data_5WE7 # _entry.id 5WE7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5WE7 pdb_00005we7 10.2210/pdb5we7/pdb WWPDB D_1000228877 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-03 2 'Structure model' 1 1 2019-12-11 3 'Structure model' 1 2 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5WE7 _pdbx_database_status.recvd_initial_deposition_date 2017-07-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5W3I unspecified PDB . 5W44 unspecified PDB . 5W73 unspecified PDB . 5W7U unspecified PDB . 5W92 unspecified PDB . 5W9G unspecified PDB . 5WA6 unspecified PDB . 5WA7 unspecified PDB . 5WAP unspecified PDB . 5WB3 unspecified PDB . 5WDW unspecified PDB . 5WCS unspecified PDB . 5WCT unspecified PDB . 5WDN unspecified PDB . 5WDC unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kumar, G.' 1 0000-0001-7593-0737 'White, S.W.' 2 0000-0001-8188-5944 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the influenza virus PA endonuclease in complex with an inhibitor - SRI-29782' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, G.' 1 ? primary 'White, S.W.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 21970.160 1 ? 'Loop 51-72 is replaced a GGS linker, C-terminal has residual His-tag' ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn '2-{(2R)-1-[2-(4-chlorophenoxy)-2-methylpropanoyl]pyrrolidin-2-yl}-5-hydroxy-6-oxo-1,6-dihydropyrimidine-4-carboxylic acid' 421.832 1 ? ? ? ? 4 non-polymer syn D-MALATE 134.087 1 ? ? ? ? 5 water nat water 18.015 32 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTG VEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR QEMASRSLWDSFRQSERAAAELALVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTG VEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR QEMASRSLWDSFRQSERAAAELALVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 '2-{(2R)-1-[2-(4-chlorophenoxy)-2-methylpropanoyl]pyrrolidin-2-yl}-5-hydroxy-6-oxo-1,6-dihydropyrimidine-4-carboxylic acid' G3K 4 D-MALATE MLT 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASP n 1 4 PHE n 1 5 VAL n 1 6 ARG n 1 7 GLN n 1 8 CYS n 1 9 PHE n 1 10 ASN n 1 11 PRO n 1 12 MET n 1 13 ILE n 1 14 VAL n 1 15 GLU n 1 16 LEU n 1 17 ALA n 1 18 GLU n 1 19 LYS n 1 20 ALA n 1 21 MET n 1 22 LYS n 1 23 GLU n 1 24 TYR n 1 25 GLY n 1 26 GLU n 1 27 ASP n 1 28 PRO n 1 29 LYS n 1 30 ILE n 1 31 GLU n 1 32 THR n 1 33 ASN n 1 34 LYS n 1 35 PHE n 1 36 ALA n 1 37 ALA n 1 38 ILE n 1 39 CYS n 1 40 THR n 1 41 HIS n 1 42 LEU n 1 43 GLU n 1 44 VAL n 1 45 CYS n 1 46 PHE n 1 47 MET n 1 48 TYR n 1 49 SER n 1 50 ASP n 1 51 GLY n 1 52 GLY n 1 53 SER n 1 54 LYS n 1 55 HIS n 1 56 ARG n 1 57 PHE n 1 58 GLU n 1 59 ILE n 1 60 ILE n 1 61 GLU n 1 62 GLY n 1 63 ARG n 1 64 ASP n 1 65 ARG n 1 66 ILE n 1 67 MET n 1 68 ALA n 1 69 TRP n 1 70 THR n 1 71 VAL n 1 72 VAL n 1 73 ASN n 1 74 SER n 1 75 ILE n 1 76 CYS n 1 77 ASN n 1 78 THR n 1 79 THR n 1 80 GLY n 1 81 VAL n 1 82 GLU n 1 83 LYS n 1 84 PRO n 1 85 LYS n 1 86 PHE n 1 87 LEU n 1 88 PRO n 1 89 ASP n 1 90 LEU n 1 91 TYR n 1 92 ASP n 1 93 TYR n 1 94 LYS n 1 95 GLU n 1 96 ASN n 1 97 ARG n 1 98 PHE n 1 99 ILE n 1 100 GLU n 1 101 ILE n 1 102 GLY n 1 103 VAL n 1 104 THR n 1 105 ARG n 1 106 ARG n 1 107 GLU n 1 108 VAL n 1 109 HIS n 1 110 ILE n 1 111 TYR n 1 112 TYR n 1 113 LEU n 1 114 GLU n 1 115 LYS n 1 116 ALA n 1 117 ASN n 1 118 LYS n 1 119 ILE n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 LYS n 1 124 THR n 1 125 HIS n 1 126 ILE n 1 127 HIS n 1 128 ILE n 1 129 PHE n 1 130 SER n 1 131 PHE n 1 132 THR n 1 133 GLY n 1 134 GLU n 1 135 GLU n 1 136 MET n 1 137 ALA n 1 138 THR n 1 139 LYS n 1 140 ALA n 1 141 ASP n 1 142 TYR n 1 143 THR n 1 144 LEU n 1 145 ASP n 1 146 GLU n 1 147 GLU n 1 148 SER n 1 149 ARG n 1 150 ALA n 1 151 ARG n 1 152 ILE n 1 153 LYS n 1 154 THR n 1 155 ARG n 1 156 LEU n 1 157 PHE n 1 158 THR n 1 159 ILE n 1 160 ARG n 1 161 GLN n 1 162 GLU n 1 163 MET n 1 164 ALA n 1 165 SER n 1 166 ARG n 1 167 SER n 1 168 LEU n 1 169 TRP n 1 170 ASP n 1 171 SER n 1 172 PHE n 1 173 ARG n 1 174 GLN n 1 175 SER n 1 176 GLU n 1 177 ARG n 1 178 ALA n 1 179 ALA n 1 180 ALA n 1 181 GLU n 1 182 LEU n 1 183 ALA n 1 184 LEU n 1 185 VAL n 1 186 PRO n 1 187 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 50 ? ? PA ? 'swl A/California/04/2009 H1N1' ? ? ? ? 'Influenza A virus' 641501 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? pET52b ? ? 1 2 sample 'Biological sequence' 51 187 ? ? PA ? 'swl A/California/04/2009 H1N1' ? ? ? ? 'Influenza A virus' 641501 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? pET52b ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G3K non-polymer . '2-{(2R)-1-[2-(4-chlorophenoxy)-2-methylpropanoyl]pyrrolidin-2-yl}-5-hydroxy-6-oxo-1,6-dihydropyrimidine-4-carboxylic acid' SRI-29782 'C19 H20 Cl N3 O6' 421.832 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLT non-polymer . D-MALATE '(2R)-2-HYDROXYBUTANEDIOIC ACID; 2-HYDROXY-SUCCINIC ACID' 'C4 H6 O5' 134.087 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LYS 54 73 73 LYS LYS A . n A 1 55 HIS 55 74 74 HIS HIS A . n A 1 56 ARG 56 75 75 ARG ARG A . n A 1 57 PHE 57 76 76 PHE PHE A . n A 1 58 GLU 58 77 77 GLU GLU A . n A 1 59 ILE 59 78 78 ILE ILE A . n A 1 60 ILE 60 79 79 ILE ILE A . n A 1 61 GLU 61 80 80 GLU GLU A . n A 1 62 GLY 62 81 81 GLY GLY A . n A 1 63 ARG 63 82 82 ARG ARG A . n A 1 64 ASP 64 83 83 ASP ASP A . n A 1 65 ARG 65 84 84 ARG ARG A . n A 1 66 ILE 66 85 85 ILE ILE A . n A 1 67 MET 67 86 86 MET MET A . n A 1 68 ALA 68 87 87 ALA ALA A . n A 1 69 TRP 69 88 88 TRP TRP A . n A 1 70 THR 70 89 89 THR THR A . n A 1 71 VAL 71 90 90 VAL VAL A . n A 1 72 VAL 72 91 91 VAL VAL A . n A 1 73 ASN 73 92 92 ASN ASN A . n A 1 74 SER 74 93 93 SER SER A . n A 1 75 ILE 75 94 94 ILE ILE A . n A 1 76 CYS 76 95 95 CYS CYS A . n A 1 77 ASN 77 96 96 ASN ASN A . n A 1 78 THR 78 97 97 THR THR A . n A 1 79 THR 79 98 98 THR THR A . n A 1 80 GLY 80 99 99 GLY GLY A . n A 1 81 VAL 81 100 100 VAL VAL A . n A 1 82 GLU 82 101 101 GLU GLU A . n A 1 83 LYS 83 102 102 LYS LYS A . n A 1 84 PRO 84 103 103 PRO PRO A . n A 1 85 LYS 85 104 104 LYS LYS A . n A 1 86 PHE 86 105 105 PHE PHE A . n A 1 87 LEU 87 106 106 LEU LEU A . n A 1 88 PRO 88 107 107 PRO PRO A . n A 1 89 ASP 89 108 108 ASP ASP A . n A 1 90 LEU 90 109 109 LEU LEU A . n A 1 91 TYR 91 110 110 TYR TYR A . n A 1 92 ASP 92 111 111 ASP ASP A . n A 1 93 TYR 93 112 112 TYR TYR A . n A 1 94 LYS 94 113 113 LYS LYS A . n A 1 95 GLU 95 114 114 GLU GLU A . n A 1 96 ASN 96 115 115 ASN ASN A . n A 1 97 ARG 97 116 116 ARG ARG A . n A 1 98 PHE 98 117 117 PHE PHE A . n A 1 99 ILE 99 118 118 ILE ILE A . n A 1 100 GLU 100 119 119 GLU GLU A . n A 1 101 ILE 101 120 120 ILE ILE A . n A 1 102 GLY 102 121 121 GLY GLY A . n A 1 103 VAL 103 122 122 VAL VAL A . n A 1 104 THR 104 123 123 THR THR A . n A 1 105 ARG 105 124 124 ARG ARG A . n A 1 106 ARG 106 125 125 ARG ARG A . n A 1 107 GLU 107 126 126 GLU GLU A . n A 1 108 VAL 108 127 127 VAL VAL A . n A 1 109 HIS 109 128 128 HIS HIS A . n A 1 110 ILE 110 129 129 ILE ILE A . n A 1 111 TYR 111 130 130 TYR TYR A . n A 1 112 TYR 112 131 131 TYR TYR A . n A 1 113 LEU 113 132 132 LEU LEU A . n A 1 114 GLU 114 133 133 GLU GLU A . n A 1 115 LYS 115 134 134 LYS LYS A . n A 1 116 ALA 116 135 135 ALA ALA A . n A 1 117 ASN 117 136 136 ASN ASN A . n A 1 118 LYS 118 137 137 LYS LYS A . n A 1 119 ILE 119 138 138 ILE ILE A . n A 1 120 LYS 120 139 139 LYS LYS A . n A 1 121 SER 121 140 140 SER SER A . n A 1 122 GLU 122 141 141 GLU GLU A . n A 1 123 LYS 123 142 142 LYS LYS A . n A 1 124 THR 124 143 143 THR THR A . n A 1 125 HIS 125 144 144 HIS HIS A . n A 1 126 ILE 126 145 145 ILE ILE A . n A 1 127 HIS 127 146 146 HIS HIS A . n A 1 128 ILE 128 147 147 ILE ILE A . n A 1 129 PHE 129 148 148 PHE PHE A . n A 1 130 SER 130 149 149 SER SER A . n A 1 131 PHE 131 150 150 PHE PHE A . n A 1 132 THR 132 151 151 THR THR A . n A 1 133 GLY 133 152 152 GLY GLY A . n A 1 134 GLU 134 153 153 GLU GLU A . n A 1 135 GLU 135 154 154 GLU GLU A . n A 1 136 MET 136 155 155 MET MET A . n A 1 137 ALA 137 156 156 ALA ALA A . n A 1 138 THR 138 157 157 THR THR A . n A 1 139 LYS 139 158 158 LYS LYS A . n A 1 140 ALA 140 159 159 ALA ALA A . n A 1 141 ASP 141 160 160 ASP ASP A . n A 1 142 TYR 142 161 161 TYR TYR A . n A 1 143 THR 143 162 162 THR THR A . n A 1 144 LEU 144 163 163 LEU LEU A . n A 1 145 ASP 145 164 164 ASP ASP A . n A 1 146 GLU 146 165 165 GLU GLU A . n A 1 147 GLU 147 166 166 GLU GLU A . n A 1 148 SER 148 167 167 SER SER A . n A 1 149 ARG 149 168 168 ARG ARG A . n A 1 150 ALA 150 169 169 ALA ALA A . n A 1 151 ARG 151 170 170 ARG ARG A . n A 1 152 ILE 152 171 171 ILE ILE A . n A 1 153 LYS 153 172 172 LYS LYS A . n A 1 154 THR 154 173 173 THR THR A . n A 1 155 ARG 155 174 174 ARG ARG A . n A 1 156 LEU 156 175 175 LEU LEU A . n A 1 157 PHE 157 176 176 PHE PHE A . n A 1 158 THR 158 177 177 THR THR A . n A 1 159 ILE 159 178 178 ILE ILE A . n A 1 160 ARG 160 179 179 ARG ARG A . n A 1 161 GLN 161 180 180 GLN GLN A . n A 1 162 GLU 162 181 181 GLU GLU A . n A 1 163 MET 163 182 182 MET MET A . n A 1 164 ALA 164 183 183 ALA ALA A . n A 1 165 SER 165 184 184 SER SER A . n A 1 166 ARG 166 185 185 ARG ARG A . n A 1 167 SER 167 186 186 SER SER A . n A 1 168 LEU 168 187 187 LEU LEU A . n A 1 169 TRP 169 188 188 TRP TRP A . n A 1 170 ASP 170 189 189 ASP ASP A . n A 1 171 SER 171 190 190 SER SER A . n A 1 172 PHE 172 191 191 PHE PHE A . n A 1 173 ARG 173 192 192 ARG ARG A . n A 1 174 GLN 174 193 193 GLN GLN A . n A 1 175 SER 175 194 194 SER SER A . n A 1 176 GLU 176 195 195 GLU GLU A . n A 1 177 ARG 177 196 196 ARG ARG A . n A 1 178 ALA 178 197 197 ALA ALA A . n A 1 179 ALA 179 198 198 ALA ALA A . n A 1 180 ALA 180 199 199 ALA ALA A . n A 1 181 GLU 181 200 200 GLU GLU A . n A 1 182 LEU 182 201 201 LEU LEU A . n A 1 183 ALA 183 202 202 ALA ALA A . n A 1 184 LEU 184 203 ? ? ? A . n A 1 185 VAL 185 204 ? ? ? A . n A 1 186 PRO 186 205 ? ? ? A . n A 1 187 ARG 187 206 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 301 201 MN MN A . C 2 MN 1 302 202 MN MN A . D 3 G3K 1 303 1 G3K G3K A . E 4 MLT 1 304 1 MLT MLT A . F 5 HOH 1 401 9 HOH HOH A . F 5 HOH 2 402 32 HOH HOH A . F 5 HOH 3 403 14 HOH HOH A . F 5 HOH 4 404 18 HOH HOH A . F 5 HOH 5 405 11 HOH HOH A . F 5 HOH 6 406 7 HOH HOH A . F 5 HOH 7 407 4 HOH HOH A . F 5 HOH 8 408 2 HOH HOH A . F 5 HOH 9 409 1 HOH HOH A . F 5 HOH 10 410 3 HOH HOH A . F 5 HOH 11 411 13 HOH HOH A . F 5 HOH 12 412 28 HOH HOH A . F 5 HOH 13 413 10 HOH HOH A . F 5 HOH 14 414 8 HOH HOH A . F 5 HOH 15 415 22 HOH HOH A . F 5 HOH 16 416 15 HOH HOH A . F 5 HOH 17 417 33 HOH HOH A . F 5 HOH 18 418 25 HOH HOH A . F 5 HOH 19 419 23 HOH HOH A . F 5 HOH 20 420 29 HOH HOH A . F 5 HOH 21 421 5 HOH HOH A . F 5 HOH 22 422 17 HOH HOH A . F 5 HOH 23 423 30 HOH HOH A . F 5 HOH 24 424 16 HOH HOH A . F 5 HOH 25 425 12 HOH HOH A . F 5 HOH 26 426 6 HOH HOH A . F 5 HOH 27 427 26 HOH HOH A . F 5 HOH 28 428 24 HOH HOH A . F 5 HOH 29 429 27 HOH HOH A . F 5 HOH 30 430 20 HOH HOH A . F 5 HOH 31 431 19 HOH HOH A . F 5 HOH 32 432 31 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 2 ? CG ? A GLU 2 CG 2 1 Y 1 A GLU 2 ? CD ? A GLU 2 CD 3 1 Y 1 A GLU 2 ? OE1 ? A GLU 2 OE1 4 1 Y 1 A GLU 2 ? OE2 ? A GLU 2 OE2 5 1 Y 1 A ASP 3 ? CG ? A ASP 3 CG 6 1 Y 1 A ASP 3 ? OD1 ? A ASP 3 OD1 7 1 Y 1 A ASP 3 ? OD2 ? A ASP 3 OD2 8 1 Y 1 A GLU 15 ? CG ? A GLU 15 CG 9 1 Y 1 A GLU 15 ? CD ? A GLU 15 CD 10 1 Y 1 A GLU 15 ? OE1 ? A GLU 15 OE1 11 1 Y 1 A GLU 15 ? OE2 ? A GLU 15 OE2 12 1 Y 1 A LYS 29 ? CG ? A LYS 29 CG 13 1 Y 1 A LYS 29 ? CD ? A LYS 29 CD 14 1 Y 1 A LYS 29 ? CE ? A LYS 29 CE 15 1 Y 1 A LYS 29 ? NZ ? A LYS 29 NZ 16 1 Y 1 A ILE 30 ? CG1 ? A ILE 30 CG1 17 1 Y 1 A ILE 30 ? CG2 ? A ILE 30 CG2 18 1 Y 1 A ILE 30 ? CD1 ? A ILE 30 CD1 19 1 Y 1 A SER 53 ? OG ? A SER 53 OG 20 1 Y 1 A GLU 101 ? CG ? A GLU 82 CG 21 1 Y 1 A GLU 101 ? CD ? A GLU 82 CD 22 1 Y 1 A GLU 101 ? OE1 ? A GLU 82 OE1 23 1 Y 1 A GLU 101 ? OE2 ? A GLU 82 OE2 24 1 Y 1 A LYS 104 ? CG ? A LYS 85 CG 25 1 Y 1 A LYS 104 ? CD ? A LYS 85 CD 26 1 Y 1 A LYS 104 ? CE ? A LYS 85 CE 27 1 Y 1 A LYS 104 ? NZ ? A LYS 85 NZ 28 1 Y 1 A LYS 137 ? CG ? A LYS 118 CG 29 1 Y 1 A LYS 137 ? CD ? A LYS 118 CD 30 1 Y 1 A LYS 137 ? CE ? A LYS 118 CE 31 1 Y 1 A LYS 137 ? NZ ? A LYS 118 NZ 32 1 Y 1 A LYS 139 ? CG ? A LYS 120 CG 33 1 Y 1 A LYS 139 ? CD ? A LYS 120 CD 34 1 Y 1 A LYS 139 ? CE ? A LYS 120 CE 35 1 Y 1 A LYS 139 ? NZ ? A LYS 120 NZ 36 1 Y 1 A SER 140 ? OG ? A SER 121 OG 37 1 Y 1 A GLU 141 ? CG ? A GLU 122 CG 38 1 Y 1 A GLU 141 ? CD ? A GLU 122 CD 39 1 Y 1 A GLU 141 ? OE1 ? A GLU 122 OE1 40 1 Y 1 A GLU 141 ? OE2 ? A GLU 122 OE2 41 1 Y 1 A LYS 142 ? CG ? A LYS 123 CG 42 1 Y 1 A LYS 142 ? CD ? A LYS 123 CD 43 1 Y 1 A LYS 142 ? CE ? A LYS 123 CE 44 1 Y 1 A LYS 142 ? NZ ? A LYS 123 NZ 45 1 Y 1 A ARG 196 ? CG ? A ARG 177 CG 46 1 Y 1 A ARG 196 ? CD ? A ARG 177 CD 47 1 Y 1 A ARG 196 ? NE ? A ARG 177 NE 48 1 Y 1 A ARG 196 ? CZ ? A ARG 177 CZ 49 1 Y 1 A ARG 196 ? NH1 ? A ARG 177 NH1 50 1 Y 1 A ARG 196 ? NH2 ? A ARG 177 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5WE7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.923 _cell.length_a_esd ? _cell.length_b 60.923 _cell.length_b_esd ? _cell.length_c 95.361 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5WE7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WE7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.10 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.8 M Succinic Acid pH 7.0, 1 mM MnCl2, 1 mM MgCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-08-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 43.550 _reflns.entry_id 5WE7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.120 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12164 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.800 _reflns.pdbx_Rmerge_I_obs 0.099 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.379 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.102 _reflns.pdbx_Rpim_I_all 0.023 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 240283 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.120 2.200 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.941 ? ? ? ? ? ? ? ? 12.300 ? 0.541 ? ? 0.978 0.259 ? 1 1 0.813 ? 2.200 2.280 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.721 ? ? ? ? ? ? ? ? 16.300 ? 0.577 ? ? 0.743 0.177 ? 2 1 0.945 ? 2.280 2.390 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.566 ? ? ? ? ? ? ? ? 19.600 ? 0.620 ? ? 0.580 0.129 ? 3 1 0.970 ? 2.390 2.510 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.437 ? ? ? ? ? ? ? ? 21.700 ? 0.669 ? ? 0.447 0.095 ? 4 1 0.982 ? 2.510 2.670 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.308 ? ? ? ? ? ? ? ? 22.000 ? 0.793 ? ? 0.316 0.067 ? 5 1 0.992 ? 2.670 2.880 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.226 ? ? ? ? ? ? ? ? 22.000 ? 0.923 ? ? 0.231 0.049 ? 6 1 0.995 ? 2.880 3.170 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.153 ? ? ? ? ? ? ? ? 21.800 ? 1.309 ? ? 0.157 0.034 ? 7 1 0.996 ? 3.170 3.620 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.106 ? ? ? ? ? ? ? ? 21.400 ? 2.071 ? ? 0.109 0.024 ? 8 1 0.998 ? 3.620 4.570 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 20.700 ? 2.979 ? ? 0.080 0.017 ? 9 1 0.999 ? 4.570 50.000 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 19.500 ? 2.681 ? ? 0.057 0.013 ? 10 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 121.530 _refine.B_iso_mean 57.9610 _refine.B_iso_min 29.390 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5WE7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.12 _refine.ls_d_res_low 35.3750 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12129 _refine.ls_number_reflns_R_free 581 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9400 _refine.ls_percent_reflns_R_free 4.7900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1929 _refine.ls_R_factor_R_free 0.2145 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1918 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.380 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.2900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.12 _refine_hist.d_res_low 35.3750 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 1528 _refine_hist.pdbx_number_residues_total 183 _refine_hist.pdbx_B_iso_mean_ligand 69.40 _refine_hist.pdbx_B_iso_mean_solvent 55.93 _refine_hist.pdbx_number_atoms_protein 1456 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1525 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.546 ? 2061 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.038 ? 220 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 266 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 7.366 ? 920 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1178 2.3309 2966 . 146 2820 100.0000 . . . 0.2626 0.0000 0.2260 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.3309 2.6681 2983 . 133 2850 100.0000 . . . 0.2634 0.0000 0.2178 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.6681 3.3611 3026 . 147 2879 100.0000 . . . 0.2376 0.0000 0.2164 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.3611 35.3802 3154 . 155 2999 100.0000 . . . 0.1906 0.0000 0.1733 . . . . . . 4 . . . # _struct.entry_id 5WE7 _struct.title 'Crystal structure of the influenza virus PA endonuclease in complex with an inhibitor - SRI-29782' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WE7 _struct_keywords.text 'Virus, Nuclease, Transcription, Cap-snatching, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP C3W5S0_I09A0 C3W5S0 ? 1 MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 1 2 UNP C3W5S0_I09A0 C3W5S0 ? 1 ;KHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5WE7 A 1 ? 50 ? C3W5S0 1 ? 50 ? 1 50 2 2 5WE7 A 54 ? 177 ? C3W5S0 73 ? 196 ? 73 196 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5WE7 GLY A 51 ? UNP C3W5S0 ? ? linker 51 1 1 5WE7 GLY A 52 ? UNP C3W5S0 ? ? linker 52 2 1 5WE7 SER A 53 ? UNP C3W5S0 ? ? linker 53 3 2 5WE7 ALA A 178 ? UNP C3W5S0 ? ? 'expression tag' 197 4 2 5WE7 ALA A 179 ? UNP C3W5S0 ? ? 'expression tag' 198 5 2 5WE7 ALA A 180 ? UNP C3W5S0 ? ? 'expression tag' 199 6 2 5WE7 GLU A 181 ? UNP C3W5S0 ? ? 'expression tag' 200 7 2 5WE7 LEU A 182 ? UNP C3W5S0 ? ? 'expression tag' 201 8 2 5WE7 ALA A 183 ? UNP C3W5S0 ? ? 'expression tag' 202 9 2 5WE7 LEU A 184 ? UNP C3W5S0 ? ? 'expression tag' 203 10 2 5WE7 VAL A 185 ? UNP C3W5S0 ? ? 'expression tag' 204 11 2 5WE7 PRO A 186 ? UNP C3W5S0 ? ? 'expression tag' 205 12 2 5WE7 ARG A 187 ? UNP C3W5S0 ? ? 'expression tag' 206 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 380 ? 1 MORE -7 ? 1 'SSA (A^2)' 9730 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Protein elutes as a monomer' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? PHE A 9 ? MET A 1 PHE A 9 1 ? 9 HELX_P HELX_P2 AA2 ASN A 10 ? TYR A 24 ? ASN A 10 TYR A 24 1 ? 15 HELX_P HELX_P3 AA3 GLU A 31 ? GLY A 51 ? GLU A 31 GLY A 51 1 ? 21 HELX_P HELX_P4 AA4 ASP A 64 ? GLY A 80 ? ASP A 83 GLY A 99 1 ? 17 HELX_P HELX_P5 AA5 GLU A 107 ? LYS A 120 ? GLU A 126 LYS A 139 1 ? 14 HELX_P HELX_P6 AA6 LYS A 139 ? ASP A 141 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 145 ? ARG A 166 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 168 ? LEU A 182 ? LEU A 187 LEU A 201 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 41 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 41 A MN 301 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc2 metalc ? ? A GLU 61 OE2 ? ? ? 1_555 C MN . MN ? ? A GLU 80 A MN 302 1_555 ? ? ? ? ? ? ? 2.265 ? ? metalc3 metalc ? ? A ASP 89 OD1 ? ? ? 1_555 B MN . MN ? ? A ASP 108 A MN 301 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc4 metalc ? ? A ASP 89 OD2 ? ? ? 1_555 C MN . MN ? ? A ASP 108 A MN 302 1_555 ? ? ? ? ? ? ? 2.218 ? ? metalc5 metalc ? ? A GLU 100 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 119 A MN 301 1_555 ? ? ? ? ? ? ? 2.242 ? ? metalc6 metalc ? ? A ILE 101 O ? ? ? 1_555 B MN . MN ? ? A ILE 120 A MN 301 1_555 ? ? ? ? ? ? ? 2.160 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 D G3K . O1 ? ? A MN 301 A G3K 303 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 D G3K . O2 ? ? A MN 301 A G3K 303 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc9 metalc ? ? C MN . MN ? ? ? 1_555 D G3K . O2 ? ? A MN 302 A G3K 303 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc10 metalc ? ? C MN . MN ? ? ? 1_555 D G3K . O4 ? ? A MN 302 A G3K 303 1_555 ? ? ? ? ? ? ? 2.128 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 302 A HOH 408 1_555 ? ? ? ? ? ? ? 2.242 ? ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 302 A HOH 409 1_555 ? ? ? ? ? ? ? 2.303 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 107.8 ? 2 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE2 ? A GLU 100 ? A GLU 119 ? 1_555 167.0 ? 3 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE2 ? A GLU 100 ? A GLU 119 ? 1_555 81.2 ? 4 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 101 ? A ILE 120 ? 1_555 85.2 ? 5 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 101 ? A ILE 120 ? 1_555 102.7 ? 6 OE2 ? A GLU 100 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 101 ? A ILE 120 ? 1_555 83.7 ? 7 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O1 ? D G3K . ? A G3K 303 ? 1_555 90.1 ? 8 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O1 ? D G3K . ? A G3K 303 ? 1_555 157.9 ? 9 OE2 ? A GLU 100 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O1 ? D G3K . ? A G3K 303 ? 1_555 83.5 ? 10 O ? A ILE 101 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O1 ? D G3K . ? A G3K 303 ? 1_555 91.3 ? 11 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O2 ? D G3K . ? A G3K 303 ? 1_555 98.2 ? 12 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O2 ? D G3K . ? A G3K 303 ? 1_555 89.8 ? 13 OE2 ? A GLU 100 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O2 ? D G3K . ? A G3K 303 ? 1_555 91.0 ? 14 O ? A ILE 101 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O2 ? D G3K . ? A G3K 303 ? 1_555 165.5 ? 15 O1 ? D G3K . ? A G3K 303 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O2 ? D G3K . ? A G3K 303 ? 1_555 74.6 ? 16 OE2 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 81.9 ? 17 OE2 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O2 ? D G3K . ? A G3K 303 ? 1_555 104.2 ? 18 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O2 ? D G3K . ? A G3K 303 ? 1_555 96.2 ? 19 OE2 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O4 ? D G3K . ? A G3K 303 ? 1_555 89.7 ? 20 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O4 ? D G3K . ? A G3K 303 ? 1_555 166.7 ? 21 O2 ? D G3K . ? A G3K 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O4 ? D G3K . ? A G3K 303 ? 1_555 75.9 ? 22 OE2 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 408 ? 1_555 88.5 ? 23 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 408 ? 1_555 95.2 ? 24 O2 ? D G3K . ? A G3K 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 408 ? 1_555 164.0 ? 25 O4 ? D G3K . ? A G3K 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 408 ? 1_555 94.8 ? 26 OE2 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 409 ? 1_555 169.5 ? 27 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 409 ? 1_555 97.8 ? 28 O2 ? D G3K . ? A G3K 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 409 ? 1_555 86.2 ? 29 O4 ? D G3K . ? A G3K 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 409 ? 1_555 92.3 ? 30 O ? F HOH . ? A HOH 408 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 409 ? 1_555 81.1 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 57 ? ILE A 59 ? PHE A 76 ILE A 78 AA1 2 LEU A 90 ? ASP A 92 ? LEU A 109 ASP A 111 AA1 3 ARG A 97 ? THR A 104 ? ARG A 116 THR A 123 AA1 4 HIS A 125 ? SER A 130 ? HIS A 144 SER A 149 AA1 5 GLU A 135 ? ALA A 137 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 58 ? N GLU A 77 O TYR A 91 ? O TYR A 110 AA1 2 3 N ASP A 92 ? N ASP A 111 O ARG A 97 ? O ARG A 116 AA1 3 4 N GLU A 100 ? N GLU A 119 O HIS A 125 ? O HIS A 144 AA1 4 5 N ILE A 128 ? N ILE A 147 O MET A 136 ? O MET A 155 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 301 ? 6 'binding site for residue MN A 301' AC2 Software A MN 302 ? 6 'binding site for residue MN A 302' AC3 Software A G3K 303 ? 15 'binding site for residue G3K A 303' AC4 Software A MLT 304 ? 7 'binding site for residue MLT A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 41 ? HIS A 41 . ? 1_555 ? 2 AC1 6 ASP A 89 ? ASP A 108 . ? 1_555 ? 3 AC1 6 GLU A 100 ? GLU A 119 . ? 1_555 ? 4 AC1 6 ILE A 101 ? ILE A 120 . ? 1_555 ? 5 AC1 6 MN C . ? MN A 302 . ? 1_555 ? 6 AC1 6 G3K D . ? G3K A 303 . ? 1_555 ? 7 AC2 6 GLU A 61 ? GLU A 80 . ? 1_555 ? 8 AC2 6 ASP A 89 ? ASP A 108 . ? 1_555 ? 9 AC2 6 MN B . ? MN A 301 . ? 1_555 ? 10 AC2 6 G3K D . ? G3K A 303 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 408 . ? 1_555 ? 12 AC2 6 HOH F . ? HOH A 409 . ? 1_555 ? 13 AC3 15 ALA A 37 ? ALA A 37 . ? 1_555 ? 14 AC3 15 HIS A 41 ? HIS A 41 . ? 1_555 ? 15 AC3 15 GLU A 61 ? GLU A 80 . ? 1_555 ? 16 AC3 15 ARG A 65 ? ARG A 84 . ? 1_555 ? 17 AC3 15 ASP A 89 ? ASP A 108 . ? 1_555 ? 18 AC3 15 GLU A 100 ? GLU A 119 . ? 1_555 ? 19 AC3 15 ILE A 101 ? ILE A 120 . ? 1_555 ? 20 AC3 15 ARG A 105 ? ARG A 124 . ? 1_555 ? 21 AC3 15 TYR A 111 ? TYR A 130 . ? 1_555 ? 22 AC3 15 LYS A 115 ? LYS A 134 . ? 1_555 ? 23 AC3 15 MN B . ? MN A 301 . ? 1_555 ? 24 AC3 15 MN C . ? MN A 302 . ? 1_555 ? 25 AC3 15 HOH F . ? HOH A 409 . ? 1_555 ? 26 AC3 15 HOH F . ? HOH A 412 . ? 1_555 ? 27 AC3 15 HOH F . ? HOH A 415 . ? 1_555 ? 28 AC4 7 LYS A 54 ? LYS A 73 . ? 1_555 ? 29 AC4 7 PHE A 57 ? PHE A 76 . ? 1_555 ? 30 AC4 7 GLU A 58 ? GLU A 77 . ? 1_555 ? 31 AC4 7 ARG A 106 ? ARG A 125 . ? 4_655 ? 32 AC4 7 GLU A 107 ? GLU A 126 . ? 4_655 ? 33 AC4 7 ILE A 110 ? ILE A 129 . ? 4_655 ? 34 AC4 7 ARG A 173 ? ARG A 192 . ? 4_655 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 181 ? ? O A HOH 401 ? ? 2.04 2 1 NE A ARG 185 ? ? O A HOH 401 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 107 ? ? -79.17 -169.44 2 1 GLU A 141 ? ? 64.02 148.84 3 1 LYS A 142 ? ? 68.76 -3.57 4 1 THR A 162 ? ? 63.49 -63.85 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 22.5499 _pdbx_refine_tls.origin_y -16.9268 _pdbx_refine_tls.origin_z 0.7082 _pdbx_refine_tls.T[1][1] 0.3912 _pdbx_refine_tls.T[2][2] 0.3182 _pdbx_refine_tls.T[3][3] 0.2992 _pdbx_refine_tls.T[1][2] -0.1346 _pdbx_refine_tls.T[1][3] 0.0011 _pdbx_refine_tls.T[2][3] -0.0258 _pdbx_refine_tls.L[1][1] 3.0299 _pdbx_refine_tls.L[2][2] 4.9048 _pdbx_refine_tls.L[3][3] 3.9434 _pdbx_refine_tls.L[1][2] 0.3266 _pdbx_refine_tls.L[1][3] -0.2632 _pdbx_refine_tls.L[2][3] 1.5943 _pdbx_refine_tls.S[1][1] -0.0947 _pdbx_refine_tls.S[2][2] 0.1587 _pdbx_refine_tls.S[3][3] -0.0527 _pdbx_refine_tls.S[1][2] -0.0667 _pdbx_refine_tls.S[1][3] -0.0246 _pdbx_refine_tls.S[2][3] -0.1385 _pdbx_refine_tls.S[2][1] 0.0906 _pdbx_refine_tls.S[3][1] 0.1449 _pdbx_refine_tls.S[3][2] 0.2487 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 202 all ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 B 201 B 202 all ? ? ? ? ? 'X-RAY DIFFRACTION' 3 1 C 1 C 33 all ? ? ? ? ? 'X-RAY DIFFRACTION' 4 1 D 1 D 1 all ? ? ? ? ? 'X-RAY DIFFRACTION' 5 1 E 1 E 1 all ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 203 ? A LEU 184 2 1 Y 1 A VAL 204 ? A VAL 185 3 1 Y 1 A PRO 205 ? A PRO 186 4 1 Y 1 A ARG 206 ? A ARG 187 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 G3K C1 C N N 88 G3K C10 C N N 89 G3K C11 C N N 90 G3K C12 C N N 91 G3K C13 C N N 92 G3K C14 C Y N 93 G3K C15 C Y N 94 G3K C16 C Y N 95 G3K C17 C Y N 96 G3K C18 C Y N 97 G3K C19 C Y N 98 G3K C2 C N N 99 G3K C3 C N N 100 G3K C4 C N N 101 G3K C5 C N N 102 G3K C6 C N R 103 G3K C7 C N N 104 G3K C8 C N N 105 G3K C9 C N N 106 G3K N1 N N N 107 G3K N2 N N N 108 G3K N3 N N N 109 G3K O1 O N N 110 G3K O2 O N N 111 G3K O3 O N N 112 G3K O4 O N N 113 G3K O5 O N N 114 G3K O6 O N N 115 G3K CL1 CL N N 116 G3K H1 H N N 117 G3K H2 H N N 118 G3K H3 H N N 119 G3K H4 H N N 120 G3K H5 H N N 121 G3K H6 H N N 122 G3K H7 H N N 123 G3K H8 H N N 124 G3K H9 H N N 125 G3K H10 H N N 126 G3K H11 H N N 127 G3K H12 H N N 128 G3K H13 H N N 129 G3K H14 H N N 130 G3K H15 H N N 131 G3K H16 H N N 132 G3K H17 H N N 133 G3K H18 H N N 134 G3K H19 H N N 135 G3K H20 H N N 136 GLN N N N N 137 GLN CA C N S 138 GLN C C N N 139 GLN O O N N 140 GLN CB C N N 141 GLN CG C N N 142 GLN CD C N N 143 GLN OE1 O N N 144 GLN NE2 N N N 145 GLN OXT O N N 146 GLN H H N N 147 GLN H2 H N N 148 GLN HA H N N 149 GLN HB2 H N N 150 GLN HB3 H N N 151 GLN HG2 H N N 152 GLN HG3 H N N 153 GLN HE21 H N N 154 GLN HE22 H N N 155 GLN HXT H N N 156 GLU N N N N 157 GLU CA C N S 158 GLU C C N N 159 GLU O O N N 160 GLU CB C N N 161 GLU CG C N N 162 GLU CD C N N 163 GLU OE1 O N N 164 GLU OE2 O N N 165 GLU OXT O N N 166 GLU H H N N 167 GLU H2 H N N 168 GLU HA H N N 169 GLU HB2 H N N 170 GLU HB3 H N N 171 GLU HG2 H N N 172 GLU HG3 H N N 173 GLU HE2 H N N 174 GLU HXT H N N 175 GLY N N N N 176 GLY CA C N N 177 GLY C C N N 178 GLY O O N N 179 GLY OXT O N N 180 GLY H H N N 181 GLY H2 H N N 182 GLY HA2 H N N 183 GLY HA3 H N N 184 GLY HXT H N N 185 HIS N N N N 186 HIS CA C N S 187 HIS C C N N 188 HIS O O N N 189 HIS CB C N N 190 HIS CG C Y N 191 HIS ND1 N Y N 192 HIS CD2 C Y N 193 HIS CE1 C Y N 194 HIS NE2 N Y N 195 HIS OXT O N N 196 HIS H H N N 197 HIS H2 H N N 198 HIS HA H N N 199 HIS HB2 H N N 200 HIS HB3 H N N 201 HIS HD1 H N N 202 HIS HD2 H N N 203 HIS HE1 H N N 204 HIS HE2 H N N 205 HIS HXT H N N 206 HOH O O N N 207 HOH H1 H N N 208 HOH H2 H N N 209 ILE N N N N 210 ILE CA C N S 211 ILE C C N N 212 ILE O O N N 213 ILE CB C N S 214 ILE CG1 C N N 215 ILE CG2 C N N 216 ILE CD1 C N N 217 ILE OXT O N N 218 ILE H H N N 219 ILE H2 H N N 220 ILE HA H N N 221 ILE HB H N N 222 ILE HG12 H N N 223 ILE HG13 H N N 224 ILE HG21 H N N 225 ILE HG22 H N N 226 ILE HG23 H N N 227 ILE HD11 H N N 228 ILE HD12 H N N 229 ILE HD13 H N N 230 ILE HXT H N N 231 LEU N N N N 232 LEU CA C N S 233 LEU C C N N 234 LEU O O N N 235 LEU CB C N N 236 LEU CG C N N 237 LEU CD1 C N N 238 LEU CD2 C N N 239 LEU OXT O N N 240 LEU H H N N 241 LEU H2 H N N 242 LEU HA H N N 243 LEU HB2 H N N 244 LEU HB3 H N N 245 LEU HG H N N 246 LEU HD11 H N N 247 LEU HD12 H N N 248 LEU HD13 H N N 249 LEU HD21 H N N 250 LEU HD22 H N N 251 LEU HD23 H N N 252 LEU HXT H N N 253 LYS N N N N 254 LYS CA C N S 255 LYS C C N N 256 LYS O O N N 257 LYS CB C N N 258 LYS CG C N N 259 LYS CD C N N 260 LYS CE C N N 261 LYS NZ N N N 262 LYS OXT O N N 263 LYS H H N N 264 LYS H2 H N N 265 LYS HA H N N 266 LYS HB2 H N N 267 LYS HB3 H N N 268 LYS HG2 H N N 269 LYS HG3 H N N 270 LYS HD2 H N N 271 LYS HD3 H N N 272 LYS HE2 H N N 273 LYS HE3 H N N 274 LYS HZ1 H N N 275 LYS HZ2 H N N 276 LYS HZ3 H N N 277 LYS HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 MLT C1 C N N 299 MLT O1 O N N 300 MLT O2 O N N 301 MLT C2 C N R 302 MLT O3 O N N 303 MLT C3 C N N 304 MLT C4 C N N 305 MLT O4 O N N 306 MLT O5 O N N 307 MLT H2 H N N 308 MLT HO3 H N N 309 MLT H31 H N N 310 MLT H32 H N N 311 MLT HO5 H N N 312 MLT H6 H N N 313 MN MN MN N N 314 PHE N N N N 315 PHE CA C N S 316 PHE C C N N 317 PHE O O N N 318 PHE CB C N N 319 PHE CG C Y N 320 PHE CD1 C Y N 321 PHE CD2 C Y N 322 PHE CE1 C Y N 323 PHE CE2 C Y N 324 PHE CZ C Y N 325 PHE OXT O N N 326 PHE H H N N 327 PHE H2 H N N 328 PHE HA H N N 329 PHE HB2 H N N 330 PHE HB3 H N N 331 PHE HD1 H N N 332 PHE HD2 H N N 333 PHE HE1 H N N 334 PHE HE2 H N N 335 PHE HZ H N N 336 PHE HXT H N N 337 PRO N N N N 338 PRO CA C N S 339 PRO C C N N 340 PRO O O N N 341 PRO CB C N N 342 PRO CG C N N 343 PRO CD C N N 344 PRO OXT O N N 345 PRO H H N N 346 PRO HA H N N 347 PRO HB2 H N N 348 PRO HB3 H N N 349 PRO HG2 H N N 350 PRO HG3 H N N 351 PRO HD2 H N N 352 PRO HD3 H N N 353 PRO HXT H N N 354 SER N N N N 355 SER CA C N S 356 SER C C N N 357 SER O O N N 358 SER CB C N N 359 SER OG O N N 360 SER OXT O N N 361 SER H H N N 362 SER H2 H N N 363 SER HA H N N 364 SER HB2 H N N 365 SER HB3 H N N 366 SER HG H N N 367 SER HXT H N N 368 THR N N N N 369 THR CA C N S 370 THR C C N N 371 THR O O N N 372 THR CB C N R 373 THR OG1 O N N 374 THR CG2 C N N 375 THR OXT O N N 376 THR H H N N 377 THR H2 H N N 378 THR HA H N N 379 THR HB H N N 380 THR HG1 H N N 381 THR HG21 H N N 382 THR HG22 H N N 383 THR HG23 H N N 384 THR HXT H N N 385 TRP N N N N 386 TRP CA C N S 387 TRP C C N N 388 TRP O O N N 389 TRP CB C N N 390 TRP CG C Y N 391 TRP CD1 C Y N 392 TRP CD2 C Y N 393 TRP NE1 N Y N 394 TRP CE2 C Y N 395 TRP CE3 C Y N 396 TRP CZ2 C Y N 397 TRP CZ3 C Y N 398 TRP CH2 C Y N 399 TRP OXT O N N 400 TRP H H N N 401 TRP H2 H N N 402 TRP HA H N N 403 TRP HB2 H N N 404 TRP HB3 H N N 405 TRP HD1 H N N 406 TRP HE1 H N N 407 TRP HE3 H N N 408 TRP HZ2 H N N 409 TRP HZ3 H N N 410 TRP HH2 H N N 411 TRP HXT H N N 412 TYR N N N N 413 TYR CA C N S 414 TYR C C N N 415 TYR O O N N 416 TYR CB C N N 417 TYR CG C Y N 418 TYR CD1 C Y N 419 TYR CD2 C Y N 420 TYR CE1 C Y N 421 TYR CE2 C Y N 422 TYR CZ C Y N 423 TYR OH O N N 424 TYR OXT O N N 425 TYR H H N N 426 TYR H2 H N N 427 TYR HA H N N 428 TYR HB2 H N N 429 TYR HB3 H N N 430 TYR HD1 H N N 431 TYR HD2 H N N 432 TYR HE1 H N N 433 TYR HE2 H N N 434 TYR HH H N N 435 TYR HXT H N N 436 VAL N N N N 437 VAL CA C N S 438 VAL C C N N 439 VAL O O N N 440 VAL CB C N N 441 VAL CG1 C N N 442 VAL CG2 C N N 443 VAL OXT O N N 444 VAL H H N N 445 VAL H2 H N N 446 VAL HA H N N 447 VAL HB H N N 448 VAL HG11 H N N 449 VAL HG12 H N N 450 VAL HG13 H N N 451 VAL HG21 H N N 452 VAL HG22 H N N 453 VAL HG23 H N N 454 VAL HXT H N N 455 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 G3K C13 C11 sing N N 83 G3K O1 C1 doub N N 84 G3K C12 C11 sing N N 85 G3K C19 C18 doub Y N 86 G3K C19 C14 sing Y N 87 G3K O5 C11 sing N N 88 G3K O5 C14 sing N N 89 G3K C11 C10 sing N N 90 G3K C18 C17 sing Y N 91 G3K C14 C15 doub Y N 92 G3K C1 N3 sing N N 93 G3K C1 C2 sing N N 94 G3K O2 C2 sing N N 95 G3K N3 C5 sing N N 96 G3K C2 C3 doub N N 97 G3K C10 O6 doub N N 98 G3K C10 N2 sing N N 99 G3K C17 CL1 sing N N 100 G3K C17 C16 doub Y N 101 G3K C9 N2 sing N N 102 G3K C9 C8 sing N N 103 G3K C15 C16 sing Y N 104 G3K N2 C6 sing N N 105 G3K C5 N1 doub N N 106 G3K C5 C6 sing N N 107 G3K C3 N1 sing N N 108 G3K C3 C4 sing N N 109 G3K C8 C7 sing N N 110 G3K O4 C4 doub N N 111 G3K C6 C7 sing N N 112 G3K C4 O3 sing N N 113 G3K C12 H1 sing N N 114 G3K C12 H2 sing N N 115 G3K C12 H3 sing N N 116 G3K C13 H4 sing N N 117 G3K C13 H5 sing N N 118 G3K C13 H6 sing N N 119 G3K C15 H7 sing N N 120 G3K C16 H8 sing N N 121 G3K C18 H9 sing N N 122 G3K C19 H10 sing N N 123 G3K C6 H11 sing N N 124 G3K C7 H12 sing N N 125 G3K C7 H13 sing N N 126 G3K C8 H14 sing N N 127 G3K C8 H15 sing N N 128 G3K C9 H16 sing N N 129 G3K C9 H17 sing N N 130 G3K N3 H18 sing N N 131 G3K O2 H19 sing N N 132 G3K O3 H20 sing N N 133 GLN N CA sing N N 134 GLN N H sing N N 135 GLN N H2 sing N N 136 GLN CA C sing N N 137 GLN CA CB sing N N 138 GLN CA HA sing N N 139 GLN C O doub N N 140 GLN C OXT sing N N 141 GLN CB CG sing N N 142 GLN CB HB2 sing N N 143 GLN CB HB3 sing N N 144 GLN CG CD sing N N 145 GLN CG HG2 sing N N 146 GLN CG HG3 sing N N 147 GLN CD OE1 doub N N 148 GLN CD NE2 sing N N 149 GLN NE2 HE21 sing N N 150 GLN NE2 HE22 sing N N 151 GLN OXT HXT sing N N 152 GLU N CA sing N N 153 GLU N H sing N N 154 GLU N H2 sing N N 155 GLU CA C sing N N 156 GLU CA CB sing N N 157 GLU CA HA sing N N 158 GLU C O doub N N 159 GLU C OXT sing N N 160 GLU CB CG sing N N 161 GLU CB HB2 sing N N 162 GLU CB HB3 sing N N 163 GLU CG CD sing N N 164 GLU CG HG2 sing N N 165 GLU CG HG3 sing N N 166 GLU CD OE1 doub N N 167 GLU CD OE2 sing N N 168 GLU OE2 HE2 sing N N 169 GLU OXT HXT sing N N 170 GLY N CA sing N N 171 GLY N H sing N N 172 GLY N H2 sing N N 173 GLY CA C sing N N 174 GLY CA HA2 sing N N 175 GLY CA HA3 sing N N 176 GLY C O doub N N 177 GLY C OXT sing N N 178 GLY OXT HXT sing N N 179 HIS N CA sing N N 180 HIS N H sing N N 181 HIS N H2 sing N N 182 HIS CA C sing N N 183 HIS CA CB sing N N 184 HIS CA HA sing N N 185 HIS C O doub N N 186 HIS C OXT sing N N 187 HIS CB CG sing N N 188 HIS CB HB2 sing N N 189 HIS CB HB3 sing N N 190 HIS CG ND1 sing Y N 191 HIS CG CD2 doub Y N 192 HIS ND1 CE1 doub Y N 193 HIS ND1 HD1 sing N N 194 HIS CD2 NE2 sing Y N 195 HIS CD2 HD2 sing N N 196 HIS CE1 NE2 sing Y N 197 HIS CE1 HE1 sing N N 198 HIS NE2 HE2 sing N N 199 HIS OXT HXT sing N N 200 HOH O H1 sing N N 201 HOH O H2 sing N N 202 ILE N CA sing N N 203 ILE N H sing N N 204 ILE N H2 sing N N 205 ILE CA C sing N N 206 ILE CA CB sing N N 207 ILE CA HA sing N N 208 ILE C O doub N N 209 ILE C OXT sing N N 210 ILE CB CG1 sing N N 211 ILE CB CG2 sing N N 212 ILE CB HB sing N N 213 ILE CG1 CD1 sing N N 214 ILE CG1 HG12 sing N N 215 ILE CG1 HG13 sing N N 216 ILE CG2 HG21 sing N N 217 ILE CG2 HG22 sing N N 218 ILE CG2 HG23 sing N N 219 ILE CD1 HD11 sing N N 220 ILE CD1 HD12 sing N N 221 ILE CD1 HD13 sing N N 222 ILE OXT HXT sing N N 223 LEU N CA sing N N 224 LEU N H sing N N 225 LEU N H2 sing N N 226 LEU CA C sing N N 227 LEU CA CB sing N N 228 LEU CA HA sing N N 229 LEU C O doub N N 230 LEU C OXT sing N N 231 LEU CB CG sing N N 232 LEU CB HB2 sing N N 233 LEU CB HB3 sing N N 234 LEU CG CD1 sing N N 235 LEU CG CD2 sing N N 236 LEU CG HG sing N N 237 LEU CD1 HD11 sing N N 238 LEU CD1 HD12 sing N N 239 LEU CD1 HD13 sing N N 240 LEU CD2 HD21 sing N N 241 LEU CD2 HD22 sing N N 242 LEU CD2 HD23 sing N N 243 LEU OXT HXT sing N N 244 LYS N CA sing N N 245 LYS N H sing N N 246 LYS N H2 sing N N 247 LYS CA C sing N N 248 LYS CA CB sing N N 249 LYS CA HA sing N N 250 LYS C O doub N N 251 LYS C OXT sing N N 252 LYS CB CG sing N N 253 LYS CB HB2 sing N N 254 LYS CB HB3 sing N N 255 LYS CG CD sing N N 256 LYS CG HG2 sing N N 257 LYS CG HG3 sing N N 258 LYS CD CE sing N N 259 LYS CD HD2 sing N N 260 LYS CD HD3 sing N N 261 LYS CE NZ sing N N 262 LYS CE HE2 sing N N 263 LYS CE HE3 sing N N 264 LYS NZ HZ1 sing N N 265 LYS NZ HZ2 sing N N 266 LYS NZ HZ3 sing N N 267 LYS OXT HXT sing N N 268 MET N CA sing N N 269 MET N H sing N N 270 MET N H2 sing N N 271 MET CA C sing N N 272 MET CA CB sing N N 273 MET CA HA sing N N 274 MET C O doub N N 275 MET C OXT sing N N 276 MET CB CG sing N N 277 MET CB HB2 sing N N 278 MET CB HB3 sing N N 279 MET CG SD sing N N 280 MET CG HG2 sing N N 281 MET CG HG3 sing N N 282 MET SD CE sing N N 283 MET CE HE1 sing N N 284 MET CE HE2 sing N N 285 MET CE HE3 sing N N 286 MET OXT HXT sing N N 287 MLT C1 O1 doub N N 288 MLT C1 O2 sing N N 289 MLT C1 C2 sing N N 290 MLT C2 O3 sing N N 291 MLT C2 C3 sing N N 292 MLT C2 H2 sing N N 293 MLT O3 HO3 sing N N 294 MLT C3 C4 sing N N 295 MLT C3 H31 sing N N 296 MLT C3 H32 sing N N 297 MLT C4 O4 doub N N 298 MLT C4 O5 sing N N 299 MLT O5 HO5 sing N N 300 MLT O2 H6 sing N N 301 PHE N CA sing N N 302 PHE N H sing N N 303 PHE N H2 sing N N 304 PHE CA C sing N N 305 PHE CA CB sing N N 306 PHE CA HA sing N N 307 PHE C O doub N N 308 PHE C OXT sing N N 309 PHE CB CG sing N N 310 PHE CB HB2 sing N N 311 PHE CB HB3 sing N N 312 PHE CG CD1 doub Y N 313 PHE CG CD2 sing Y N 314 PHE CD1 CE1 sing Y N 315 PHE CD1 HD1 sing N N 316 PHE CD2 CE2 doub Y N 317 PHE CD2 HD2 sing N N 318 PHE CE1 CZ doub Y N 319 PHE CE1 HE1 sing N N 320 PHE CE2 CZ sing Y N 321 PHE CE2 HE2 sing N N 322 PHE CZ HZ sing N N 323 PHE OXT HXT sing N N 324 PRO N CA sing N N 325 PRO N CD sing N N 326 PRO N H sing N N 327 PRO CA C sing N N 328 PRO CA CB sing N N 329 PRO CA HA sing N N 330 PRO C O doub N N 331 PRO C OXT sing N N 332 PRO CB CG sing N N 333 PRO CB HB2 sing N N 334 PRO CB HB3 sing N N 335 PRO CG CD sing N N 336 PRO CG HG2 sing N N 337 PRO CG HG3 sing N N 338 PRO CD HD2 sing N N 339 PRO CD HD3 sing N N 340 PRO OXT HXT sing N N 341 SER N CA sing N N 342 SER N H sing N N 343 SER N H2 sing N N 344 SER CA C sing N N 345 SER CA CB sing N N 346 SER CA HA sing N N 347 SER C O doub N N 348 SER C OXT sing N N 349 SER CB OG sing N N 350 SER CB HB2 sing N N 351 SER CB HB3 sing N N 352 SER OG HG sing N N 353 SER OXT HXT sing N N 354 THR N CA sing N N 355 THR N H sing N N 356 THR N H2 sing N N 357 THR CA C sing N N 358 THR CA CB sing N N 359 THR CA HA sing N N 360 THR C O doub N N 361 THR C OXT sing N N 362 THR CB OG1 sing N N 363 THR CB CG2 sing N N 364 THR CB HB sing N N 365 THR OG1 HG1 sing N N 366 THR CG2 HG21 sing N N 367 THR CG2 HG22 sing N N 368 THR CG2 HG23 sing N N 369 THR OXT HXT sing N N 370 TRP N CA sing N N 371 TRP N H sing N N 372 TRP N H2 sing N N 373 TRP CA C sing N N 374 TRP CA CB sing N N 375 TRP CA HA sing N N 376 TRP C O doub N N 377 TRP C OXT sing N N 378 TRP CB CG sing N N 379 TRP CB HB2 sing N N 380 TRP CB HB3 sing N N 381 TRP CG CD1 doub Y N 382 TRP CG CD2 sing Y N 383 TRP CD1 NE1 sing Y N 384 TRP CD1 HD1 sing N N 385 TRP CD2 CE2 doub Y N 386 TRP CD2 CE3 sing Y N 387 TRP NE1 CE2 sing Y N 388 TRP NE1 HE1 sing N N 389 TRP CE2 CZ2 sing Y N 390 TRP CE3 CZ3 doub Y N 391 TRP CE3 HE3 sing N N 392 TRP CZ2 CH2 doub Y N 393 TRP CZ2 HZ2 sing N N 394 TRP CZ3 CH2 sing Y N 395 TRP CZ3 HZ3 sing N N 396 TRP CH2 HH2 sing N N 397 TRP OXT HXT sing N N 398 TYR N CA sing N N 399 TYR N H sing N N 400 TYR N H2 sing N N 401 TYR CA C sing N N 402 TYR CA CB sing N N 403 TYR CA HA sing N N 404 TYR C O doub N N 405 TYR C OXT sing N N 406 TYR CB CG sing N N 407 TYR CB HB2 sing N N 408 TYR CB HB3 sing N N 409 TYR CG CD1 doub Y N 410 TYR CG CD2 sing Y N 411 TYR CD1 CE1 sing Y N 412 TYR CD1 HD1 sing N N 413 TYR CD2 CE2 doub Y N 414 TYR CD2 HD2 sing N N 415 TYR CE1 CZ doub Y N 416 TYR CE1 HE1 sing N N 417 TYR CE2 CZ sing Y N 418 TYR CE2 HE2 sing N N 419 TYR CZ OH sing N N 420 TYR OH HH sing N N 421 TYR OXT HXT sing N N 422 VAL N CA sing N N 423 VAL N H sing N N 424 VAL N H2 sing N N 425 VAL CA C sing N N 426 VAL CA CB sing N N 427 VAL CA HA sing N N 428 VAL C O doub N N 429 VAL C OXT sing N N 430 VAL CB CG1 sing N N 431 VAL CB CG2 sing N N 432 VAL CB HB sing N N 433 VAL CG1 HG11 sing N N 434 VAL CG1 HG12 sing N N 435 VAL CG1 HG13 sing N N 436 VAL CG2 HG21 sing N N 437 VAL CG2 HG22 sing N N 438 VAL CG2 HG23 sing N N 439 VAL OXT HXT sing N N 440 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01AI098757 1 ;St. Jude Children's Research Hospital (ALSAC) ; 'United States' ? 2 ;St. Jude Children's Research Hospital (ALSAC) ; 'United States' ? 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id G3K _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id G3K _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 5WE7 _atom_sites.fract_transf_matrix[1][1] 0.016414 _atom_sites.fract_transf_matrix[1][2] 0.009477 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018953 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010486 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL MN N O S # loop_