data_5W9F # _entry.id 5W9F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5W9F pdb_00005w9f 10.2210/pdb5w9f/pdb WWPDB D_1000228623 ? ? BMRB 30312 ? 10.13018/BMR30312 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-07-11 2 'Structure model' 1 1 2018-09-12 3 'Structure model' 1 2 2018-10-31 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 10 5 'Structure model' pdbx_entry_details 11 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation_author.identifier_ORCID' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' 16 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 17 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5W9F _pdbx_database_status.recvd_initial_deposition_date 2017-06-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the de novo mini protein gHEEE_02' _pdbx_database_related.db_id 30312 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pulavarti, S.V.S.R.K.' 1 ? 'Shaw, E.A.' 2 ? 'Bahl, C.D.' 3 ? 'Garry, B.W.' 4 ? 'Baker, D.' 5 ? 'Szyperski, T.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 1611 _citation.page_last 1623 _citation.title ;Cytosolic expression, solution structures, and molecular dynamics simulation of genetically encodable disulfide-rich de novo designed peptides. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.3453 _citation.pdbx_database_id_PubMed 30152054 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 ? primary 'Pulavarti, S.V.S.R.K.' 2 ? primary 'Ovchinnikov, V.' 3 ? primary 'Shaw, E.A.' 4 ? primary 'Rettie, S.A.' 5 ? primary 'Myler, P.J.' 6 ? primary 'Karplus, M.' 7 ? primary 'Szyperski, T.' 8 ? primary 'Baker, D.' 9 ? primary 'Bahl, C.D.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'De novo mini protein gHEEE_02' _entity.formula_weight 4900.680 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SQETRKKCTEMKKKFKNCEVRCDESNHCVEVRCSDTKYTLC _entity_poly.pdbx_seq_one_letter_code_can SQETRKKCTEMKKKFKNCEVRCDESNHCVEVRCSDTKYTLC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLN n 1 3 GLU n 1 4 THR n 1 5 ARG n 1 6 LYS n 1 7 LYS n 1 8 CYS n 1 9 THR n 1 10 GLU n 1 11 MET n 1 12 LYS n 1 13 LYS n 1 14 LYS n 1 15 PHE n 1 16 LYS n 1 17 ASN n 1 18 CYS n 1 19 GLU n 1 20 VAL n 1 21 ARG n 1 22 CYS n 1 23 ASP n 1 24 GLU n 1 25 SER n 1 26 ASN n 1 27 HIS n 1 28 CYS n 1 29 VAL n 1 30 GLU n 1 31 VAL n 1 32 ARG n 1 33 CYS n 1 34 SER n 1 35 ASP n 1 36 THR n 1 37 LYS n 1 38 TYR n 1 39 THR n 1 40 LEU n 1 41 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 41 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pCD _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pCDB367 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 CYS 41 41 41 CYS CYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5W9F _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5W9F _struct.title 'Solution structure of the de novo mini protein gHEEE_02' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5W9F _struct_keywords.text 'De-novo design, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5W9F _struct_ref.pdbx_db_accession 5W9F _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5W9F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 41 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5W9F _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 41 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 41 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3120 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 15 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 2 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 15 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 8 A CYS 22 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf2 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 18 A CYS 33 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 28 A CYS 41 1_555 ? ? ? ? ? ? ? 2.029 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 8 ? CYS A 22 ? CYS A 8 ? 1_555 CYS A 22 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 18 ? CYS A 33 ? CYS A 18 ? 1_555 CYS A 33 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 28 ? CYS A 41 ? CYS A 28 ? 1_555 CYS A 41 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 19 ? ARG A 21 ? GLU A 19 ARG A 21 AA1 2 VAL A 29 ? ARG A 32 ? VAL A 29 ARG A 32 AA1 3 LYS A 37 ? LEU A 40 ? LYS A 37 LEU A 40 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 21 ? N ARG A 21 O GLU A 30 ? O GLU A 30 AA1 2 3 N VAL A 31 ? N VAL A 31 O TYR A 38 ? O TYR A 38 # _pdbx_entry_details.entry_id 5W9F _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 24 ? ? -154.47 -28.72 2 1 CYS A 33 ? ? -70.03 -72.18 3 1 SER A 34 ? ? -156.74 -65.42 4 2 LYS A 14 ? ? -91.51 -60.24 5 2 SER A 34 ? ? -163.78 -57.63 6 2 THR A 36 ? ? -66.88 93.92 7 3 GLN A 2 ? ? -103.09 45.16 8 3 PHE A 15 ? ? -105.78 52.98 9 3 SER A 34 ? ? -173.13 -64.65 10 4 ASP A 23 ? ? -165.76 101.04 11 5 GLU A 3 ? ? -126.01 -64.49 12 5 PHE A 15 ? ? -109.34 64.78 13 5 GLU A 24 ? ? -142.14 -3.56 14 5 SER A 34 ? ? -179.48 -55.42 15 6 PHE A 15 ? ? -107.04 53.89 16 6 CYS A 33 ? ? -73.16 -72.53 17 6 SER A 34 ? ? -157.81 -59.85 18 7 PHE A 15 ? ? -119.68 71.17 19 7 ASP A 23 ? ? -175.31 110.69 20 7 CYS A 33 ? ? -71.97 -74.96 21 7 SER A 34 ? ? -174.31 -43.22 22 7 THR A 36 ? ? -95.33 -65.23 23 7 LYS A 37 ? ? 60.44 97.93 24 8 GLU A 3 ? ? -115.83 -72.40 25 8 PHE A 15 ? ? -112.31 72.90 26 8 GLU A 24 ? ? -154.08 10.13 27 8 CYS A 33 ? ? -154.61 -76.81 28 8 SER A 34 ? ? -164.61 -64.99 29 8 THR A 36 ? ? -86.94 -83.07 30 8 LYS A 37 ? ? 56.71 91.60 31 9 PHE A 15 ? ? -95.19 50.68 32 9 ASP A 23 ? ? -171.36 132.69 33 9 SER A 34 ? ? -165.78 -63.84 34 9 LYS A 37 ? ? 47.24 88.86 35 10 GLN A 2 ? ? -156.61 80.35 36 10 GLU A 3 ? ? -129.18 -58.39 37 10 LYS A 16 ? ? -85.03 47.06 38 10 ASN A 17 ? ? -167.73 -37.42 39 10 CYS A 33 ? ? -64.49 -70.01 40 10 SER A 34 ? ? -175.44 -66.32 41 10 THR A 36 ? ? -92.76 -65.39 42 10 LYS A 37 ? ? 57.33 103.93 43 11 GLU A 3 ? ? -106.64 -69.46 44 11 LYS A 14 ? ? -92.14 -65.80 45 11 PHE A 15 ? ? -91.72 46.43 46 11 HIS A 27 ? ? 72.84 41.84 47 11 SER A 34 ? ? 173.71 -66.23 48 11 THR A 36 ? ? -78.90 -72.15 49 11 LYS A 37 ? ? 59.64 89.01 50 12 PHE A 15 ? ? -118.74 55.39 51 12 GLU A 24 ? ? -153.67 -1.64 52 12 CYS A 33 ? ? -148.77 -85.81 53 12 SER A 34 ? ? -149.50 -53.55 54 12 THR A 36 ? ? -94.61 -80.92 55 12 LYS A 37 ? ? 52.76 107.94 56 13 GLU A 3 ? ? -139.60 -68.48 57 13 CYS A 33 ? ? -65.86 -70.19 58 13 SER A 34 ? ? 175.25 -43.41 59 13 THR A 36 ? ? -86.18 -70.11 60 13 LYS A 37 ? ? 59.39 94.76 61 14 GLU A 3 ? ? -91.11 -76.93 62 14 PHE A 15 ? ? -114.73 58.26 63 14 SER A 34 ? ? -172.43 -61.21 64 14 THR A 36 ? ? -108.01 -77.62 65 14 LYS A 37 ? ? 56.02 94.70 66 15 GLU A 3 ? ? -160.37 -66.29 67 15 LYS A 14 ? ? -95.04 -61.55 68 15 PHE A 15 ? ? -93.00 54.05 69 15 CYS A 33 ? ? -157.94 -71.54 70 15 SER A 34 ? ? -157.60 -61.63 71 15 THR A 36 ? ? -109.85 -84.87 72 15 LYS A 37 ? ? 58.70 90.30 73 16 GLU A 3 ? ? -87.63 -93.63 74 16 HIS A 27 ? ? 74.34 32.05 75 16 SER A 34 ? ? 66.13 -80.54 76 16 THR A 36 ? ? -123.30 -67.73 77 16 LYS A 37 ? ? 60.45 93.82 78 17 LYS A 14 ? ? -86.08 -70.54 79 17 GLU A 24 ? ? -145.65 -3.92 80 17 CYS A 33 ? ? -70.10 -77.50 81 17 SER A 34 ? ? -158.46 -73.82 82 17 THR A 36 ? ? -84.06 -75.84 83 17 LYS A 37 ? ? 53.06 94.21 84 18 GLU A 24 ? ? -146.69 14.15 85 18 HIS A 27 ? ? 63.39 77.90 86 18 SER A 34 ? ? -175.50 -47.79 87 18 LYS A 37 ? ? 55.87 83.46 88 19 GLN A 2 ? ? -88.02 33.65 89 19 GLU A 3 ? ? -63.59 -70.89 90 19 LYS A 14 ? ? -94.47 -62.20 91 19 ASP A 23 ? ? -166.28 118.80 92 19 SER A 34 ? ? -173.42 -70.60 93 19 THR A 36 ? ? -99.82 -73.44 94 19 LYS A 37 ? ? 64.33 115.29 95 20 GLU A 3 ? ? -96.55 -80.45 96 20 LYS A 14 ? ? -66.24 -73.45 97 20 ASP A 23 ? ? -172.42 131.24 98 20 SER A 34 ? ? -172.66 -56.31 99 20 LYS A 37 ? ? 54.38 83.93 # _pdbx_nmr_ensemble.entry_id 5W9F _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5W9F _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-13C;15N] gHEEE_02, 5 uM DSS, 0.02 % sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label gHEEE_02_NC _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '50 mM sodium phosphate, 5 uM DSS, 0.02 % sodium azide, 1 mM [U-13C;15N] gHEEE_02, 90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 gHEEE_02 1 ? mM '[U-13C;15N]' 1 DSS 5 ? uM 'natural abundance' 1 d20 10 ? % 'natural abundance' 1 'sodium azide' 0.02 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D CBCA(CO)NH' 1 isotropic 10 1 1 '3D HNCACB' 1 isotropic 9 1 1 '3D HBHA(CO)NH' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 7 1 1 'GFT 4,3D HCCH-COSY' 1 isotropic 6 1 1 '3D 15N/13Caliphatic/13Caromatic-edited [1H,1H]-NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 5W9F _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'torsion angle dynamics with CYANA' _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection VNMR ? Varian 2 processing PROSA 6.4 Guntert 3 'data analysis' XEASY ? 'Bartels et al.' 4 'chemical shift assignment' CARA 1.8 'Keller and Wuthrich' 7 'chemical shift calculation' CARA 1.8 'Keller and Wuthrich' 6 'structure calculation' CYANA 3.97 'Guntert, Mumenthaler and Wuthrich' 5 refinement CNS 1.3 'Brunger, Adams, Clore, Gros, Nilges and Read' 10 'data analysis' PSVS 1.5 'Bhattacharya and Montelione' 11 refinement CYANA 3.97 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 HIS N N N N 114 HIS CA C N S 115 HIS C C N N 116 HIS O O N N 117 HIS CB C N N 118 HIS CG C Y N 119 HIS ND1 N Y N 120 HIS CD2 C Y N 121 HIS CE1 C Y N 122 HIS NE2 N Y N 123 HIS OXT O N N 124 HIS H H N N 125 HIS H2 H N N 126 HIS HA H N N 127 HIS HB2 H N N 128 HIS HB3 H N N 129 HIS HD1 H N N 130 HIS HD2 H N N 131 HIS HE1 H N N 132 HIS HE2 H N N 133 HIS HXT H N N 134 LEU N N N N 135 LEU CA C N S 136 LEU C C N N 137 LEU O O N N 138 LEU CB C N N 139 LEU CG C N N 140 LEU CD1 C N N 141 LEU CD2 C N N 142 LEU OXT O N N 143 LEU H H N N 144 LEU H2 H N N 145 LEU HA H N N 146 LEU HB2 H N N 147 LEU HB3 H N N 148 LEU HG H N N 149 LEU HD11 H N N 150 LEU HD12 H N N 151 LEU HD13 H N N 152 LEU HD21 H N N 153 LEU HD22 H N N 154 LEU HD23 H N N 155 LEU HXT H N N 156 LYS N N N N 157 LYS CA C N S 158 LYS C C N N 159 LYS O O N N 160 LYS CB C N N 161 LYS CG C N N 162 LYS CD C N N 163 LYS CE C N N 164 LYS NZ N N N 165 LYS OXT O N N 166 LYS H H N N 167 LYS H2 H N N 168 LYS HA H N N 169 LYS HB2 H N N 170 LYS HB3 H N N 171 LYS HG2 H N N 172 LYS HG3 H N N 173 LYS HD2 H N N 174 LYS HD3 H N N 175 LYS HE2 H N N 176 LYS HE3 H N N 177 LYS HZ1 H N N 178 LYS HZ2 H N N 179 LYS HZ3 H N N 180 LYS HXT H N N 181 MET N N N N 182 MET CA C N S 183 MET C C N N 184 MET O O N N 185 MET CB C N N 186 MET CG C N N 187 MET SD S N N 188 MET CE C N N 189 MET OXT O N N 190 MET H H N N 191 MET H2 H N N 192 MET HA H N N 193 MET HB2 H N N 194 MET HB3 H N N 195 MET HG2 H N N 196 MET HG3 H N N 197 MET HE1 H N N 198 MET HE2 H N N 199 MET HE3 H N N 200 MET HXT H N N 201 PHE N N N N 202 PHE CA C N S 203 PHE C C N N 204 PHE O O N N 205 PHE CB C N N 206 PHE CG C Y N 207 PHE CD1 C Y N 208 PHE CD2 C Y N 209 PHE CE1 C Y N 210 PHE CE2 C Y N 211 PHE CZ C Y N 212 PHE OXT O N N 213 PHE H H N N 214 PHE H2 H N N 215 PHE HA H N N 216 PHE HB2 H N N 217 PHE HB3 H N N 218 PHE HD1 H N N 219 PHE HD2 H N N 220 PHE HE1 H N N 221 PHE HE2 H N N 222 PHE HZ H N N 223 PHE HXT H N N 224 SER N N N N 225 SER CA C N S 226 SER C C N N 227 SER O O N N 228 SER CB C N N 229 SER OG O N N 230 SER OXT O N N 231 SER H H N N 232 SER H2 H N N 233 SER HA H N N 234 SER HB2 H N N 235 SER HB3 H N N 236 SER HG H N N 237 SER HXT H N N 238 THR N N N N 239 THR CA C N S 240 THR C C N N 241 THR O O N N 242 THR CB C N R 243 THR OG1 O N N 244 THR CG2 C N N 245 THR OXT O N N 246 THR H H N N 247 THR H2 H N N 248 THR HA H N N 249 THR HB H N N 250 THR HG1 H N N 251 THR HG21 H N N 252 THR HG22 H N N 253 THR HG23 H N N 254 THR HXT H N N 255 TYR N N N N 256 TYR CA C N S 257 TYR C C N N 258 TYR O O N N 259 TYR CB C N N 260 TYR CG C Y N 261 TYR CD1 C Y N 262 TYR CD2 C Y N 263 TYR CE1 C Y N 264 TYR CE2 C Y N 265 TYR CZ C Y N 266 TYR OH O N N 267 TYR OXT O N N 268 TYR H H N N 269 TYR H2 H N N 270 TYR HA H N N 271 TYR HB2 H N N 272 TYR HB3 H N N 273 TYR HD1 H N N 274 TYR HD2 H N N 275 TYR HE1 H N N 276 TYR HE2 H N N 277 TYR HH H N N 278 TYR HXT H N N 279 VAL N N N N 280 VAL CA C N S 281 VAL C C N N 282 VAL O O N N 283 VAL CB C N N 284 VAL CG1 C N N 285 VAL CG2 C N N 286 VAL OXT O N N 287 VAL H H N N 288 VAL H2 H N N 289 VAL HA H N N 290 VAL HB H N N 291 VAL HG11 H N N 292 VAL HG12 H N N 293 VAL HG13 H N N 294 VAL HG21 H N N 295 VAL HG22 H N N 296 VAL HG23 H N N 297 VAL HXT H N N 298 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLU N CA sing N N 90 GLU N H sing N N 91 GLU N H2 sing N N 92 GLU CA C sing N N 93 GLU CA CB sing N N 94 GLU CA HA sing N N 95 GLU C O doub N N 96 GLU C OXT sing N N 97 GLU CB CG sing N N 98 GLU CB HB2 sing N N 99 GLU CB HB3 sing N N 100 GLU CG CD sing N N 101 GLU CG HG2 sing N N 102 GLU CG HG3 sing N N 103 GLU CD OE1 doub N N 104 GLU CD OE2 sing N N 105 GLU OE2 HE2 sing N N 106 GLU OXT HXT sing N N 107 HIS N CA sing N N 108 HIS N H sing N N 109 HIS N H2 sing N N 110 HIS CA C sing N N 111 HIS CA CB sing N N 112 HIS CA HA sing N N 113 HIS C O doub N N 114 HIS C OXT sing N N 115 HIS CB CG sing N N 116 HIS CB HB2 sing N N 117 HIS CB HB3 sing N N 118 HIS CG ND1 sing Y N 119 HIS CG CD2 doub Y N 120 HIS ND1 CE1 doub Y N 121 HIS ND1 HD1 sing N N 122 HIS CD2 NE2 sing Y N 123 HIS CD2 HD2 sing N N 124 HIS CE1 NE2 sing Y N 125 HIS CE1 HE1 sing N N 126 HIS NE2 HE2 sing N N 127 HIS OXT HXT sing N N 128 LEU N CA sing N N 129 LEU N H sing N N 130 LEU N H2 sing N N 131 LEU CA C sing N N 132 LEU CA CB sing N N 133 LEU CA HA sing N N 134 LEU C O doub N N 135 LEU C OXT sing N N 136 LEU CB CG sing N N 137 LEU CB HB2 sing N N 138 LEU CB HB3 sing N N 139 LEU CG CD1 sing N N 140 LEU CG CD2 sing N N 141 LEU CG HG sing N N 142 LEU CD1 HD11 sing N N 143 LEU CD1 HD12 sing N N 144 LEU CD1 HD13 sing N N 145 LEU CD2 HD21 sing N N 146 LEU CD2 HD22 sing N N 147 LEU CD2 HD23 sing N N 148 LEU OXT HXT sing N N 149 LYS N CA sing N N 150 LYS N H sing N N 151 LYS N H2 sing N N 152 LYS CA C sing N N 153 LYS CA CB sing N N 154 LYS CA HA sing N N 155 LYS C O doub N N 156 LYS C OXT sing N N 157 LYS CB CG sing N N 158 LYS CB HB2 sing N N 159 LYS CB HB3 sing N N 160 LYS CG CD sing N N 161 LYS CG HG2 sing N N 162 LYS CG HG3 sing N N 163 LYS CD CE sing N N 164 LYS CD HD2 sing N N 165 LYS CD HD3 sing N N 166 LYS CE NZ sing N N 167 LYS CE HE2 sing N N 168 LYS CE HE3 sing N N 169 LYS NZ HZ1 sing N N 170 LYS NZ HZ2 sing N N 171 LYS NZ HZ3 sing N N 172 LYS OXT HXT sing N N 173 MET N CA sing N N 174 MET N H sing N N 175 MET N H2 sing N N 176 MET CA C sing N N 177 MET CA CB sing N N 178 MET CA HA sing N N 179 MET C O doub N N 180 MET C OXT sing N N 181 MET CB CG sing N N 182 MET CB HB2 sing N N 183 MET CB HB3 sing N N 184 MET CG SD sing N N 185 MET CG HG2 sing N N 186 MET CG HG3 sing N N 187 MET SD CE sing N N 188 MET CE HE1 sing N N 189 MET CE HE2 sing N N 190 MET CE HE3 sing N N 191 MET OXT HXT sing N N 192 PHE N CA sing N N 193 PHE N H sing N N 194 PHE N H2 sing N N 195 PHE CA C sing N N 196 PHE CA CB sing N N 197 PHE CA HA sing N N 198 PHE C O doub N N 199 PHE C OXT sing N N 200 PHE CB CG sing N N 201 PHE CB HB2 sing N N 202 PHE CB HB3 sing N N 203 PHE CG CD1 doub Y N 204 PHE CG CD2 sing Y N 205 PHE CD1 CE1 sing Y N 206 PHE CD1 HD1 sing N N 207 PHE CD2 CE2 doub Y N 208 PHE CD2 HD2 sing N N 209 PHE CE1 CZ doub Y N 210 PHE CE1 HE1 sing N N 211 PHE CE2 CZ sing Y N 212 PHE CE2 HE2 sing N N 213 PHE CZ HZ sing N N 214 PHE OXT HXT sing N N 215 SER N CA sing N N 216 SER N H sing N N 217 SER N H2 sing N N 218 SER CA C sing N N 219 SER CA CB sing N N 220 SER CA HA sing N N 221 SER C O doub N N 222 SER C OXT sing N N 223 SER CB OG sing N N 224 SER CB HB2 sing N N 225 SER CB HB3 sing N N 226 SER OG HG sing N N 227 SER OXT HXT sing N N 228 THR N CA sing N N 229 THR N H sing N N 230 THR N H2 sing N N 231 THR CA C sing N N 232 THR CA CB sing N N 233 THR CA HA sing N N 234 THR C O doub N N 235 THR C OXT sing N N 236 THR CB OG1 sing N N 237 THR CB CG2 sing N N 238 THR CB HB sing N N 239 THR OG1 HG1 sing N N 240 THR CG2 HG21 sing N N 241 THR CG2 HG22 sing N N 242 THR CG2 HG23 sing N N 243 THR OXT HXT sing N N 244 TYR N CA sing N N 245 TYR N H sing N N 246 TYR N H2 sing N N 247 TYR CA C sing N N 248 TYR CA CB sing N N 249 TYR CA HA sing N N 250 TYR C O doub N N 251 TYR C OXT sing N N 252 TYR CB CG sing N N 253 TYR CB HB2 sing N N 254 TYR CB HB3 sing N N 255 TYR CG CD1 doub Y N 256 TYR CG CD2 sing Y N 257 TYR CD1 CE1 sing Y N 258 TYR CD1 HD1 sing N N 259 TYR CD2 CE2 doub Y N 260 TYR CD2 HD2 sing N N 261 TYR CE1 CZ doub Y N 262 TYR CE1 HE1 sing N N 263 TYR CE2 CZ sing Y N 264 TYR CE2 HE2 sing N N 265 TYR CZ OH sing N N 266 TYR OH HH sing N N 267 TYR OXT HXT sing N N 268 VAL N CA sing N N 269 VAL N H sing N N 270 VAL N H2 sing N N 271 VAL CA C sing N N 272 VAL CA CB sing N N 273 VAL CA HA sing N N 274 VAL C O doub N N 275 VAL C OXT sing N N 276 VAL CB CG1 sing N N 277 VAL CB CG2 sing N N 278 VAL CB HB sing N N 279 VAL CG1 HG11 sing N N 280 VAL CG1 HG12 sing N N 281 VAL CG1 HG13 sing N N 282 VAL CG2 HG21 sing N N 283 VAL CG2 HG22 sing N N 284 VAL CG2 HG23 sing N N 285 VAL OXT HXT sing N N 286 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 750 _pdbx_nmr_spectrometer.details 'High field NMR facility, Dept. of Chemistry, SUNY Buffalo' # _atom_sites.entry_id 5W9F _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_