 through 49 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 B 50 B 66 ;chain 'B' and (resid 50 through 66 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 B 67 B 79 ;chain 'B' and (resid 67 through 79 ) ; ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -3 ? A GLY 1 2 1 Y 1 A PRO -2 ? A PRO 2 3 1 Y 1 A LEU -1 ? A LEU 3 4 1 Y 1 A GLY 0 ? A GLY 4 5 1 Y 1 A SER 1 ? A SER 5 6 1 Y 1 A GLU 2 ? A GLU 6 7 1 Y 1 A THR 3 ? A THR 7 8 1 Y 1 A LYS 4 ? A LYS 8 9 1 Y 1 A GLU 5 ? A GLU 9 10 1 Y 1 A SER 69 ? A SER 73 11 1 Y 1 A LYS 70 ? A LYS 74 12 1 Y 1 A GLY 82 ? A GLY 86 13 1 Y 1 A LEU 83 ? A LEU 87 14 1 Y 1 A LYS 84 ? A LYS 88 15 1 Y 1 A GLY 85 ? A GLY 89 16 1 Y 1 B GLY -3 ? B GLY 1 17 1 Y 1 B PRO -2 ? B PRO 2 18 1 Y 1 B LEU -1 ? B LEU 3 19 1 Y 1 B GLY 0 ? B GLY 4 20 1 Y 1 B SER 1 ? B SER 5 21 1 Y 1 B GLU 2 ? B GLU 6 22 1 Y 1 B THR 3 ? B THR 7 23 1 Y 1 B LYS 4 ? B LYS 8 24 1 Y 1 B LYS 70 ? B LYS 74 25 1 Y 1 B ASN 71 ? B ASN 75 26 1 Y 1 B CYS 72 ? B CYS 76 27 1 Y 1 B GLY 82 ? B GLY 86 28 1 Y 1 B LEU 83 ? B LEU 87 29 1 Y 1 B LYS 84 ? B LYS 88 30 1 Y 1 B GLY 85 ? B GLY 89 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TRP N N N N 301 TRP CA C N S 302 TRP C C N N 303 TRP O O N N 304 TRP CB C N N 305 TRP CG C Y N 306 TRP CD1 C Y N 307 TRP CD2 C Y N 308 TRP NE1 N Y N 309 TRP CE2 C Y N 310 TRP CE3 C Y N 311 TRP CZ2 C Y N 312 TRP CZ3 C Y N 313 TRP CH2 C Y N 314 TRP OXT O N N 315 TRP H H N N 316 TRP H2 H N N 317 TRP HA H N N 318 TRP HB2 H N N 319 TRP HB3 H N N 320 TRP HD1 H N N 321 TRP HE1 H N N 322 TRP HE3 H N N 323 TRP HZ2 H N N 324 TRP HZ3 H N N 325 TRP HH2 H N N 326 TRP HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 PHE N CA sing N N 218 PHE N H sing N N 219 PHE N H2 sing N N 220 PHE CA C sing N N 221 PHE CA CB sing N N 222 PHE CA HA sing N N 223 PHE C O doub N N 224 PHE C OXT sing N N 225 PHE CB CG sing N N 226 PHE CB HB2 sing N N 227 PHE CB HB3 sing N N 228 PHE CG CD1 doub Y N 229 PHE CG CD2 sing Y N 230 PHE CD1 CE1 sing Y N 231 PHE CD1 HD1 sing N N 232 PHE CD2 CE2 doub Y N 233 PHE CD2 HD2 sing N N 234 PHE CE1 CZ doub Y N 235 PHE CE1 HE1 sing N N 236 PHE CE2 CZ sing Y N 237 PHE CE2 HE2 sing N N 238 PHE CZ HZ sing N N 239 PHE OXT HXT sing N N 240 PRO N CA sing N N 241 PRO N CD sing N N 242 PRO N H sing N N 243 PRO CA C sing N N 244 PRO CA CB sing N N 245 PRO CA HA sing N N 246 PRO C O doub N N 247 PRO C OXT sing N N 248 PRO CB CG sing N N 249 PRO CB HB2 sing N N 250 PRO CB HB3 sing N N 251 PRO CG CD sing N N 252 PRO CG HG2 sing N N 253 PRO CG HG3 sing N N 254 PRO CD HD2 sing N N 255 PRO CD HD3 sing N N 256 PRO OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 THR N CA sing N N 271 THR N H sing N N 272 THR N H2 sing N N 273 THR CA C sing N N 274 THR CA CB sing N N 275 THR CA HA sing N N 276 THR C O doub N N 277 THR C OXT sing N N 278 THR CB OG1 sing N N 279 THR CB CG2 sing N N 280 THR CB HB sing N N 281 THR OG1 HG1 sing N N 282 THR CG2 HG21 sing N N 283 THR CG2 HG22 sing N N 284 THR CG2 HG23 sing N N 285 THR OXT HXT sing N N 286 TRP N CA sing N N 287 TRP N H sing N N 288 TRP N H2 sing N N 289 TRP CA C sing N N 290 TRP CA CB sing N N 291 TRP CA HA sing N N 292 TRP C O doub N N 293 TRP C OXT sing N N 294 TRP CB CG sing N N 295 TRP CB HB2 sing N N 296 TRP CB HB3 sing N N 297 TRP CG CD1 doub Y N 298 TRP CG CD2 sing Y N 299 TRP CD1 NE1 sing Y N 300 TRP CD1 HD1 sing N N 301 TRP CD2 CE2 doub Y N 302 TRP CD2 CE3 sing Y N 303 TRP NE1 CE2 sing Y N 304 TRP NE1 HE1 sing N N 305 TRP CE2 CZ2 sing Y N 306 TRP CE3 CZ3 doub Y N 307 TRP CE3 HE3 sing N N 308 TRP CZ2 CH2 doub Y N 309 TRP CZ2 HZ2 sing N N 310 TRP CZ3 CH2 sing Y N 311 TRP CZ3 HZ3 sing N N 312 TRP CH2 HH2 sing N N 313 TRP OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_audit_support.funding_organization 'ARSACS Foundation' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5VSZ _pdbx_initial_refinement_model.details '5VSZ, SeMet-L78M mutant' # _atom_sites.entry_id 5VSX _atom_sites.fract_transf_matrix[1][1] 0.019267 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015973 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011009 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ # loop_ #