data_5W0G # _entry.id 5W0G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5W0G pdb_00005w0g 10.2210/pdb5w0g/pdb WWPDB D_1000228194 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '2HZC is the same protein at a lower resolution' _pdbx_database_related.db_id 2HZC _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5W0G _pdbx_database_status.recvd_initial_deposition_date 2017-05-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Agrawal, A.A.' 1 ? 'Jenkins, J.L.' 2 ? 'Kielkopf, C.L.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 1520-4995 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 56 _citation.language ? _citation.page_first 4757 _citation.page_last 4761 _citation.title 'Cancer-Associated Mutations Mapped on High-Resolution Structures of the U2AF2 RNA Recognition Motifs.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.7b00551 _citation.pdbx_database_id_PubMed 28850223 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Glasser, E.' 1 ? primary 'Agrawal, A.A.' 2 ? primary 'Jenkins, J.L.' 3 ? primary 'Kielkopf, C.L.' 4 ? # _cell.entry_id 5W0G _cell.length_a 28.707 _cell.length_b 28.707 _cell.length_c 185.851 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5W0G _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Splicing factor U2AF 65 kDa subunit' 9629.989 1 ? ? 'RNA RECOGNITION motif 1 (RRM1), residues 148-229' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 4 non-polymer syn '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' 252.305 1 ? ? ? ? 5 water nat water 18.015 132 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'U2 auxiliary factor 65 kDa subunit,hU2AF65,U2 snRNP auxiliary factor large subunit' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQ SLKIRRP ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQ SLKIRRP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 ALA n 1 7 ARG n 1 8 ARG n 1 9 LEU n 1 10 TYR n 1 11 VAL n 1 12 GLY n 1 13 ASN n 1 14 ILE n 1 15 PRO n 1 16 PHE n 1 17 GLY n 1 18 ILE n 1 19 THR n 1 20 GLU n 1 21 GLU n 1 22 ALA n 1 23 MET n 1 24 MET n 1 25 ASP n 1 26 PHE n 1 27 PHE n 1 28 ASN n 1 29 ALA n 1 30 GLN n 1 31 MET n 1 32 ARG n 1 33 LEU n 1 34 GLY n 1 35 GLY n 1 36 LEU n 1 37 THR n 1 38 GLN n 1 39 ALA n 1 40 PRO n 1 41 GLY n 1 42 ASN n 1 43 PRO n 1 44 VAL n 1 45 LEU n 1 46 ALA n 1 47 VAL n 1 48 GLN n 1 49 ILE n 1 50 ASN n 1 51 GLN n 1 52 ASP n 1 53 LYS n 1 54 ASN n 1 55 PHE n 1 56 ALA n 1 57 PHE n 1 58 LEU n 1 59 GLU n 1 60 PHE n 1 61 ARG n 1 62 SER n 1 63 VAL n 1 64 ASP n 1 65 GLU n 1 66 THR n 1 67 THR n 1 68 GLN n 1 69 ALA n 1 70 MET n 1 71 ALA n 1 72 PHE n 1 73 ASP n 1 74 GLY n 1 75 ILE n 1 76 ILE n 1 77 PHE n 1 78 GLN n 1 79 GLY n 1 80 GLN n 1 81 SER n 1 82 LEU n 1 83 LYS n 1 84 ILE n 1 85 ARG n 1 86 ARG n 1 87 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 87 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'U2AF2, U2AF65' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-6P _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code U2AF2_HUMAN _struct_ref.pdbx_db_accession P26368 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIR RP ; _struct_ref.pdbx_align_begin 148 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5W0G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P26368 _struct_ref_seq.db_align_beg 148 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 229 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 148 _struct_ref_seq.pdbx_auth_seq_align_end 229 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5W0G GLY A 1 ? UNP P26368 ? ? 'expression tag' 143 1 1 5W0G PRO A 2 ? UNP P26368 ? ? 'expression tag' 144 2 1 5W0G LEU A 3 ? UNP P26368 ? ? 'expression tag' 145 3 1 5W0G GLY A 4 ? UNP P26368 ? ? 'expression tag' 146 4 1 5W0G SER A 5 ? UNP P26368 ? ? 'expression tag' 147 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1PG non-polymer . '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' ? 'C11 H24 O6' 252.305 ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5W0G _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.13 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '21% (w/v) PEG MME 550, 210 mM zinc acetate, 100 mM MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-05-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9779 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CHESS BEAMLINE F1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9779 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline F1 _diffrn_source.pdbx_synchrotron_site CHESS # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 5W0G _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 16.980 _reflns.d_resolution_high 1.070 _reflns.number_obs 33973 _reflns.number_all ? _reflns.percent_possible_obs 94.9 _reflns.pdbx_Rmerge_I_obs 0.06300 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 16.3000 _reflns.B_iso_Wilson_estimate 12.39 _reflns.pdbx_redundancy 4.500 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.07 _reflns_shell.d_res_low 1.09 _reflns_shell.percent_possible_all 67.5 _reflns_shell.Rmerge_I_obs 0.25000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.900 _reflns_shell.pdbx_redundancy 2.30 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5W0G _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 33138 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 16.98 _refine.ls_d_res_high 1.07 _refine.ls_percent_reflns_obs 92.6 _refine.ls_R_factor_obs 0.136 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.135 _refine.ls_R_factor_R_free 0.153 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.660 _refine.ls_number_reflns_R_free 1876 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 22.03 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 2HZC _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.070 _refine.pdbx_overall_phase_error 13.070 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 652 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 132 _refine_hist.number_atoms_total 807 _refine_hist.d_res_high 1.07 _refine_hist.d_res_low 16.98 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.023 ? ? 742 'X-RAY DIFFRACTION' ? f_angle_d 1.393 ? ? 985 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 16.871 ? ? 283 'X-RAY DIFFRACTION' ? f_chiral_restr 0.086 ? ? 103 'X-RAY DIFFRACTION' ? f_plane_restr 0.008 ? ? 133 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.0710 1.1000 1611 0.1904 64.00 0.2186 . . 92 . . 'X-RAY DIFFRACTION' . 1.1000 1.1323 2179 0.1516 87.00 0.1833 . . 131 . . 'X-RAY DIFFRACTION' . 1.1323 1.1689 2379 0.1262 94.00 0.1697 . . 138 . . 'X-RAY DIFFRACTION' . 1.1689 1.2106 2457 0.1237 96.00 0.1672 . . 148 . . 'X-RAY DIFFRACTION' . 1.2106 1.2591 2476 0.1240 97.00 0.1610 . . 153 . . 'X-RAY DIFFRACTION' . 1.2591 1.3164 2502 0.1105 98.00 0.1414 . . 153 . . 'X-RAY DIFFRACTION' . 1.3164 1.3857 2519 0.1108 99.00 0.1573 . . 152 . . 'X-RAY DIFFRACTION' . 1.3857 1.4725 2535 0.1074 99.00 0.1221 . . 153 . . 'X-RAY DIFFRACTION' . 1.4725 1.5861 2588 0.1060 99.00 0.1255 . . 152 . . 'X-RAY DIFFRACTION' . 1.5861 1.7456 2578 0.1098 99.00 0.1233 . . 148 . . 'X-RAY DIFFRACTION' . 1.7456 1.9979 2566 0.1161 98.00 0.1354 . . 172 . . 'X-RAY DIFFRACTION' . 1.9979 2.5158 2575 0.1268 95.00 0.1471 . . 147 . . 'X-RAY DIFFRACTION' . 2.5158 16.9802 2297 0.1771 79.00 0.1811 . . 137 . . # _struct.entry_id 5W0G _struct.title 'Structure of U2AF65 (U2AF2) RRM1 at 1.07 resolution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5W0G _struct_keywords.text 'RNA SPLICING FACTOR, RNA RECOGNITION MOTIF, RRM, POLYPYRIMIDINE TRACT, RNA BINDING PROTEIN, RNA BINDING PROTEIN-RNA complex' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN/RNA' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 4 ? ALA A 6 ? GLY A 146 ALA A 148 5 ? 3 HELX_P HELX_P2 AA2 THR A 19 ? GLY A 34 ? THR A 161 GLY A 176 1 ? 16 HELX_P HELX_P3 AA3 SER A 62 ? MET A 70 ? SER A 204 MET A 212 1 ? 9 HELX_P HELX_P4 AA4 ALA A 71 ? ASP A 73 ? ALA A 213 ASP A 215 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 20 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 162 A ZN 301 1_555 ? ? ? ? ? ? ? 2.039 ? ? metalc2 metalc ? ? A GLU 20 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 162 A ZN 301 7_557 ? ? ? ? ? ? ? 1.989 ? ? metalc3 metalc ? ? A GLU 21 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 163 A ZN 302 1_555 ? ? ? ? ? ? ? 1.921 ? ? metalc4 metalc ? ? A ASP 25 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 167 A ZN 302 1_555 ? ? ? ? ? ? ? 1.918 ? ? metalc5 metalc ? ? A PRO 87 O ? ? ? 1_555 C ZN . ZN ? ? A PRO 229 A ZN 302 1_655 ? ? ? ? ? ? ? 1.900 ? ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 301 A HOH 401 1_555 ? ? ? ? ? ? ? 1.928 ? ? metalc7 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 301 A HOH 407 1_555 ? ? ? ? ? ? ? 2.360 ? ? metalc8 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 301 A HOH 407 7_557 ? ? ? ? ? ? ? 2.035 ? ? metalc9 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 301 A HOH 493 1_555 ? ? ? ? ? ? ? 2.009 ? ? metalc10 metalc ? ? C ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 302 A HOH 405 1_555 ? ? ? ? ? ? ? 1.837 ? ? metalc11 metalc ? ? C ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 302 A HOH 476 1_555 ? ? ? ? ? ? ? 1.976 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 44 ? ILE A 49 ? VAL A 186 ILE A 191 AA1 2 PHE A 55 ? PHE A 60 ? PHE A 197 PHE A 202 AA1 3 ARG A 8 ? GLY A 12 ? ARG A 150 GLY A 154 AA1 4 LYS A 83 ? ARG A 85 ? LYS A 225 ARG A 227 AA2 1 ILE A 76 ? PHE A 77 ? ILE A 218 PHE A 219 AA2 2 GLN A 80 ? SER A 81 ? GLN A 222 SER A 223 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 46 ? N ALA A 188 O GLU A 59 ? O GLU A 201 AA1 2 3 O ALA A 56 ? O ALA A 198 N VAL A 11 ? N VAL A 153 AA1 3 4 N GLY A 12 ? N GLY A 154 O LYS A 83 ? O LYS A 225 AA2 1 2 N PHE A 77 ? N PHE A 219 O GLN A 80 ? O GLN A 222 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 301 ? 8 'binding site for residue ZN A 301' AC2 Software A ZN 302 ? 6 'binding site for residue ZN A 302' AC3 Software A ACT 303 ? 6 'binding site for residue ACT A 303' AC4 Software A 1PG 304 ? 10 'binding site for residue 1PG A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 GLU A 20 ? GLU A 162 . ? 1_555 ? 2 AC1 8 GLU A 20 ? GLU A 162 . ? 7_557 ? 3 AC1 8 GLN A 48 ? GLN A 190 . ? 7_557 ? 4 AC1 8 HOH F . ? HOH A 401 . ? 7_557 ? 5 AC1 8 HOH F . ? HOH A 401 . ? 1_555 ? 6 AC1 8 HOH F . ? HOH A 407 . ? 7_557 ? 7 AC1 8 HOH F . ? HOH A 407 . ? 1_555 ? 8 AC1 8 HOH F . ? HOH A 493 . ? 1_555 ? 9 AC2 6 GLU A 21 ? GLU A 163 . ? 1_555 ? 10 AC2 6 ASP A 25 ? ASP A 167 . ? 1_555 ? 11 AC2 6 PRO A 87 ? PRO A 229 . ? 1_455 ? 12 AC2 6 HOH F . ? HOH A 405 . ? 1_555 ? 13 AC2 6 HOH F . ? HOH A 476 . ? 1_555 ? 14 AC2 6 HOH F . ? HOH A 485 . ? 1_555 ? 15 AC3 6 THR A 19 ? THR A 161 . ? 7_557 ? 16 AC3 6 THR A 19 ? THR A 161 . ? 1_555 ? 17 AC3 6 GLU A 20 ? GLU A 162 . ? 7_557 ? 18 AC3 6 GLU A 20 ? GLU A 162 . ? 1_555 ? 19 AC3 6 GLU A 21 ? GLU A 163 . ? 1_555 ? 20 AC3 6 HOH F . ? HOH A 480 . ? 1_555 ? 21 AC4 10 LEU A 33 ? LEU A 175 . ? 6_547 ? 22 AC4 10 GLN A 38 ? GLN A 180 . ? 1_545 ? 23 AC4 10 ARG A 61 ? ARG A 203 . ? 1_545 ? 24 AC4 10 SER A 62 ? SER A 204 . ? 1_545 ? 25 AC4 10 ASP A 64 ? ASP A 206 . ? 1_545 ? 26 AC4 10 ASP A 73 ? ASP A 215 . ? 1_555 ? 27 AC4 10 GLY A 74 ? GLY A 216 . ? 1_555 ? 28 AC4 10 ILE A 75 ? ILE A 217 . ? 1_555 ? 29 AC4 10 HOH F . ? HOH A 412 . ? 1_555 ? 30 AC4 10 HOH F . ? HOH A 413 . ? 1_545 ? # _atom_sites.entry_id 5W0G _atom_sites.fract_transf_matrix[1][1] 0.034835 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.034835 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005381 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 143 ? ? ? A . n A 1 2 PRO 2 144 ? ? ? A . n A 1 3 LEU 3 145 145 LEU LEU A . n A 1 4 GLY 4 146 146 GLY GLY A . n A 1 5 SER 5 147 147 SER SER A . n A 1 6 ALA 6 148 148 ALA ALA A . n A 1 7 ARG 7 149 149 ARG ARG A . n A 1 8 ARG 8 150 150 ARG ARG A . n A 1 9 LEU 9 151 151 LEU LEU A . n A 1 10 TYR 10 152 152 TYR TYR A . n A 1 11 VAL 11 153 153 VAL VAL A . n A 1 12 GLY 12 154 154 GLY GLY A . n A 1 13 ASN 13 155 155 ASN ASN A . n A 1 14 ILE 14 156 156 ILE ILE A . n A 1 15 PRO 15 157 157 PRO PRO A . n A 1 16 PHE 16 158 158 PHE PHE A . n A 1 17 GLY 17 159 159 GLY GLY A . n A 1 18 ILE 18 160 160 ILE ILE A . n A 1 19 THR 19 161 161 THR THR A . n A 1 20 GLU 20 162 162 GLU GLU A . n A 1 21 GLU 21 163 163 GLU GLU A . n A 1 22 ALA 22 164 164 ALA ALA A . n A 1 23 MET 23 165 165 MET MET A . n A 1 24 MET 24 166 166 MET MET A . n A 1 25 ASP 25 167 167 ASP ASP A . n A 1 26 PHE 26 168 168 PHE PHE A . n A 1 27 PHE 27 169 169 PHE PHE A . n A 1 28 ASN 28 170 170 ASN ASN A . n A 1 29 ALA 29 171 171 ALA ALA A . n A 1 30 GLN 30 172 172 GLN GLN A . n A 1 31 MET 31 173 173 MET MET A . n A 1 32 ARG 32 174 174 ARG ARG A . n A 1 33 LEU 33 175 175 LEU LEU A . n A 1 34 GLY 34 176 176 GLY GLY A . n A 1 35 GLY 35 177 177 GLY GLY A . n A 1 36 LEU 36 178 178 LEU LEU A . n A 1 37 THR 37 179 179 THR THR A . n A 1 38 GLN 38 180 180 GLN GLN A . n A 1 39 ALA 39 181 181 ALA ALA A . n A 1 40 PRO 40 182 182 PRO PRO A . n A 1 41 GLY 41 183 183 GLY GLY A . n A 1 42 ASN 42 184 184 ASN ASN A . n A 1 43 PRO 43 185 185 PRO PRO A . n A 1 44 VAL 44 186 186 VAL VAL A . n A 1 45 LEU 45 187 187 LEU LEU A . n A 1 46 ALA 46 188 188 ALA ALA A . n A 1 47 VAL 47 189 189 VAL VAL A . n A 1 48 GLN 48 190 190 GLN GLN A . n A 1 49 ILE 49 191 191 ILE ILE A . n A 1 50 ASN 50 192 192 ASN ASN A . n A 1 51 GLN 51 193 193 GLN GLN A . n A 1 52 ASP 52 194 ? ? ? A . n A 1 53 LYS 53 195 195 LYS LYS A . n A 1 54 ASN 54 196 196 ASN ASN A . n A 1 55 PHE 55 197 197 PHE PHE A . n A 1 56 ALA 56 198 198 ALA ALA A . n A 1 57 PHE 57 199 199 PHE PHE A . n A 1 58 LEU 58 200 200 LEU LEU A . n A 1 59 GLU 59 201 201 GLU GLU A . n A 1 60 PHE 60 202 202 PHE PHE A . n A 1 61 ARG 61 203 203 ARG ARG A . n A 1 62 SER 62 204 204 SER SER A . n A 1 63 VAL 63 205 205 VAL VAL A . n A 1 64 ASP 64 206 206 ASP ASP A . n A 1 65 GLU 65 207 207 GLU GLU A . n A 1 66 THR 66 208 208 THR THR A . n A 1 67 THR 67 209 209 THR THR A . n A 1 68 GLN 68 210 210 GLN GLN A . n A 1 69 ALA 69 211 211 ALA ALA A . n A 1 70 MET 70 212 212 MET MET A . n A 1 71 ALA 71 213 213 ALA ALA A . n A 1 72 PHE 72 214 214 PHE PHE A . n A 1 73 ASP 73 215 215 ASP ASP A . n A 1 74 GLY 74 216 216 GLY GLY A . n A 1 75 ILE 75 217 217 ILE ILE A . n A 1 76 ILE 76 218 218 ILE ILE A . n A 1 77 PHE 77 219 219 PHE PHE A . n A 1 78 GLN 78 220 220 GLN GLN A . n A 1 79 GLY 79 221 221 GLY GLY A . n A 1 80 GLN 80 222 222 GLN GLN A . n A 1 81 SER 81 223 223 SER SER A . n A 1 82 LEU 82 224 224 LEU LEU A . n A 1 83 LYS 83 225 225 LYS LYS A . n A 1 84 ILE 84 226 226 ILE ILE A . n A 1 85 ARG 85 227 227 ARG ARG A . n A 1 86 ARG 86 228 228 ARG ARG A . n A 1 87 PRO 87 229 229 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 301 ZN ZN A . C 2 ZN 1 302 302 ZN ZN A . D 3 ACT 1 303 303 ACT ACT A . E 4 1PG 1 304 304 1PG 1PG A . F 5 HOH 1 401 401 HOH HOH A . F 5 HOH 2 402 402 HOH HOH A . F 5 HOH 3 403 403 HOH HOH A . F 5 HOH 4 404 404 HOH HOH A . F 5 HOH 5 405 405 HOH HOH A . F 5 HOH 6 406 406 HOH HOH A . F 5 HOH 7 407 407 HOH HOH A . F 5 HOH 8 408 408 HOH HOH A . F 5 HOH 9 409 409 HOH HOH A . F 5 HOH 10 410 410 HOH HOH A . F 5 HOH 11 411 411 HOH HOH A . F 5 HOH 12 412 412 HOH HOH A . F 5 HOH 13 413 413 HOH HOH A . F 5 HOH 14 414 414 HOH HOH A . F 5 HOH 15 415 415 HOH HOH A . F 5 HOH 16 416 416 HOH HOH A . F 5 HOH 17 417 417 HOH HOH A . F 5 HOH 18 418 418 HOH HOH A . F 5 HOH 19 419 419 HOH HOH A . F 5 HOH 20 420 420 HOH HOH A . F 5 HOH 21 421 421 HOH HOH A . F 5 HOH 22 422 422 HOH HOH A . F 5 HOH 23 423 423 HOH HOH A . F 5 HOH 24 424 424 HOH HOH A . F 5 HOH 25 425 425 HOH HOH A . F 5 HOH 26 426 426 HOH HOH A . F 5 HOH 27 427 427 HOH HOH A . F 5 HOH 28 428 428 HOH HOH A . F 5 HOH 29 429 429 HOH HOH A . F 5 HOH 30 430 430 HOH HOH A . F 5 HOH 31 431 431 HOH HOH A . F 5 HOH 32 432 432 HOH HOH A . F 5 HOH 33 433 433 HOH HOH A . F 5 HOH 34 434 434 HOH HOH A . F 5 HOH 35 435 435 HOH HOH A . F 5 HOH 36 436 436 HOH HOH A . F 5 HOH 37 437 437 HOH HOH A . F 5 HOH 38 438 438 HOH HOH A . F 5 HOH 39 439 439 HOH HOH A . F 5 HOH 40 440 440 HOH HOH A . F 5 HOH 41 441 441 HOH HOH A . F 5 HOH 42 442 442 HOH HOH A . F 5 HOH 43 443 443 HOH HOH A . F 5 HOH 44 444 444 HOH HOH A . F 5 HOH 45 445 445 HOH HOH A . F 5 HOH 46 446 446 HOH HOH A . F 5 HOH 47 447 447 HOH HOH A . F 5 HOH 48 448 448 HOH HOH A . F 5 HOH 49 449 449 HOH HOH A . F 5 HOH 50 450 450 HOH HOH A . F 5 HOH 51 451 451 HOH HOH A . F 5 HOH 52 452 452 HOH HOH A . F 5 HOH 53 453 453 HOH HOH A . F 5 HOH 54 454 454 HOH HOH A . F 5 HOH 55 455 455 HOH HOH A . F 5 HOH 56 456 456 HOH HOH A . F 5 HOH 57 457 457 HOH HOH A . F 5 HOH 58 458 528 HOH HOH A . F 5 HOH 59 459 458 HOH HOH A . F 5 HOH 60 460 459 HOH HOH A . F 5 HOH 61 461 460 HOH HOH A . F 5 HOH 62 462 461 HOH HOH A . F 5 HOH 63 463 462 HOH HOH A . F 5 HOH 64 464 463 HOH HOH A . F 5 HOH 65 465 465 HOH HOH A . F 5 HOH 66 466 466 HOH HOH A . F 5 HOH 67 467 467 HOH HOH A . F 5 HOH 68 468 468 HOH HOH A . F 5 HOH 69 469 469 HOH HOH A . F 5 HOH 70 470 470 HOH HOH A . F 5 HOH 71 471 471 HOH HOH A . F 5 HOH 72 472 472 HOH HOH A . F 5 HOH 73 473 473 HOH HOH A . F 5 HOH 74 474 474 HOH HOH A . F 5 HOH 75 475 475 HOH HOH A . F 5 HOH 76 476 476 HOH HOH A . F 5 HOH 77 477 477 HOH HOH A . F 5 HOH 78 478 478 HOH HOH A . F 5 HOH 79 479 479 HOH HOH A . F 5 HOH 80 480 480 HOH HOH A . F 5 HOH 81 481 481 HOH HOH A . F 5 HOH 82 482 532 HOH HOH A . F 5 HOH 83 483 482 HOH HOH A . F 5 HOH 84 484 483 HOH HOH A . F 5 HOH 85 485 484 HOH HOH A . F 5 HOH 86 486 508 HOH HOH A . F 5 HOH 87 487 485 HOH HOH A . F 5 HOH 88 488 486 HOH HOH A . F 5 HOH 89 489 487 HOH HOH A . F 5 HOH 90 490 488 HOH HOH A . F 5 HOH 91 491 489 HOH HOH A . F 5 HOH 92 492 490 HOH HOH A . F 5 HOH 93 493 491 HOH HOH A . F 5 HOH 94 494 492 HOH HOH A . F 5 HOH 95 495 493 HOH HOH A . F 5 HOH 96 496 494 HOH HOH A . F 5 HOH 97 497 495 HOH HOH A . F 5 HOH 98 498 496 HOH HOH A . F 5 HOH 99 499 497 HOH HOH A . F 5 HOH 100 500 498 HOH HOH A . F 5 HOH 101 501 499 HOH HOH A . F 5 HOH 102 502 500 HOH HOH A . F 5 HOH 103 503 501 HOH HOH A . F 5 HOH 104 504 502 HOH HOH A . F 5 HOH 105 505 503 HOH HOH A . F 5 HOH 106 506 504 HOH HOH A . F 5 HOH 107 507 505 HOH HOH A . F 5 HOH 108 508 506 HOH HOH A . F 5 HOH 109 509 507 HOH HOH A . F 5 HOH 110 510 509 HOH HOH A . F 5 HOH 111 511 527 HOH HOH A . F 5 HOH 112 512 510 HOH HOH A . F 5 HOH 113 513 511 HOH HOH A . F 5 HOH 114 514 512 HOH HOH A . F 5 HOH 115 515 513 HOH HOH A . F 5 HOH 116 516 514 HOH HOH A . F 5 HOH 117 517 515 HOH HOH A . F 5 HOH 118 518 516 HOH HOH A . F 5 HOH 119 519 517 HOH HOH A . F 5 HOH 120 520 518 HOH HOH A . F 5 HOH 121 521 519 HOH HOH A . F 5 HOH 122 522 520 HOH HOH A . F 5 HOH 123 523 521 HOH HOH A . F 5 HOH 124 524 530 HOH HOH A . F 5 HOH 125 525 522 HOH HOH A . F 5 HOH 126 526 523 HOH HOH A . F 5 HOH 127 527 524 HOH HOH A . F 5 HOH 128 528 525 HOH HOH A . F 5 HOH 129 529 526 HOH HOH A . F 5 HOH 130 530 464 HOH HOH A . F 5 HOH 131 531 529 HOH HOH A . F 5 HOH 132 532 531 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 550 ? 1 MORE -38 ? 1 'SSA (A^2)' 5050 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 507 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 20 ? A GLU 162 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OE1 ? A GLU 20 ? A GLU 162 ? 1_555 0.0 ? 2 OE1 ? A GLU 20 ? A GLU 162 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 401 ? 1_555 43.4 ? 3 OE1 ? A GLU 20 ? A GLU 162 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 401 ? 1_555 43.4 ? 4 OE1 ? A GLU 20 ? A GLU 162 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 407 ? 1_555 74.0 ? 5 OE1 ? A GLU 20 ? A GLU 162 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 407 ? 1_555 74.0 ? 6 O ? F HOH . ? A HOH 401 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 407 ? 1_555 88.3 ? 7 OE1 ? A GLU 20 ? A GLU 162 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 407 ? 7_557 144.6 ? 8 OE1 ? A GLU 20 ? A GLU 162 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 407 ? 7_557 144.6 ? 9 O ? F HOH . ? A HOH 401 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 407 ? 7_557 168.8 ? 10 O ? F HOH . ? A HOH 407 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 407 ? 7_557 101.6 ? 11 OE1 ? A GLU 20 ? A GLU 162 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 493 ? 1_555 126.5 ? 12 OE1 ? A GLU 20 ? A GLU 162 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 493 ? 1_555 126.5 ? 13 O ? F HOH . ? A HOH 401 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 493 ? 1_555 85.7 ? 14 O ? F HOH . ? A HOH 407 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 493 ? 1_555 129.5 ? 15 O ? F HOH . ? A HOH 407 ? 7_557 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 493 ? 1_555 84.0 ? 16 OE2 ? A GLU 21 ? A GLU 163 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 OD2 ? A ASP 25 ? A ASP 167 ? 1_555 114.8 ? 17 OE2 ? A GLU 21 ? A GLU 163 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? A PRO 87 ? A PRO 229 ? 1_555 62.6 ? 18 OD2 ? A ASP 25 ? A ASP 167 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? A PRO 87 ? A PRO 229 ? 1_555 57.3 ? 19 OE2 ? A GLU 21 ? A GLU 163 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 65.0 ? 20 OD2 ? A ASP 25 ? A ASP 167 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 98.2 ? 21 O ? A PRO 87 ? A PRO 229 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 56.1 ? 22 OE2 ? A GLU 21 ? A GLU 163 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 476 ? 1_555 115.1 ? 23 OD2 ? A ASP 25 ? A ASP 167 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 476 ? 1_555 108.5 ? 24 O ? A PRO 87 ? A PRO 229 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 476 ? 1_555 111.7 ? 25 O ? F HOH . ? A HOH 405 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 476 ? 1_555 62.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-11 2 'Structure model' 1 1 2022-03-23 3 'Structure model' 1 2 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_audit_support 3 2 'Structure model' pdbx_struct_conn_angle 4 2 'Structure model' struct_conn 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_audit_support.funding_organization' 4 2 'Structure model' '_pdbx_audit_support.grant_number' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 19 2 'Structure model' '_pdbx_struct_conn_angle.value' 20 2 'Structure model' '_struct_conn.pdbx_dist_value' 21 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 30 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 31 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 32 2 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH21 A ARG 227 ? B O A HOH 406 ? ? 1.46 2 1 OE1 A GLU 162 ? ? O A HOH 401 ? ? 1.47 3 1 HD22 A ASN 196 ? ? O A HOH 404 ? ? 1.53 4 1 O A GLN 193 ? ? O A HOH 402 ? ? 1.65 5 1 O A HOH 494 ? ? O A HOH 497 ? ? 1.83 6 1 O A HOH 405 ? ? O A HOH 476 ? ? 1.99 7 1 ND2 A ASN 196 ? ? O A HOH 404 ? ? 2.00 8 1 OE2 A GLU 163 ? ? O A HOH 405 ? ? 2.02 9 1 OD1 A ASP 167 ? ? O A HOH 405 ? ? 2.13 10 1 O A HOH 445 ? ? O A HOH 488 ? ? 2.14 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 410 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 432 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_655 _pdbx_validate_symm_contact.dist 1.81 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 N _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 MET _pdbx_validate_rmsd_bond.auth_seq_id_1 212 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CA _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 MET _pdbx_validate_rmsd_bond.auth_seq_id_2 212 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.579 _pdbx_validate_rmsd_bond.bond_target_value 1.459 _pdbx_validate_rmsd_bond.bond_deviation 0.120 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.020 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 528 ? 5.81 . 2 1 O ? A HOH 529 ? 5.91 . 3 1 O ? A HOH 530 ? 6.07 . 4 1 O ? A HOH 531 ? 7.75 . 5 1 O ? A HOH 532 ? 8.13 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 145 ? N ? A LEU 3 N 2 1 Y 1 A LEU 145 ? CA ? A LEU 3 CA 3 1 Y 1 A LEU 145 ? CB ? A LEU 3 CB 4 1 Y 1 A LEU 145 ? CG ? A LEU 3 CG 5 1 Y 1 A LEU 145 ? CD1 ? A LEU 3 CD1 6 1 Y 1 A LEU 145 ? CD2 ? A LEU 3 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 143 ? A GLY 1 2 1 Y 1 A PRO 144 ? A PRO 2 3 1 Y 1 A ASP 194 ? A ASP 52 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 1PG C2 C N N 1 1PG C1 C N N 2 1PG O1 O N N 3 1PG O2 O N N 4 1PG C3 C N N 5 1PG C4 C N N 6 1PG C5 C N N 7 1PG O3 O N N 8 1PG C6 C N N 9 1PG C7 C N N 10 1PG O4 O N N 11 1PG C8 C N N 12 1PG C9 C N N 13 1PG O5 O N N 14 1PG C10 C N N 15 1PG C11 C N N 16 1PG O6 O N N 17 1PG H21 H N N 18 1PG H22 H N N 19 1PG H11 H N N 20 1PG H12 H N N 21 1PG H13 H N N 22 1PG H31 H N N 23 1PG H32 H N N 24 1PG H41 H N N 25 1PG H42 H N N 26 1PG H51 H N N 27 1PG H52 H N N 28 1PG H61 H N N 29 1PG H62 H N N 30 1PG H71 H N N 31 1PG H72 H N N 32 1PG H81 H N N 33 1PG H82 H N N 34 1PG H91 H N N 35 1PG H92 H N N 36 1PG H101 H N N 37 1PG H102 H N N 38 1PG H111 H N N 39 1PG H112 H N N 40 1PG HO6 H N N 41 ACT C C N N 42 ACT O O N N 43 ACT OXT O N N 44 ACT CH3 C N N 45 ACT H1 H N N 46 ACT H2 H N N 47 ACT H3 H N N 48 ALA N N N N 49 ALA CA C N S 50 ALA C C N N 51 ALA O O N N 52 ALA CB C N N 53 ALA OXT O N N 54 ALA H H N N 55 ALA H2 H N N 56 ALA HA H N N 57 ALA HB1 H N N 58 ALA HB2 H N N 59 ALA HB3 H N N 60 ALA HXT H N N 61 ARG N N N N 62 ARG CA C N S 63 ARG C C N N 64 ARG O O N N 65 ARG CB C N N 66 ARG CG C N N 67 ARG CD C N N 68 ARG NE N N N 69 ARG CZ C N N 70 ARG NH1 N N N 71 ARG NH2 N N N 72 ARG OXT O N N 73 ARG H H N N 74 ARG H2 H N N 75 ARG HA H N N 76 ARG HB2 H N N 77 ARG HB3 H N N 78 ARG HG2 H N N 79 ARG HG3 H N N 80 ARG HD2 H N N 81 ARG HD3 H N N 82 ARG HE H N N 83 ARG HH11 H N N 84 ARG HH12 H N N 85 ARG HH21 H N N 86 ARG HH22 H N N 87 ARG HXT H N N 88 ASN N N N N 89 ASN CA C N S 90 ASN C C N N 91 ASN O O N N 92 ASN CB C N N 93 ASN CG C N N 94 ASN OD1 O N N 95 ASN ND2 N N N 96 ASN OXT O N N 97 ASN H H N N 98 ASN H2 H N N 99 ASN HA H N N 100 ASN HB2 H N N 101 ASN HB3 H N N 102 ASN HD21 H N N 103 ASN HD22 H N N 104 ASN HXT H N N 105 ASP N N N N 106 ASP CA C N S 107 ASP C C N N 108 ASP O O N N 109 ASP CB C N N 110 ASP CG C N N 111 ASP OD1 O N N 112 ASP OD2 O N N 113 ASP OXT O N N 114 ASP H H N N 115 ASP H2 H N N 116 ASP HA H N N 117 ASP HB2 H N N 118 ASP HB3 H N N 119 ASP HD2 H N N 120 ASP HXT H N N 121 GLN N N N N 122 GLN CA C N S 123 GLN C C N N 124 GLN O O N N 125 GLN CB C N N 126 GLN CG C N N 127 GLN CD C N N 128 GLN OE1 O N N 129 GLN NE2 N N N 130 GLN OXT O N N 131 GLN H H N N 132 GLN H2 H N N 133 GLN HA H N N 134 GLN HB2 H N N 135 GLN HB3 H N N 136 GLN HG2 H N N 137 GLN HG3 H N N 138 GLN HE21 H N N 139 GLN HE22 H N N 140 GLN HXT H N N 141 GLU N N N N 142 GLU CA C N S 143 GLU C C N N 144 GLU O O N N 145 GLU CB C N N 146 GLU CG C N N 147 GLU CD C N N 148 GLU OE1 O N N 149 GLU OE2 O N N 150 GLU OXT O N N 151 GLU H H N N 152 GLU H2 H N N 153 GLU HA H N N 154 GLU HB2 H N N 155 GLU HB3 H N N 156 GLU HG2 H N N 157 GLU HG3 H N N 158 GLU HE2 H N N 159 GLU HXT H N N 160 GLY N N N N 161 GLY CA C N N 162 GLY C C N N 163 GLY O O N N 164 GLY OXT O N N 165 GLY H H N N 166 GLY H2 H N N 167 GLY HA2 H N N 168 GLY HA3 H N N 169 GLY HXT H N N 170 HOH O O N N 171 HOH H1 H N N 172 HOH H2 H N N 173 ILE N N N N 174 ILE CA C N S 175 ILE C C N N 176 ILE O O N N 177 ILE CB C N S 178 ILE CG1 C N N 179 ILE CG2 C N N 180 ILE CD1 C N N 181 ILE OXT O N N 182 ILE H H N N 183 ILE H2 H N N 184 ILE HA H N N 185 ILE HB H N N 186 ILE HG12 H N N 187 ILE HG13 H N N 188 ILE HG21 H N N 189 ILE HG22 H N N 190 ILE HG23 H N N 191 ILE HD11 H N N 192 ILE HD12 H N N 193 ILE HD13 H N N 194 ILE HXT H N N 195 LEU N N N N 196 LEU CA C N S 197 LEU C C N N 198 LEU O O N N 199 LEU CB C N N 200 LEU CG C N N 201 LEU CD1 C N N 202 LEU CD2 C N N 203 LEU OXT O N N 204 LEU H H N N 205 LEU H2 H N N 206 LEU HA H N N 207 LEU HB2 H N N 208 LEU HB3 H N N 209 LEU HG H N N 210 LEU HD11 H N N 211 LEU HD12 H N N 212 LEU HD13 H N N 213 LEU HD21 H N N 214 LEU HD22 H N N 215 LEU HD23 H N N 216 LEU HXT H N N 217 LYS N N N N 218 LYS CA C N S 219 LYS C C N N 220 LYS O O N N 221 LYS CB C N N 222 LYS CG C N N 223 LYS CD C N N 224 LYS CE C N N 225 LYS NZ N N N 226 LYS OXT O N N 227 LYS H H N N 228 LYS H2 H N N 229 LYS HA H N N 230 LYS HB2 H N N 231 LYS HB3 H N N 232 LYS HG2 H N N 233 LYS HG3 H N N 234 LYS HD2 H N N 235 LYS HD3 H N N 236 LYS HE2 H N N 237 LYS HE3 H N N 238 LYS HZ1 H N N 239 LYS HZ2 H N N 240 LYS HZ3 H N N 241 LYS HXT H N N 242 MET N N N N 243 MET CA C N S 244 MET C C N N 245 MET O O N N 246 MET CB C N N 247 MET CG C N N 248 MET SD S N N 249 MET CE C N N 250 MET OXT O N N 251 MET H H N N 252 MET H2 H N N 253 MET HA H N N 254 MET HB2 H N N 255 MET HB3 H N N 256 MET HG2 H N N 257 MET HG3 H N N 258 MET HE1 H N N 259 MET HE2 H N N 260 MET HE3 H N N 261 MET HXT H N N 262 PHE N N N N 263 PHE CA C N S 264 PHE C C N N 265 PHE O O N N 266 PHE CB C N N 267 PHE CG C Y N 268 PHE CD1 C Y N 269 PHE CD2 C Y N 270 PHE CE1 C Y N 271 PHE CE2 C Y N 272 PHE CZ C Y N 273 PHE OXT O N N 274 PHE H H N N 275 PHE H2 H N N 276 PHE HA H N N 277 PHE HB2 H N N 278 PHE HB3 H N N 279 PHE HD1 H N N 280 PHE HD2 H N N 281 PHE HE1 H N N 282 PHE HE2 H N N 283 PHE HZ H N N 284 PHE HXT H N N 285 PRO N N N N 286 PRO CA C N S 287 PRO C C N N 288 PRO O O N N 289 PRO CB C N N 290 PRO CG C N N 291 PRO CD C N N 292 PRO OXT O N N 293 PRO H H N N 294 PRO HA H N N 295 PRO HB2 H N N 296 PRO HB3 H N N 297 PRO HG2 H N N 298 PRO HG3 H N N 299 PRO HD2 H N N 300 PRO HD3 H N N 301 PRO HXT H N N 302 SER N N N N 303 SER CA C N S 304 SER C C N N 305 SER O O N N 306 SER CB C N N 307 SER OG O N N 308 SER OXT O N N 309 SER H H N N 310 SER H2 H N N 311 SER HA H N N 312 SER HB2 H N N 313 SER HB3 H N N 314 SER HG H N N 315 SER HXT H N N 316 THR N N N N 317 THR CA C N S 318 THR C C N N 319 THR O O N N 320 THR CB C N R 321 THR OG1 O N N 322 THR CG2 C N N 323 THR OXT O N N 324 THR H H N N 325 THR H2 H N N 326 THR HA H N N 327 THR HB H N N 328 THR HG1 H N N 329 THR HG21 H N N 330 THR HG22 H N N 331 THR HG23 H N N 332 THR HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 ZN ZN ZN N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 1PG C2 O1 sing N N 1 1PG C2 C3 sing N N 2 1PG C2 H21 sing N N 3 1PG C2 H22 sing N N 4 1PG C1 O1 sing N N 5 1PG C1 H11 sing N N 6 1PG C1 H12 sing N N 7 1PG C1 H13 sing N N 8 1PG O2 C3 sing N N 9 1PG O2 C4 sing N N 10 1PG C3 H31 sing N N 11 1PG C3 H32 sing N N 12 1PG C4 C5 sing N N 13 1PG C4 H41 sing N N 14 1PG C4 H42 sing N N 15 1PG C5 O3 sing N N 16 1PG C5 H51 sing N N 17 1PG C5 H52 sing N N 18 1PG O3 C6 sing N N 19 1PG C6 C7 sing N N 20 1PG C6 H61 sing N N 21 1PG C6 H62 sing N N 22 1PG C7 O4 sing N N 23 1PG C7 H71 sing N N 24 1PG C7 H72 sing N N 25 1PG O4 C8 sing N N 26 1PG C8 C9 sing N N 27 1PG C8 H81 sing N N 28 1PG C8 H82 sing N N 29 1PG C9 O5 sing N N 30 1PG C9 H91 sing N N 31 1PG C9 H92 sing N N 32 1PG O5 C10 sing N N 33 1PG C10 C11 sing N N 34 1PG C10 H101 sing N N 35 1PG C10 H102 sing N N 36 1PG C11 O6 sing N N 37 1PG C11 H111 sing N N 38 1PG C11 H112 sing N N 39 1PG O6 HO6 sing N N 40 ACT C O doub N N 41 ACT C OXT sing N N 42 ACT C CH3 sing N N 43 ACT CH3 H1 sing N N 44 ACT CH3 H2 sing N N 45 ACT CH3 H3 sing N N 46 ALA N CA sing N N 47 ALA N H sing N N 48 ALA N H2 sing N N 49 ALA CA C sing N N 50 ALA CA CB sing N N 51 ALA CA HA sing N N 52 ALA C O doub N N 53 ALA C OXT sing N N 54 ALA CB HB1 sing N N 55 ALA CB HB2 sing N N 56 ALA CB HB3 sing N N 57 ALA OXT HXT sing N N 58 ARG N CA sing N N 59 ARG N H sing N N 60 ARG N H2 sing N N 61 ARG CA C sing N N 62 ARG CA CB sing N N 63 ARG CA HA sing N N 64 ARG C O doub N N 65 ARG C OXT sing N N 66 ARG CB CG sing N N 67 ARG CB HB2 sing N N 68 ARG CB HB3 sing N N 69 ARG CG CD sing N N 70 ARG CG HG2 sing N N 71 ARG CG HG3 sing N N 72 ARG CD NE sing N N 73 ARG CD HD2 sing N N 74 ARG CD HD3 sing N N 75 ARG NE CZ sing N N 76 ARG NE HE sing N N 77 ARG CZ NH1 sing N N 78 ARG CZ NH2 doub N N 79 ARG NH1 HH11 sing N N 80 ARG NH1 HH12 sing N N 81 ARG NH2 HH21 sing N N 82 ARG NH2 HH22 sing N N 83 ARG OXT HXT sing N N 84 ASN N CA sing N N 85 ASN N H sing N N 86 ASN N H2 sing N N 87 ASN CA C sing N N 88 ASN CA CB sing N N 89 ASN CA HA sing N N 90 ASN C O doub N N 91 ASN C OXT sing N N 92 ASN CB CG sing N N 93 ASN CB HB2 sing N N 94 ASN CB HB3 sing N N 95 ASN CG OD1 doub N N 96 ASN CG ND2 sing N N 97 ASN ND2 HD21 sing N N 98 ASN ND2 HD22 sing N N 99 ASN OXT HXT sing N N 100 ASP N CA sing N N 101 ASP N H sing N N 102 ASP N H2 sing N N 103 ASP CA C sing N N 104 ASP CA CB sing N N 105 ASP CA HA sing N N 106 ASP C O doub N N 107 ASP C OXT sing N N 108 ASP CB CG sing N N 109 ASP CB HB2 sing N N 110 ASP CB HB3 sing N N 111 ASP CG OD1 doub N N 112 ASP CG OD2 sing N N 113 ASP OD2 HD2 sing N N 114 ASP OXT HXT sing N N 115 GLN N CA sing N N 116 GLN N H sing N N 117 GLN N H2 sing N N 118 GLN CA C sing N N 119 GLN CA CB sing N N 120 GLN CA HA sing N N 121 GLN C O doub N N 122 GLN C OXT sing N N 123 GLN CB CG sing N N 124 GLN CB HB2 sing N N 125 GLN CB HB3 sing N N 126 GLN CG CD sing N N 127 GLN CG HG2 sing N N 128 GLN CG HG3 sing N N 129 GLN CD OE1 doub N N 130 GLN CD NE2 sing N N 131 GLN NE2 HE21 sing N N 132 GLN NE2 HE22 sing N N 133 GLN OXT HXT sing N N 134 GLU N CA sing N N 135 GLU N H sing N N 136 GLU N H2 sing N N 137 GLU CA C sing N N 138 GLU CA CB sing N N 139 GLU CA HA sing N N 140 GLU C O doub N N 141 GLU C OXT sing N N 142 GLU CB CG sing N N 143 GLU CB HB2 sing N N 144 GLU CB HB3 sing N N 145 GLU CG CD sing N N 146 GLU CG HG2 sing N N 147 GLU CG HG3 sing N N 148 GLU CD OE1 doub N N 149 GLU CD OE2 sing N N 150 GLU OE2 HE2 sing N N 151 GLU OXT HXT sing N N 152 GLY N CA sing N N 153 GLY N H sing N N 154 GLY N H2 sing N N 155 GLY CA C sing N N 156 GLY CA HA2 sing N N 157 GLY CA HA3 sing N N 158 GLY C O doub N N 159 GLY C OXT sing N N 160 GLY OXT HXT sing N N 161 HOH O H1 sing N N 162 HOH O H2 sing N N 163 ILE N CA sing N N 164 ILE N H sing N N 165 ILE N H2 sing N N 166 ILE CA C sing N N 167 ILE CA CB sing N N 168 ILE CA HA sing N N 169 ILE C O doub N N 170 ILE C OXT sing N N 171 ILE CB CG1 sing N N 172 ILE CB CG2 sing N N 173 ILE CB HB sing N N 174 ILE CG1 CD1 sing N N 175 ILE CG1 HG12 sing N N 176 ILE CG1 HG13 sing N N 177 ILE CG2 HG21 sing N N 178 ILE CG2 HG22 sing N N 179 ILE CG2 HG23 sing N N 180 ILE CD1 HD11 sing N N 181 ILE CD1 HD12 sing N N 182 ILE CD1 HD13 sing N N 183 ILE OXT HXT sing N N 184 LEU N CA sing N N 185 LEU N H sing N N 186 LEU N H2 sing N N 187 LEU CA C sing N N 188 LEU CA CB sing N N 189 LEU CA HA sing N N 190 LEU C O doub N N 191 LEU C OXT sing N N 192 LEU CB CG sing N N 193 LEU CB HB2 sing N N 194 LEU CB HB3 sing N N 195 LEU CG CD1 sing N N 196 LEU CG CD2 sing N N 197 LEU CG HG sing N N 198 LEU CD1 HD11 sing N N 199 LEU CD1 HD12 sing N N 200 LEU CD1 HD13 sing N N 201 LEU CD2 HD21 sing N N 202 LEU CD2 HD22 sing N N 203 LEU CD2 HD23 sing N N 204 LEU OXT HXT sing N N 205 LYS N CA sing N N 206 LYS N H sing N N 207 LYS N H2 sing N N 208 LYS CA C sing N N 209 LYS CA CB sing N N 210 LYS CA HA sing N N 211 LYS C O doub N N 212 LYS C OXT sing N N 213 LYS CB CG sing N N 214 LYS CB HB2 sing N N 215 LYS CB HB3 sing N N 216 LYS CG CD sing N N 217 LYS CG HG2 sing N N 218 LYS CG HG3 sing N N 219 LYS CD CE sing N N 220 LYS CD HD2 sing N N 221 LYS CD HD3 sing N N 222 LYS CE NZ sing N N 223 LYS CE HE2 sing N N 224 LYS CE HE3 sing N N 225 LYS NZ HZ1 sing N N 226 LYS NZ HZ2 sing N N 227 LYS NZ HZ3 sing N N 228 LYS OXT HXT sing N N 229 MET N CA sing N N 230 MET N H sing N N 231 MET N H2 sing N N 232 MET CA C sing N N 233 MET CA CB sing N N 234 MET CA HA sing N N 235 MET C O doub N N 236 MET C OXT sing N N 237 MET CB CG sing N N 238 MET CB HB2 sing N N 239 MET CB HB3 sing N N 240 MET CG SD sing N N 241 MET CG HG2 sing N N 242 MET CG HG3 sing N N 243 MET SD CE sing N N 244 MET CE HE1 sing N N 245 MET CE HE2 sing N N 246 MET CE HE3 sing N N 247 MET OXT HXT sing N N 248 PHE N CA sing N N 249 PHE N H sing N N 250 PHE N H2 sing N N 251 PHE CA C sing N N 252 PHE CA CB sing N N 253 PHE CA HA sing N N 254 PHE C O doub N N 255 PHE C OXT sing N N 256 PHE CB CG sing N N 257 PHE CB HB2 sing N N 258 PHE CB HB3 sing N N 259 PHE CG CD1 doub Y N 260 PHE CG CD2 sing Y N 261 PHE CD1 CE1 sing Y N 262 PHE CD1 HD1 sing N N 263 PHE CD2 CE2 doub Y N 264 PHE CD2 HD2 sing N N 265 PHE CE1 CZ doub Y N 266 PHE CE1 HE1 sing N N 267 PHE CE2 CZ sing Y N 268 PHE CE2 HE2 sing N N 269 PHE CZ HZ sing N N 270 PHE OXT HXT sing N N 271 PRO N CA sing N N 272 PRO N CD sing N N 273 PRO N H sing N N 274 PRO CA C sing N N 275 PRO CA CB sing N N 276 PRO CA HA sing N N 277 PRO C O doub N N 278 PRO C OXT sing N N 279 PRO CB CG sing N N 280 PRO CB HB2 sing N N 281 PRO CB HB3 sing N N 282 PRO CG CD sing N N 283 PRO CG HG2 sing N N 284 PRO CG HG3 sing N N 285 PRO CD HD2 sing N N 286 PRO CD HD3 sing N N 287 PRO OXT HXT sing N N 288 SER N CA sing N N 289 SER N H sing N N 290 SER N H2 sing N N 291 SER CA C sing N N 292 SER CA CB sing N N 293 SER CA HA sing N N 294 SER C O doub N N 295 SER C OXT sing N N 296 SER CB OG sing N N 297 SER CB HB2 sing N N 298 SER CB HB3 sing N N 299 SER OG HG sing N N 300 SER OXT HXT sing N N 301 THR N CA sing N N 302 THR N H sing N N 303 THR N H2 sing N N 304 THR CA C sing N N 305 THR CA CB sing N N 306 THR CA HA sing N N 307 THR C O doub N N 308 THR C OXT sing N N 309 THR CB OG1 sing N N 310 THR CB CG2 sing N N 311 THR CB HB sing N N 312 THR OG1 HG1 sing N N 313 THR CG2 HG21 sing N N 314 THR CG2 HG22 sing N N 315 THR CG2 HG23 sing N N 316 THR OXT HXT sing N N 317 TYR N CA sing N N 318 TYR N H sing N N 319 TYR N H2 sing N N 320 TYR CA C sing N N 321 TYR CA CB sing N N 322 TYR CA HA sing N N 323 TYR C O doub N N 324 TYR C OXT sing N N 325 TYR CB CG sing N N 326 TYR CB HB2 sing N N 327 TYR CB HB3 sing N N 328 TYR CG CD1 doub Y N 329 TYR CG CD2 sing Y N 330 TYR CD1 CE1 sing Y N 331 TYR CD1 HD1 sing N N 332 TYR CD2 CE2 doub Y N 333 TYR CD2 HD2 sing N N 334 TYR CE1 CZ doub Y N 335 TYR CE1 HE1 sing N N 336 TYR CE2 CZ sing Y N 337 TYR CE2 HE2 sing N N 338 TYR CZ OH sing N N 339 TYR OH HH sing N N 340 TYR OXT HXT sing N N 341 VAL N CA sing N N 342 VAL N H sing N N 343 VAL N H2 sing N N 344 VAL CA C sing N N 345 VAL CA CB sing N N 346 VAL CA HA sing N N 347 VAL C O doub N N 348 VAL C OXT sing N N 349 VAL CB CG1 sing N N 350 VAL CB CG2 sing N N 351 VAL CB HB sing N N 352 VAL CG1 HG11 sing N N 353 VAL CG1 HG12 sing N N 354 VAL CG1 HG13 sing N N 355 VAL CG2 HG21 sing N N 356 VAL CG2 HG22 sing N N 357 VAL CG2 HG23 sing N N 358 VAL OXT HXT sing N N 359 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM070503 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'ACETATE ION' ACT 4 '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' 1PG 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2HZC _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #