data_5WOZ # _entry.id 5WOZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5WOZ WWPDB D_1000228216 BMRB 30327 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of Rtt103 (RTT) protein using two 4D-spectra' _pdbx_database_related.db_id 30327 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5WOZ _pdbx_database_status.recvd_initial_deposition_date 2017-08-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Evangelidis, T.' 1 ? 'Nerli, S.' 2 ? 'Sgourakis, N.G.' 3 ? 'Tripsianes, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 384 _citation.page_last 384 _citation.title 'Automated NMR resonance assignments and structure determination using a minimal set of 4D spectra.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-017-02592-z _citation.pdbx_database_id_PubMed 29374165 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Evangelidis, T.' 1 primary 'Nerli, S.' 2 primary 'Novacek, J.' 3 primary 'Brereton, A.E.' 4 primary 'Karplus, P.A.' 5 primary 'Dotas, R.R.' 6 primary 'Venditti, V.' 7 primary 'Sgourakis, N.G.' 8 primary 'Tripsianes, K.' 9 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Regulator of Ty1 transposition protein 103' _entity.formula_weight 16132.574 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 5-131' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFG KVAAEVLGRINQEFPRDLKKKLSRVVNILKERNIFSKQVVNDIERSLAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;SEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFG KVAAEVLGRINQEFPRDLKKKLSRVVNILKERNIFSKQVVNDIERSLAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 GLN n 1 4 PHE n 1 5 THR n 1 6 THR n 1 7 LYS n 1 8 LEU n 1 9 ASN n 1 10 THR n 1 11 LEU n 1 12 GLU n 1 13 ASP n 1 14 SER n 1 15 GLN n 1 16 GLU n 1 17 SER n 1 18 ILE n 1 19 SER n 1 20 SER n 1 21 ALA n 1 22 SER n 1 23 LYS n 1 24 TRP n 1 25 LEU n 1 26 LEU n 1 27 LEU n 1 28 GLN n 1 29 TYR n 1 30 ARG n 1 31 ASP n 1 32 ALA n 1 33 PRO n 1 34 LYS n 1 35 VAL n 1 36 ALA n 1 37 GLU n 1 38 MET n 1 39 TRP n 1 40 LYS n 1 41 GLU n 1 42 TYR n 1 43 MET n 1 44 LEU n 1 45 ARG n 1 46 PRO n 1 47 SER n 1 48 VAL n 1 49 ASN n 1 50 THR n 1 51 ARG n 1 52 ARG n 1 53 LYS n 1 54 LEU n 1 55 LEU n 1 56 GLY n 1 57 LEU n 1 58 TYR n 1 59 LEU n 1 60 MET n 1 61 ASN n 1 62 HIS n 1 63 VAL n 1 64 VAL n 1 65 GLN n 1 66 GLN n 1 67 ALA n 1 68 LYS n 1 69 GLY n 1 70 GLN n 1 71 LYS n 1 72 ILE n 1 73 ILE n 1 74 GLN n 1 75 PHE n 1 76 GLN n 1 77 ASP n 1 78 SER n 1 79 PHE n 1 80 GLY n 1 81 LYS n 1 82 VAL n 1 83 ALA n 1 84 ALA n 1 85 GLU n 1 86 VAL n 1 87 LEU n 1 88 GLY n 1 89 ARG n 1 90 ILE n 1 91 ASN n 1 92 GLN n 1 93 GLU n 1 94 PHE n 1 95 PRO n 1 96 ARG n 1 97 ASP n 1 98 LEU n 1 99 LYS n 1 100 LYS n 1 101 LYS n 1 102 LEU n 1 103 SER n 1 104 ARG n 1 105 VAL n 1 106 VAL n 1 107 ASN n 1 108 ILE n 1 109 LEU n 1 110 LYS n 1 111 GLU n 1 112 ARG n 1 113 ASN n 1 114 ILE n 1 115 PHE n 1 116 SER n 1 117 LYS n 1 118 GLN n 1 119 VAL n 1 120 VAL n 1 121 ASN n 1 122 ASP n 1 123 ILE n 1 124 GLU n 1 125 ARG n 1 126 SER n 1 127 LEU n 1 128 ALA n 1 129 ALA n 1 130 ALA n 1 131 LEU n 1 132 GLU n 1 133 HIS n 1 134 HIS n 1 135 HIS n 1 136 HIS n 1 137 HIS n 1 138 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 138 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RTT103, YDR289C' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RT103_YEAST _struct_ref.pdbx_db_accession Q05543 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFG KVAAEVLGRINQEFPRDLKKKLSRVVNILKERNIFSKQVVNDIERSL ; _struct_ref.pdbx_align_begin 5 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5WOZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 127 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05543 _struct_ref_seq.db_align_beg 5 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 127 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5WOZ ALA A 128 ? UNP Q05543 ? ? 'expression tag' 128 1 1 5WOZ ALA A 129 ? UNP Q05543 ? ? 'expression tag' 129 2 1 5WOZ ALA A 130 ? UNP Q05543 ? ? 'expression tag' 130 3 1 5WOZ LEU A 131 ? UNP Q05543 ? ? 'expression tag' 131 4 1 5WOZ GLU A 132 ? UNP Q05543 ? ? 'expression tag' 132 5 1 5WOZ HIS A 133 ? UNP Q05543 ? ? 'expression tag' 133 6 1 5WOZ HIS A 134 ? UNP Q05543 ? ? 'expression tag' 134 7 1 5WOZ HIS A 135 ? UNP Q05543 ? ? 'expression tag' 135 8 1 5WOZ HIS A 136 ? UNP Q05543 ? ? 'expression tag' 136 9 1 5WOZ HIS A 137 ? UNP Q05543 ? ? 'expression tag' 137 10 1 5WOZ HIS A 138 ? UNP Q05543 ? ? 'expression tag' 138 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '4D HC(CC TOCSY(CO))NH' 1 isotropic 2 1 1 '4D 13C,15N edited HMQC-NOESY-HSQC' 1 isotropic 3 1 1 '4D 13C,13C edited HMQC-NOESY-HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 35 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8 mM [U-13C; U-15N] Rtt103 (RTT) protein, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AvanceIII _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.details ? _pdbx_nmr_refine.entry_id 5WOZ _pdbx_nmr_refine.method na _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 5WOZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 5WOZ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 4D-CHAINS ? 'Evangelidis and Tripsianes' 2 refinement CS-Rosetta ? 'Shen, Vernon, Baker and Bax' 3 'data analysis' CS-Rosetta ? 'Shen, Vernon, Baker and Bax' 4 'peak picking' SPARKY ? Goddard 5 'structure calculation' CS-Rosetta ? 'Shen, Vernon, Baker and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WOZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5WOZ _struct.title 'NMR solution structure of Rtt103 (RTT) protein using two 4D-spectra' _struct.pdbx_descriptor 'Regulator of Ty1 transposition protein 103' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WOZ _struct_keywords.text 'RNA polymerase II core binder, TRANSCRIPTION REGULATOR' _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? THR A 10 ? SER A 1 THR A 10 1 ? 10 HELX_P HELX_P2 AA2 SER A 14 ? GLN A 28 ? SER A 14 GLN A 28 1 ? 15 HELX_P HELX_P3 AA3 ASP A 31 ? ARG A 45 ? ASP A 31 ARG A 45 1 ? 15 HELX_P HELX_P4 AA4 ASN A 49 ? LYS A 71 ? ASN A 49 LYS A 71 1 ? 23 HELX_P HELX_P5 AA5 ILE A 72 ? PHE A 94 ? ILE A 72 PHE A 94 1 ? 23 HELX_P HELX_P6 AA6 PRO A 95 ? ARG A 112 ? PRO A 95 ARG A 112 1 ? 18 HELX_P HELX_P7 AA7 SER A 116 ? HIS A 133 ? SER A 116 HIS A 133 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5WOZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 HIS 134 134 ? ? ? A . n A 1 135 HIS 135 135 ? ? ? A . n A 1 136 HIS 136 136 ? ? ? A . n A 1 137 HIS 137 137 ? ? ? A . n A 1 138 HIS 138 138 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7940 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2018-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Rtt103 (RTT) protein' _pdbx_nmr_exptl_sample.concentration 0.8 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 2 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 VAL _pdbx_validate_close_contact.auth_seq_id_1 35 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TRP _pdbx_validate_close_contact.auth_seq_id_2 39 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 4 ASP A 31 ? ? -107.96 41.36 2 4 GLU A 132 ? ? -69.57 79.95 3 6 GLN A 28 ? ? -108.75 54.27 4 7 GLN A 28 ? ? -102.92 49.01 5 9 SER A 14 ? ? -171.88 140.06 6 9 GLN A 28 ? ? -103.17 44.88 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 134 ? A HIS 134 2 1 Y 1 A HIS 135 ? A HIS 135 3 1 Y 1 A HIS 136 ? A HIS 136 4 1 Y 1 A HIS 137 ? A HIS 137 5 1 Y 1 A HIS 138 ? A HIS 138 6 2 Y 1 A HIS 134 ? A HIS 134 7 2 Y 1 A HIS 135 ? A HIS 135 8 2 Y 1 A HIS 136 ? A HIS 136 9 2 Y 1 A HIS 137 ? A HIS 137 10 2 Y 1 A HIS 138 ? A HIS 138 11 3 Y 1 A HIS 134 ? A HIS 134 12 3 Y 1 A HIS 135 ? A HIS 135 13 3 Y 1 A HIS 136 ? A HIS 136 14 3 Y 1 A HIS 137 ? A HIS 137 15 3 Y 1 A HIS 138 ? A HIS 138 16 4 Y 1 A HIS 134 ? A HIS 134 17 4 Y 1 A HIS 135 ? A HIS 135 18 4 Y 1 A HIS 136 ? A HIS 136 19 4 Y 1 A HIS 137 ? A HIS 137 20 4 Y 1 A HIS 138 ? A HIS 138 21 5 Y 1 A HIS 134 ? A HIS 134 22 5 Y 1 A HIS 135 ? A HIS 135 23 5 Y 1 A HIS 136 ? A HIS 136 24 5 Y 1 A HIS 137 ? A HIS 137 25 5 Y 1 A HIS 138 ? A HIS 138 26 6 Y 1 A HIS 134 ? A HIS 134 27 6 Y 1 A HIS 135 ? A HIS 135 28 6 Y 1 A HIS 136 ? A HIS 136 29 6 Y 1 A HIS 137 ? A HIS 137 30 6 Y 1 A HIS 138 ? A HIS 138 31 7 Y 1 A HIS 134 ? A HIS 134 32 7 Y 1 A HIS 135 ? A HIS 135 33 7 Y 1 A HIS 136 ? A HIS 136 34 7 Y 1 A HIS 137 ? A HIS 137 35 7 Y 1 A HIS 138 ? A HIS 138 36 8 Y 1 A HIS 134 ? A HIS 134 37 8 Y 1 A HIS 135 ? A HIS 135 38 8 Y 1 A HIS 136 ? A HIS 136 39 8 Y 1 A HIS 137 ? A HIS 137 40 8 Y 1 A HIS 138 ? A HIS 138 41 9 Y 1 A HIS 134 ? A HIS 134 42 9 Y 1 A HIS 135 ? A HIS 135 43 9 Y 1 A HIS 136 ? A HIS 136 44 9 Y 1 A HIS 137 ? A HIS 137 45 9 Y 1 A HIS 138 ? A HIS 138 46 10 Y 1 A HIS 134 ? A HIS 134 47 10 Y 1 A HIS 135 ? A HIS 135 48 10 Y 1 A HIS 136 ? A HIS 136 49 10 Y 1 A HIS 137 ? A HIS 137 50 10 Y 1 A HIS 138 ? A HIS 138 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #