data_5W2V # _entry.id 5W2V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5W2V pdb_00005w2v 10.2210/pdb5w2v/pdb WWPDB D_1000228341 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'CJ without thiol' 5W17 unspecified PDB CJ-G34C 5W2D unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5W2V _pdbx_database_status.recvd_initial_deposition_date 2017-06-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Huber, T.R.' 1 ? 'Snow, C.D.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Bioconjug. Chem.' _citation.journal_id_ASTM BCCHES _citation.journal_id_CSD 2063 _citation.journal_id_ISSN 1520-4812 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 17 _citation.page_last 22 _citation.title 'Installing Guest Molecules at Specific Sites within Scaffold Protein Crystals.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.bioconjchem.7b00668 _citation.pdbx_database_id_PubMed 29232505 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huber, T.R.' 1 ? primary 'McPherson, E.C.' 2 ? primary 'Keating, C.E.' 3 ? primary 'Snow, C.D.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5W2V _cell.details ? _cell.formula_units_Z ? _cell.length_a 178.022 _cell.length_a_esd ? _cell.length_b 178.022 _cell.length_b_esd ? _cell.length_c 50.707 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5W2V _symmetry.cell_setting ? _symmetry.Int_Tables_number 177 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 6 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative periplasmic protein' 20245.883 1 ? G34C ? ? 2 non-polymer syn 'UNKNOWN LIGAND' 282.547 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn SELENOCYSTEINE 168.053 1 ? ? ? ? 5 water nat water 18.015 16 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKEYTLDKAHTDVCFKIKHLQISNVKGNFKDYSAVIDFDPASAEFKKLDVTIKIASVNTENQTRDNHLQQDDFFKAKKYP DMTFTMKKYEKIDNEKGKMTGTLTIAGVSKDIVLDAEIGGVAKGKDGKEKIGFSLNGKIKRSDFKFATSTSTITLSDDIN LNIEVEANEKEGGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKEYTLDKAHTDVCFKIKHLQISNVKGNFKDYSAVIDFDPASAEFKKLDVTIKIASVNTENQTRDNHLQQDDFFKAKKYP DMTFTMKKYEKIDNEKGKMTGTLTIAGVSKDIVLDAEIGGVAKGKDGKEKIGFSLNGKIKRSDFKFATSTSTITLSDDIN LNIEVEANEKEGGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLU n 1 4 TYR n 1 5 THR n 1 6 LEU n 1 7 ASP n 1 8 LYS n 1 9 ALA n 1 10 HIS n 1 11 THR n 1 12 ASP n 1 13 VAL n 1 14 CYS n 1 15 PHE n 1 16 LYS n 1 17 ILE n 1 18 LYS n 1 19 HIS n 1 20 LEU n 1 21 GLN n 1 22 ILE n 1 23 SER n 1 24 ASN n 1 25 VAL n 1 26 LYS n 1 27 GLY n 1 28 ASN n 1 29 PHE n 1 30 LYS n 1 31 ASP n 1 32 TYR n 1 33 SER n 1 34 ALA n 1 35 VAL n 1 36 ILE n 1 37 ASP n 1 38 PHE n 1 39 ASP n 1 40 PRO n 1 41 ALA n 1 42 SER n 1 43 ALA n 1 44 GLU n 1 45 PHE n 1 46 LYS n 1 47 LYS n 1 48 LEU n 1 49 ASP n 1 50 VAL n 1 51 THR n 1 52 ILE n 1 53 LYS n 1 54 ILE n 1 55 ALA n 1 56 SER n 1 57 VAL n 1 58 ASN n 1 59 THR n 1 60 GLU n 1 61 ASN n 1 62 GLN n 1 63 THR n 1 64 ARG n 1 65 ASP n 1 66 ASN n 1 67 HIS n 1 68 LEU n 1 69 GLN n 1 70 GLN n 1 71 ASP n 1 72 ASP n 1 73 PHE n 1 74 PHE n 1 75 LYS n 1 76 ALA n 1 77 LYS n 1 78 LYS n 1 79 TYR n 1 80 PRO n 1 81 ASP n 1 82 MET n 1 83 THR n 1 84 PHE n 1 85 THR n 1 86 MET n 1 87 LYS n 1 88 LYS n 1 89 TYR n 1 90 GLU n 1 91 LYS n 1 92 ILE n 1 93 ASP n 1 94 ASN n 1 95 GLU n 1 96 LYS n 1 97 GLY n 1 98 LYS n 1 99 MET n 1 100 THR n 1 101 GLY n 1 102 THR n 1 103 LEU n 1 104 THR n 1 105 ILE n 1 106 ALA n 1 107 GLY n 1 108 VAL n 1 109 SER n 1 110 LYS n 1 111 ASP n 1 112 ILE n 1 113 VAL n 1 114 LEU n 1 115 ASP n 1 116 ALA n 1 117 GLU n 1 118 ILE n 1 119 GLY n 1 120 GLY n 1 121 VAL n 1 122 ALA n 1 123 LYS n 1 124 GLY n 1 125 LYS n 1 126 ASP n 1 127 GLY n 1 128 LYS n 1 129 GLU n 1 130 LYS n 1 131 ILE n 1 132 GLY n 1 133 PHE n 1 134 SER n 1 135 LEU n 1 136 ASN n 1 137 GLY n 1 138 LYS n 1 139 ILE n 1 140 LYS n 1 141 ARG n 1 142 SER n 1 143 ASP n 1 144 PHE n 1 145 LYS n 1 146 PHE n 1 147 ALA n 1 148 THR n 1 149 SER n 1 150 THR n 1 151 SER n 1 152 THR n 1 153 ILE n 1 154 THR n 1 155 LEU n 1 156 SER n 1 157 ASP n 1 158 ASP n 1 159 ILE n 1 160 ASN n 1 161 LEU n 1 162 ASN n 1 163 ILE n 1 164 GLU n 1 165 VAL n 1 166 GLU n 1 167 ALA n 1 168 ASN n 1 169 GLU n 1 170 LYS n 1 171 GLU n 1 172 GLY n 1 173 GLY n 1 174 SER n 1 175 HIS n 1 176 HIS n 1 177 HIS n 1 178 HIS n 1 179 HIS n 1 180 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Cj0420 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700819 / NCTC 11168' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 192222 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'C41(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pSB3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q0PB90_CAMJE _struct_ref.pdbx_db_accession Q0PB90 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KEYTLDKAHTDVGFKIKHLQISNVKGNFKDYSAVIDFDPASAEFKKLDVTIKIASVNTENQTRDNHLQQDDFFKAKKYPD MTFTMKKYEKIDNEKGKMTGTLTIAGVSKDIVLDAEIGGVAKGKDGKEKIGFSLNGKIKRSDFKFATSTSTITLSDDINL NIEVEANEK ; _struct_ref.pdbx_align_begin 22 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5W2V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 170 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q0PB90 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 190 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 22 _struct_ref_seq.pdbx_auth_seq_align_end 190 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5W2V MET A 1 ? UNP Q0PB90 ? ? 'expression tag' 21 1 1 5W2V CYS A 14 ? UNP Q0PB90 GLY 34 'engineered mutation' 34 2 1 5W2V GLU A 171 ? UNP Q0PB90 ? ? 'expression tag' 191 3 1 5W2V GLY A 172 ? UNP Q0PB90 ? ? 'expression tag' 192 4 1 5W2V GLY A 173 ? UNP Q0PB90 ? ? 'expression tag' 193 5 1 5W2V SER A 174 ? UNP Q0PB90 ? ? 'expression tag' 194 6 1 5W2V HIS A 175 ? UNP Q0PB90 ? ? 'expression tag' 195 7 1 5W2V HIS A 176 ? UNP Q0PB90 ? ? 'expression tag' 196 8 1 5W2V HIS A 177 ? UNP Q0PB90 ? ? 'expression tag' 197 9 1 5W2V HIS A 178 ? UNP Q0PB90 ? ? 'expression tag' 198 10 1 5W2V HIS A 179 ? UNP Q0PB90 ? ? 'expression tag' 199 11 1 5W2V HIS A 180 ? UNP Q0PB90 ? ? 'expression tag' 200 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEC 'L-peptide linking' y SELENOCYSTEINE ? 'C3 H7 N O2 Se' 168.053 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNL non-polymer . 'UNKNOWN LIGAND' ? ? ? VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5W2V _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 78.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.210 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.2 M Ammonium Sulfate, 0.1 M Bis-Tris' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CMOS _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RDI CMOS_8M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si (111) double crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5W2V _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.900 _reflns.d_resolution_low 38.5700 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10946 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.500 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.204 _reflns.pdbx_netI_over_av_sigmaI 3.200 _reflns.pdbx_netI_over_sigmaI 10.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.210 _reflns.pdbx_Rpim_I_all 0.048 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.900 3.060 ? 0.300 ? ? ? ? ? 98.300 ? ? ? ? 2.341 ? ? ? ? ? ? ? ? 12.500 2.341 ? ? ? 2.441 0.675 ? 1 1 ? ? 3.060 3.240 ? 0.700 ? ? ? ? ? 99.900 ? ? ? ? 1.049 ? ? ? ? ? ? ? ? 18.800 1.049 ? ? ? 1.079 0.248 ? 2 1 ? ? 3.240 3.470 ? 1.200 ? ? ? ? ? 99.900 ? ? ? ? 0.596 ? ? ? ? ? ? ? ? 20.500 0.596 ? ? ? 0.612 0.135 ? 3 1 ? ? 3.470 3.740 ? 1.500 ? ? ? ? ? 100.000 ? ? ? ? 0.441 ? ? ? ? ? ? ? ? 19.800 0.441 ? ? ? 0.453 0.102 ? 4 1 ? ? 3.740 4.100 ? 2.000 ? ? ? ? ? 100.000 ? ? ? ? 0.325 ? ? ? ? ? ? ? ? 19.600 0.325 ? ? ? 0.333 0.075 ? 5 1 ? ? 4.100 4.590 ? 3.700 ? ? ? ? ? 100.000 ? ? ? ? 0.189 ? ? ? ? ? ? ? ? 19.900 0.189 ? ? ? 0.194 0.044 ? 6 1 ? ? 4.590 5.290 ? 4.800 ? ? ? ? ? 100.000 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 19.900 0.150 ? ? ? 0.154 0.035 ? 7 1 ? ? 5.290 6.480 ? 5.400 ? ? ? ? ? 100.000 ? ? ? ? 0.130 ? ? ? ? ? ? ? ? 19.800 0.130 ? ? ? 0.134 0.030 ? 8 1 ? ? 6.480 9.170 ? 8.000 ? ? ? ? ? 100.000 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 19.100 0.081 ? ? ? 0.083 0.019 ? 9 1 ? ? 9.170 38.543 ? 10.100 ? ? ? ? ? 98.700 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 16.300 0.054 ? ? ? 0.056 0.013 ? 10 1 ? ? # _refine.aniso_B[1][1] 4.4600 _refine.aniso_B[1][2] 2.2300 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 4.4600 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -14.4700 _refine.B_iso_max 212.070 _refine.B_iso_mean 97.8170 _refine.B_iso_min 60.880 _refine.correlation_coeff_Fo_to_Fc 0.9530 _refine.correlation_coeff_Fo_to_Fc_free 0.9250 _refine.details 'U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5W2V _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.9000 _refine.ls_d_res_low 38.5700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10365 _refine.ls_number_reflns_R_free 549 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.2400 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2151 _refine.ls_R_factor_R_free 0.2608 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2127 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5W2D _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3330 _refine.pdbx_overall_ESU_R_Free 0.2800 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.9000 _refine_hist.d_res_low 38.5700 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1368 _refine_hist.pdbx_number_residues_total 171 _refine_hist.pdbx_B_iso_mean_ligand 98.86 _refine_hist.pdbx_B_iso_mean_solvent 80.47 _refine_hist.pdbx_number_atoms_protein 1323 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.019 1367 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.693 1.970 1828 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 7.787 5.000 170 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.047 26.441 59 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 20.393 15.000 256 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.190 15.000 2 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.104 0.200 209 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 978 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.9000 _refine_ls_shell.d_res_low 2.9750 _refine_ls_shell.number_reflns_all 769 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 41 _refine_ls_shell.number_reflns_R_work 728 _refine_ls_shell.percent_reflns_obs 96.4900 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3770 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.4510 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5W2V _struct.title 'Crystal structure of mutant CJ YCEI protein (CJ-G34C) with selenocysteine guest structure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5W2V _struct_keywords.text 'nanotechnology nanoporous, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 7 ? THR A 11 ? ASP A 27 THR A 31 5 ? 5 HELX_P HELX_P2 AA2 ASN A 61 ? GLN A 70 ? ASN A 81 GLN A 90 1 ? 10 HELX_P HELX_P3 AA3 SER A 142 ? LYS A 145 ? SER A 162 LYS A 165 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 7 ? AA3 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 28 ? PHE A 29 ? ASN A 48 PHE A 49 AA1 2 VAL A 57 ? ASN A 58 ? VAL A 77 ASN A 78 AA2 1 TYR A 32 ? PHE A 38 ? TYR A 52 PHE A 58 AA2 2 PHE A 45 ? LYS A 53 ? PHE A 65 LYS A 73 AA2 3 ASP A 81 ? ASP A 93 ? ASP A 101 ASP A 113 AA2 4 LYS A 96 ? ILE A 105 ? LYS A 116 ILE A 125 AA2 5 VAL A 108 ? GLU A 117 ? VAL A 128 GLU A 137 AA2 6 GLU A 129 ? LYS A 140 ? GLU A 149 LYS A 160 AA2 7 VAL A 121 ? LYS A 123 ? VAL A 141 LYS A 143 AA3 1 TYR A 32 ? PHE A 38 ? TYR A 52 PHE A 58 AA3 2 PHE A 45 ? LYS A 53 ? PHE A 65 LYS A 73 AA3 3 ASP A 81 ? ASP A 93 ? ASP A 101 ASP A 113 AA3 4 LYS A 96 ? ILE A 105 ? LYS A 116 ILE A 125 AA3 5 VAL A 108 ? GLU A 117 ? VAL A 128 GLU A 137 AA3 6 GLU A 129 ? LYS A 140 ? GLU A 149 LYS A 160 AA3 7 ASP A 158 ? ASN A 168 ? ASP A 178 ASN A 188 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 28 ? N ASN A 48 O ASN A 58 ? O ASN A 78 AA2 1 2 N ASP A 37 ? N ASP A 57 O LYS A 46 ? O LYS A 66 AA2 2 3 N ILE A 52 ? N ILE A 72 O MET A 82 ? O MET A 102 AA2 3 4 N GLU A 90 ? N GLU A 110 O LYS A 98 ? O LYS A 118 AA2 4 5 N LEU A 103 ? N LEU A 123 O LYS A 110 ? O LYS A 130 AA2 5 6 N ASP A 115 ? N ASP A 135 O ASN A 136 ? O ASN A 156 AA2 6 7 O LYS A 130 ? O LYS A 150 N ALA A 122 ? N ALA A 142 AA3 1 2 N ASP A 37 ? N ASP A 57 O LYS A 46 ? O LYS A 66 AA3 2 3 N ILE A 52 ? N ILE A 72 O MET A 82 ? O MET A 102 AA3 3 4 N GLU A 90 ? N GLU A 110 O LYS A 98 ? O LYS A 118 AA3 4 5 N LEU A 103 ? N LEU A 123 O LYS A 110 ? O LYS A 130 AA3 5 6 N ASP A 115 ? N ASP A 135 O ASN A 136 ? O ASN A 156 AA3 6 7 N GLY A 137 ? N GLY A 157 O LEU A 161 ? O LEU A 181 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 302 ? 2 'binding site for residue SO4 A 302' AC2 Software A SO4 303 ? 6 'binding site for residue SO4 A 303' AC3 Software A SEC 304 ? 2 'binding site for residue SEC A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 LYS A 110 ? LYS A 130 . ? 1_555 ? 2 AC1 2 ASP A 111 ? ASP A 131 . ? 1_555 ? 3 AC2 6 SER A 149 ? SER A 169 . ? 4_545 ? 4 AC2 6 THR A 150 ? THR A 170 . ? 1_555 ? 5 AC2 6 SER A 151 ? SER A 171 . ? 4_545 ? 6 AC2 6 SER A 151 ? SER A 171 . ? 1_555 ? 7 AC2 6 THR A 154 ? THR A 174 . ? 4_545 ? 8 AC2 6 THR A 154 ? THR A 174 . ? 1_555 ? 9 AC3 2 CYS A 14 ? CYS A 34 . ? 1_555 ? 10 AC3 2 ASN A 162 ? ASN A 182 . ? 9_556 ? # _atom_sites.entry_id 5W2V _atom_sites.fract_transf_matrix[1][1] 0.005617 _atom_sites.fract_transf_matrix[1][2] 0.003243 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006486 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019721 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 21 21 MET MET A . n A 1 2 LYS 2 22 22 LYS LYS A . n A 1 3 GLU 3 23 23 GLU GLU A . n A 1 4 TYR 4 24 24 TYR TYR A . n A 1 5 THR 5 25 25 THR THR A . n A 1 6 LEU 6 26 26 LEU LEU A . n A 1 7 ASP 7 27 27 ASP ASP A . n A 1 8 LYS 8 28 28 LYS LYS A . n A 1 9 ALA 9 29 29 ALA ALA A . n A 1 10 HIS 10 30 30 HIS HIS A . n A 1 11 THR 11 31 31 THR THR A . n A 1 12 ASP 12 32 32 ASP ASP A . n A 1 13 VAL 13 33 33 VAL VAL A . n A 1 14 CYS 14 34 34 CYS CYS A . n A 1 15 PHE 15 35 35 PHE PHE A . n A 1 16 LYS 16 36 36 LYS LYS A . n A 1 17 ILE 17 37 37 ILE ILE A . n A 1 18 LYS 18 38 38 LYS LYS A . n A 1 19 HIS 19 39 39 HIS HIS A . n A 1 20 LEU 20 40 40 LEU LEU A . n A 1 21 GLN 21 41 41 GLN GLN A . n A 1 22 ILE 22 42 42 ILE ILE A . n A 1 23 SER 23 43 43 SER SER A . n A 1 24 ASN 24 44 44 ASN ASN A . n A 1 25 VAL 25 45 45 VAL VAL A . n A 1 26 LYS 26 46 46 LYS LYS A . n A 1 27 GLY 27 47 47 GLY GLY A . n A 1 28 ASN 28 48 48 ASN ASN A . n A 1 29 PHE 29 49 49 PHE PHE A . n A 1 30 LYS 30 50 50 LYS LYS A . n A 1 31 ASP 31 51 51 ASP ASP A . n A 1 32 TYR 32 52 52 TYR TYR A . n A 1 33 SER 33 53 53 SER SER A . n A 1 34 ALA 34 54 54 ALA ALA A . n A 1 35 VAL 35 55 55 VAL VAL A . n A 1 36 ILE 36 56 56 ILE ILE A . n A 1 37 ASP 37 57 57 ASP ASP A . n A 1 38 PHE 38 58 58 PHE PHE A . n A 1 39 ASP 39 59 59 ASP ASP A . n A 1 40 PRO 40 60 60 PRO PRO A . n A 1 41 ALA 41 61 61 ALA ALA A . n A 1 42 SER 42 62 62 SER SER A . n A 1 43 ALA 43 63 63 ALA ALA A . n A 1 44 GLU 44 64 64 GLU GLU A . n A 1 45 PHE 45 65 65 PHE PHE A . n A 1 46 LYS 46 66 66 LYS LYS A . n A 1 47 LYS 47 67 67 LYS LYS A . n A 1 48 LEU 48 68 68 LEU LEU A . n A 1 49 ASP 49 69 69 ASP ASP A . n A 1 50 VAL 50 70 70 VAL VAL A . n A 1 51 THR 51 71 71 THR THR A . n A 1 52 ILE 52 72 72 ILE ILE A . n A 1 53 LYS 53 73 73 LYS LYS A . n A 1 54 ILE 54 74 74 ILE ILE A . n A 1 55 ALA 55 75 75 ALA ALA A . n A 1 56 SER 56 76 76 SER SER A . n A 1 57 VAL 57 77 77 VAL VAL A . n A 1 58 ASN 58 78 78 ASN ASN A . n A 1 59 THR 59 79 79 THR THR A . n A 1 60 GLU 60 80 80 GLU GLU A . n A 1 61 ASN 61 81 81 ASN ASN A . n A 1 62 GLN 62 82 82 GLN GLN A . n A 1 63 THR 63 83 83 THR THR A . n A 1 64 ARG 64 84 84 ARG ARG A . n A 1 65 ASP 65 85 85 ASP ASP A . n A 1 66 ASN 66 86 86 ASN ASN A . n A 1 67 HIS 67 87 87 HIS HIS A . n A 1 68 LEU 68 88 88 LEU LEU A . n A 1 69 GLN 69 89 89 GLN GLN A . n A 1 70 GLN 70 90 90 GLN GLN A . n A 1 71 ASP 71 91 91 ASP ASP A . n A 1 72 ASP 72 92 92 ASP ASP A . n A 1 73 PHE 73 93 93 PHE PHE A . n A 1 74 PHE 74 94 94 PHE PHE A . n A 1 75 LYS 75 95 95 LYS LYS A . n A 1 76 ALA 76 96 96 ALA ALA A . n A 1 77 LYS 77 97 97 LYS LYS A . n A 1 78 LYS 78 98 98 LYS LYS A . n A 1 79 TYR 79 99 99 TYR TYR A . n A 1 80 PRO 80 100 100 PRO PRO A . n A 1 81 ASP 81 101 101 ASP ASP A . n A 1 82 MET 82 102 102 MET MET A . n A 1 83 THR 83 103 103 THR THR A . n A 1 84 PHE 84 104 104 PHE PHE A . n A 1 85 THR 85 105 105 THR THR A . n A 1 86 MET 86 106 106 MET MET A . n A 1 87 LYS 87 107 107 LYS LYS A . n A 1 88 LYS 88 108 108 LYS LYS A . n A 1 89 TYR 89 109 109 TYR TYR A . n A 1 90 GLU 90 110 110 GLU GLU A . n A 1 91 LYS 91 111 111 LYS LYS A . n A 1 92 ILE 92 112 112 ILE ILE A . n A 1 93 ASP 93 113 113 ASP ASP A . n A 1 94 ASN 94 114 114 ASN ASN A . n A 1 95 GLU 95 115 115 GLU GLU A . n A 1 96 LYS 96 116 116 LYS LYS A . n A 1 97 GLY 97 117 117 GLY GLY A . n A 1 98 LYS 98 118 118 LYS LYS A . n A 1 99 MET 99 119 119 MET MET A . n A 1 100 THR 100 120 120 THR THR A . n A 1 101 GLY 101 121 121 GLY GLY A . n A 1 102 THR 102 122 122 THR THR A . n A 1 103 LEU 103 123 123 LEU LEU A . n A 1 104 THR 104 124 124 THR THR A . n A 1 105 ILE 105 125 125 ILE ILE A . n A 1 106 ALA 106 126 126 ALA ALA A . n A 1 107 GLY 107 127 127 GLY GLY A . n A 1 108 VAL 108 128 128 VAL VAL A . n A 1 109 SER 109 129 129 SER SER A . n A 1 110 LYS 110 130 130 LYS LYS A . n A 1 111 ASP 111 131 131 ASP ASP A . n A 1 112 ILE 112 132 132 ILE ILE A . n A 1 113 VAL 113 133 133 VAL VAL A . n A 1 114 LEU 114 134 134 LEU LEU A . n A 1 115 ASP 115 135 135 ASP ASP A . n A 1 116 ALA 116 136 136 ALA ALA A . n A 1 117 GLU 117 137 137 GLU GLU A . n A 1 118 ILE 118 138 138 ILE ILE A . n A 1 119 GLY 119 139 139 GLY GLY A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 VAL 121 141 141 VAL VAL A . n A 1 122 ALA 122 142 142 ALA ALA A . n A 1 123 LYS 123 143 143 LYS LYS A . n A 1 124 GLY 124 144 144 GLY GLY A . n A 1 125 LYS 125 145 145 LYS LYS A . n A 1 126 ASP 126 146 146 ASP ASP A . n A 1 127 GLY 127 147 147 GLY GLY A . n A 1 128 LYS 128 148 148 LYS LYS A . n A 1 129 GLU 129 149 149 GLU GLU A . n A 1 130 LYS 130 150 150 LYS LYS A . n A 1 131 ILE 131 151 151 ILE ILE A . n A 1 132 GLY 132 152 152 GLY GLY A . n A 1 133 PHE 133 153 153 PHE PHE A . n A 1 134 SER 134 154 154 SER SER A . n A 1 135 LEU 135 155 155 LEU LEU A . n A 1 136 ASN 136 156 156 ASN ASN A . n A 1 137 GLY 137 157 157 GLY GLY A . n A 1 138 LYS 138 158 158 LYS LYS A . n A 1 139 ILE 139 159 159 ILE ILE A . n A 1 140 LYS 140 160 160 LYS LYS A . n A 1 141 ARG 141 161 161 ARG ARG A . n A 1 142 SER 142 162 162 SER SER A . n A 1 143 ASP 143 163 163 ASP ASP A . n A 1 144 PHE 144 164 164 PHE PHE A . n A 1 145 LYS 145 165 165 LYS LYS A . n A 1 146 PHE 146 166 166 PHE PHE A . n A 1 147 ALA 147 167 167 ALA ALA A . n A 1 148 THR 148 168 168 THR THR A . n A 1 149 SER 149 169 169 SER SER A . n A 1 150 THR 150 170 170 THR THR A . n A 1 151 SER 151 171 171 SER SER A . n A 1 152 THR 152 172 172 THR THR A . n A 1 153 ILE 153 173 173 ILE ILE A . n A 1 154 THR 154 174 174 THR THR A . n A 1 155 LEU 155 175 175 LEU LEU A . n A 1 156 SER 156 176 176 SER SER A . n A 1 157 ASP 157 177 177 ASP ASP A . n A 1 158 ASP 158 178 178 ASP ASP A . n A 1 159 ILE 159 179 179 ILE ILE A . n A 1 160 ASN 160 180 180 ASN ASN A . n A 1 161 LEU 161 181 181 LEU LEU A . n A 1 162 ASN 162 182 182 ASN ASN A . n A 1 163 ILE 163 183 183 ILE ILE A . n A 1 164 GLU 164 184 184 GLU GLU A . n A 1 165 VAL 165 185 185 VAL VAL A . n A 1 166 GLU 166 186 186 GLU GLU A . n A 1 167 ALA 167 187 187 ALA ALA A . n A 1 168 ASN 168 188 188 ASN ASN A . n A 1 169 GLU 169 189 189 GLU GLU A . n A 1 170 LYS 170 190 190 LYS LYS A . n A 1 171 GLU 171 191 191 GLU GLU A . n A 1 172 GLY 172 192 ? ? ? A . n A 1 173 GLY 173 193 ? ? ? A . n A 1 174 SER 174 194 ? ? ? A . n A 1 175 HIS 175 195 ? ? ? A . n A 1 176 HIS 176 196 ? ? ? A . n A 1 177 HIS 177 197 ? ? ? A . n A 1 178 HIS 178 198 ? ? ? A . n A 1 179 HIS 179 199 ? ? ? A . n A 1 180 HIS 180 200 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 UNL 1 301 1 UNL LFA A . C 3 SO4 1 302 1 SO4 SO4 A . D 3 SO4 1 303 2 SO4 SO4 A . E 4 SEC 1 304 1 SEC SEC A . F 5 HOH 1 401 1 HOH HOH A . F 5 HOH 2 402 17 HOH HOH A . F 5 HOH 3 403 25 HOH HOH A . F 5 HOH 4 404 10 HOH HOH A . F 5 HOH 5 405 6 HOH HOH A . F 5 HOH 6 406 14 HOH HOH A . F 5 HOH 7 407 12 HOH HOH A . F 5 HOH 8 408 4 HOH HOH A . F 5 HOH 9 409 5 HOH HOH A . F 5 HOH 10 410 21 HOH HOH A . F 5 HOH 11 411 11 HOH HOH A . F 5 HOH 12 412 3 HOH HOH A . F 5 HOH 13 413 2 HOH HOH A . F 5 HOH 14 414 23 HOH HOH A . F 5 HOH 15 415 20 HOH HOH A . F 5 HOH 16 416 8 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 21660 ? 1 MORE -206 ? 1 'SSA (A^2)' 32310 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_545 -x,-y-1,z -1.0000000000 0.0000000000 0.0000000000 89.0110000000 0.0000000000 -1.0000000000 0.0000000000 -154.1715744325 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 9_556 -x,-x+y,-z+1 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 50.7070000000 4 'crystal symmetry operation' 12_546 x,x-y-1,-z+1 0.5000000000 0.8660254038 0.0000000000 89.0110000000 0.8660254038 -0.5000000000 0.0000000000 -154.1715744325 0.0000000000 0.0000000000 -1.0000000000 50.7070000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-03 2 'Structure model' 1 1 2018-01-24 3 'Structure model' 1 2 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.22 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20161101 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 34 ? ? SE A SEC 304 ? B 1.86 2 1 SG A CYS 34 ? ? SE A SEC 304 ? A 1.88 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 403 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 403 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 12_545 _pdbx_validate_symm_contact.dist 1.78 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 22 ? ? -171.61 144.49 2 1 ASN A 48 ? ? -114.54 -165.30 3 1 ALA A 63 ? ? 39.24 61.31 4 1 ASN A 81 ? ? -171.46 116.14 5 1 PHE A 93 ? ? -137.56 -109.16 6 1 LYS A 145 ? ? -29.24 -61.62 7 1 LYS A 165 ? ? 35.95 53.03 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 46 ? CG ? A LYS 26 CG 2 1 Y 1 A LYS 46 ? CD ? A LYS 26 CD 3 1 Y 1 A LYS 46 ? CE ? A LYS 26 CE 4 1 Y 1 A LYS 46 ? NZ ? A LYS 26 NZ 5 1 Y 1 A LYS 50 ? CG ? A LYS 30 CG 6 1 Y 1 A LYS 50 ? CD ? A LYS 30 CD 7 1 Y 1 A LYS 50 ? CE ? A LYS 30 CE 8 1 Y 1 A LYS 50 ? NZ ? A LYS 30 NZ 9 1 Y 1 A LYS 97 ? CG ? A LYS 77 CG 10 1 Y 1 A LYS 97 ? CD ? A LYS 77 CD 11 1 Y 1 A LYS 97 ? CE ? A LYS 77 CE 12 1 Y 1 A LYS 97 ? NZ ? A LYS 77 NZ 13 1 Y 1 A LYS 158 ? CG ? A LYS 138 CG 14 1 Y 1 A LYS 158 ? CD ? A LYS 138 CD 15 1 Y 1 A LYS 158 ? CE ? A LYS 138 CE 16 1 Y 1 A LYS 158 ? NZ ? A LYS 138 NZ 17 1 Y 1 A GLU 186 ? CG ? A GLU 166 CG 18 1 Y 1 A GLU 186 ? CD ? A GLU 166 CD 19 1 Y 1 A GLU 186 ? OE1 ? A GLU 166 OE1 20 1 Y 1 A GLU 186 ? OE2 ? A GLU 166 OE2 21 1 Y 1 A GLU 191 ? CG ? A GLU 171 CG 22 1 Y 1 A GLU 191 ? CD ? A GLU 171 CD 23 1 Y 1 A GLU 191 ? OE1 ? A GLU 171 OE1 24 1 Y 1 A GLU 191 ? OE2 ? A GLU 171 OE2 25 1 N 1 A SEC 304 ? N ? E SEC 1 N 26 1 N 1 A SEC 304 ? CA ? E SEC 1 CA 27 1 N 1 A SEC 304 ? CB ? E SEC 1 CB 28 1 N 1 A SEC 304 ? C ? E SEC 1 C 29 1 N 1 A SEC 304 ? O ? E SEC 1 O 30 1 N 1 A SEC 304 ? OXT ? E SEC 1 OXT # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 192 ? A GLY 172 2 1 Y 1 A GLY 193 ? A GLY 173 3 1 Y 1 A SER 194 ? A SER 174 4 1 Y 1 A HIS 195 ? A HIS 175 5 1 Y 1 A HIS 196 ? A HIS 176 6 1 Y 1 A HIS 197 ? A HIS 177 7 1 Y 1 A HIS 198 ? A HIS 178 8 1 Y 1 A HIS 199 ? A HIS 179 9 1 Y 1 A HIS 200 ? A HIS 180 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SEC N N N N 290 SEC CA C N R 291 SEC CB C N N 292 SEC SE SE N N 293 SEC C C N N 294 SEC O O N N 295 SEC OXT O N N 296 SEC H H N N 297 SEC H2 H N N 298 SEC HA H N N 299 SEC HB2 H N N 300 SEC HB3 H N N 301 SEC HE H N N 302 SEC HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 SO4 S S N N 318 SO4 O1 O N N 319 SO4 O2 O N N 320 SO4 O3 O N N 321 SO4 O4 O N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TYR N N N N 340 TYR CA C N S 341 TYR C C N N 342 TYR O O N N 343 TYR CB C N N 344 TYR CG C Y N 345 TYR CD1 C Y N 346 TYR CD2 C Y N 347 TYR CE1 C Y N 348 TYR CE2 C Y N 349 TYR CZ C Y N 350 TYR OH O N N 351 TYR OXT O N N 352 TYR H H N N 353 TYR H2 H N N 354 TYR HA H N N 355 TYR HB2 H N N 356 TYR HB3 H N N 357 TYR HD1 H N N 358 TYR HD2 H N N 359 TYR HE1 H N N 360 TYR HE2 H N N 361 TYR HH H N N 362 TYR HXT H N N 363 VAL N N N N 364 VAL CA C N S 365 VAL C C N N 366 VAL O O N N 367 VAL CB C N N 368 VAL CG1 C N N 369 VAL CG2 C N N 370 VAL OXT O N N 371 VAL H H N N 372 VAL H2 H N N 373 VAL HA H N N 374 VAL HB H N N 375 VAL HG11 H N N 376 VAL HG12 H N N 377 VAL HG13 H N N 378 VAL HG21 H N N 379 VAL HG22 H N N 380 VAL HG23 H N N 381 VAL HXT H N N 382 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SEC N CA sing N N 277 SEC N H sing N N 278 SEC N H2 sing N N 279 SEC CA CB sing N N 280 SEC CA C sing N N 281 SEC CA HA sing N N 282 SEC CB SE sing N N 283 SEC CB HB2 sing N N 284 SEC CB HB3 sing N N 285 SEC SE HE sing N N 286 SEC C O doub N N 287 SEC C OXT sing N N 288 SEC OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 SO4 S O1 doub N N 303 SO4 S O2 doub N N 304 SO4 S O3 sing N N 305 SO4 S O4 sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TYR N CA sing N N 323 TYR N H sing N N 324 TYR N H2 sing N N 325 TYR CA C sing N N 326 TYR CA CB sing N N 327 TYR CA HA sing N N 328 TYR C O doub N N 329 TYR C OXT sing N N 330 TYR CB CG sing N N 331 TYR CB HB2 sing N N 332 TYR CB HB3 sing N N 333 TYR CG CD1 doub Y N 334 TYR CG CD2 sing Y N 335 TYR CD1 CE1 sing Y N 336 TYR CD1 HD1 sing N N 337 TYR CD2 CE2 doub Y N 338 TYR CD2 HD2 sing N N 339 TYR CE1 CZ doub Y N 340 TYR CE1 HE1 sing N N 341 TYR CE2 CZ sing Y N 342 TYR CE2 HE2 sing N N 343 TYR CZ OH sing N N 344 TYR OH HH sing N N 345 TYR OXT HXT sing N N 346 VAL N CA sing N N 347 VAL N H sing N N 348 VAL N H2 sing N N 349 VAL CA C sing N N 350 VAL CA CB sing N N 351 VAL CA HA sing N N 352 VAL C O doub N N 353 VAL C OXT sing N N 354 VAL CB CG1 sing N N 355 VAL CB CG2 sing N N 356 VAL CB HB sing N N 357 VAL CG1 HG11 sing N N 358 VAL CG1 HG12 sing N N 359 VAL CG1 HG13 sing N N 360 VAL CG2 HG21 sing N N 361 VAL CG2 HG22 sing N N 362 VAL CG2 HG23 sing N N 363 VAL OXT HXT sing N N 364 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'UNKNOWN LIGAND' UNL 3 'SULFATE ION' SO4 4 SELENOCYSTEINE SEC 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5W2D _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details . #