data_5WWX # _entry.id 5WWX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5WWX pdb_00005wwx 10.2210/pdb5wwx/pdb WWPDB D_1300002533 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5WWW unspecified PDB . 5WWZ unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5WWX _pdbx_database_status.recvd_initial_deposition_date 2017-01-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yang, L.' 1 ? 'Wang, C.' 2 ? 'Li, F.' 3 ? 'Gong, Q.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 292 _citation.language ? _citation.page_first 16221 _citation.page_last 16234 _citation.title 'The human RNA-binding protein and E3 ligase MEX-3C binds the MEX-3-recognition element (MRE) motif with high affinity' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M117.797746 _citation.pdbx_database_id_PubMed 28808060 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, L.' 1 ? primary 'Wang, C.' 2 ? primary 'Li, F.' 3 ? primary 'Zhang, J.' 4 ? primary 'Nayab, A.' 5 ? primary 'Wu, J.' 6 ? primary 'Shi, Y.' 7 ? primary 'Gong, Q.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5WWX _cell.details ? _cell.formula_units_Z ? _cell.length_a 74.611 _cell.length_a_esd ? _cell.length_b 74.611 _cell.length_b_esd ? _cell.length_c 32.535 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5WWX _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RNA-binding E3 ubiquitin-protein ligase MEX3C' 9772.222 1 2.3.2.27 ? 'KH2 domain, UNP residues 320-396' ? 2 polymer syn ;RNA (5'-R(P*AP*GP*AP*GP*U)-3') ; 1610.032 1 ? ? ? ? 3 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 4 water nat water 18.015 62 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING finger and KH domain-containing protein 2,RING finger protein 194,RING-type E3 ubiquitin transferase MEX3C' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGHHHHHHMSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMH IAMRTG ; ;MGHHHHHHMSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMH IAMRTG ; A ? 2 polyribonucleotide no no AGAGU AGAGU C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 SER n 1 11 PRO n 1 12 ASN n 1 13 LEU n 1 14 PRO n 1 15 GLY n 1 16 GLN n 1 17 THR n 1 18 THR n 1 19 VAL n 1 20 GLN n 1 21 VAL n 1 22 ARG n 1 23 VAL n 1 24 PRO n 1 25 TYR n 1 26 ARG n 1 27 VAL n 1 28 VAL n 1 29 GLY n 1 30 LEU n 1 31 VAL n 1 32 VAL n 1 33 GLY n 1 34 PRO n 1 35 LYS n 1 36 GLY n 1 37 ALA n 1 38 THR n 1 39 ILE n 1 40 LYS n 1 41 ARG n 1 42 ILE n 1 43 GLN n 1 44 GLN n 1 45 GLN n 1 46 THR n 1 47 HIS n 1 48 THR n 1 49 TYR n 1 50 ILE n 1 51 VAL n 1 52 THR n 1 53 PRO n 1 54 SER n 1 55 ARG n 1 56 ASP n 1 57 LYS n 1 58 GLU n 1 59 PRO n 1 60 VAL n 1 61 PHE n 1 62 GLU n 1 63 VAL n 1 64 THR n 1 65 GLY n 1 66 MET n 1 67 PRO n 1 68 GLU n 1 69 ASN n 1 70 VAL n 1 71 ASP n 1 72 ARG n 1 73 ALA n 1 74 ARG n 1 75 GLU n 1 76 GLU n 1 77 ILE n 1 78 GLU n 1 79 MET n 1 80 HIS n 1 81 ILE n 1 82 ALA n 1 83 MET n 1 84 ARG n 1 85 THR n 1 86 GLY n 2 1 A n 2 2 G n 2 3 A n 2 4 G n 2 5 U n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 86 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MEX3C, RKHD2, RNF194, BM-013' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 5 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MEX3C_HUMAN Q5U5Q3 ? 1 SPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMHIAMRTG 320 2 PDB 5WWX 5WWX ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5WWX A 10 ? 86 ? Q5U5Q3 320 ? 396 ? 320 396 2 2 5WWX C 1 ? 5 ? 5WWX 1 ? 5 ? 1 5 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5WWX MET A 1 ? UNP Q5U5Q3 ? ? 'expression tag' 311 1 1 5WWX GLY A 2 ? UNP Q5U5Q3 ? ? 'expression tag' 312 2 1 5WWX HIS A 3 ? UNP Q5U5Q3 ? ? 'expression tag' 313 3 1 5WWX HIS A 4 ? UNP Q5U5Q3 ? ? 'expression tag' 314 4 1 5WWX HIS A 5 ? UNP Q5U5Q3 ? ? 'expression tag' 315 5 1 5WWX HIS A 6 ? UNP Q5U5Q3 ? ? 'expression tag' 316 6 1 5WWX HIS A 7 ? UNP Q5U5Q3 ? ? 'expression tag' 317 7 1 5WWX HIS A 8 ? UNP Q5U5Q3 ? ? 'expression tag' 318 8 1 5WWX MET A 9 ? UNP Q5U5Q3 ? ? 'expression tag' 319 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WWX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.04M Magnesium acetate tetrahydrate, 0.05M Sodium cacodylate trihydrate pH 6.0, 30% v/v (+/-)-2-Methyl-2,4-pentanediol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-12-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 23.130 _reflns.entry_id 5WWX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.000 _reflns.d_resolution_low 40.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6609 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.600 _reflns.pdbx_Rmerge_I_obs 0.108 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.000 2.070 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.534 ? ? ? ? ? ? ? ? 7.900 ? ? ? ? ? ? ? 1 1 0.904 ? 2.070 2.150 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.346 ? ? ? ? ? ? ? ? 8.000 ? ? ? ? ? ? ? 2 1 0.958 ? 2.150 2.250 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.332 ? ? ? ? ? ? ? ? 7.700 ? ? ? ? ? ? ? 3 1 0.931 ? 2.250 2.370 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.239 ? ? ? ? ? ? ? ? 7.300 ? ? ? ? ? ? ? 4 1 0.969 ? 2.370 2.520 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.205 ? ? ? ? ? ? ? ? 7.500 ? ? ? ? ? ? ? 5 1 0.980 ? 2.520 2.710 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.164 ? ? ? ? ? ? ? ? 8.100 ? ? ? ? ? ? ? 6 1 0.985 ? 2.710 2.990 ? ? ? ? ? ? ? 99.200 ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 7.800 ? ? ? ? ? ? ? 7 1 0.993 ? 2.990 3.420 ? ? ? ? ? ? ? 99.500 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 7.100 ? ? ? ? ? ? ? 8 1 0.995 ? 3.420 4.310 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 7.600 ? ? ? ? ? ? ? 9 1 0.997 ? 4.310 40.000 ? ? ? ? ? ? ? 98.000 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 7.000 ? ? ? ? ? ? ? 10 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 106.810 _refine.B_iso_mean 23.0942 _refine.B_iso_min 8.760 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5WWX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0 _refine.ls_d_res_low 33.3670 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6586 _refine.ls_number_reflns_R_free 337 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6200 _refine.ls_percent_reflns_R_free 5.1200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1724 _refine.ls_R_factor_R_free 0.2180 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1701 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5WWW _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.8500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 33.3670 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 845 _refine_hist.pdbx_number_residues_total 89 _refine_hist.pdbx_B_iso_mean_ligand 25.67 _refine_hist.pdbx_B_iso_mean_solvent 32.70 _refine_hist.pdbx_number_atoms_protein 672 _refine_hist.pdbx_number_atoms_nucleic_acid 110 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 848 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.923 ? 1179 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 133 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 137 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.630 ? 508 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9992 2.5187 3220 . 166 3054 100.0000 . . . 0.2521 0.0000 0.1707 . . . . . . 2 . . . 'X-RAY DIFFRACTION' 2.5187 33.3717 3366 . 171 3195 99.0000 . . . 0.2041 0.0000 0.1698 . . . . . . 2 . . . # _struct.entry_id 5WWX _struct.title 'Crystal structure of the KH2 domain of human RNA-binding E3 ubiquitin-protein ligase MEX-3C complex with RNA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WWX _struct_keywords.text 'KH2, MEX-3C, RNA, RNA BINDING PROTEIN-RNA complex' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN/RNA' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 24 ? ARG A 26 ? PRO A 334 ARG A 336 5 ? 3 HELX_P HELX_P2 AA2 VAL A 27 ? GLY A 33 ? VAL A 337 GLY A 343 1 ? 7 HELX_P HELX_P3 AA3 GLY A 36 ? HIS A 47 ? GLY A 346 HIS A 357 1 ? 12 HELX_P HELX_P4 AA4 MET A 66 ? GLY A 86 ? MET A 376 GLY A 396 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 4 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 314 A NI 401 1_555 ? ? ? ? ? ? ? 1.976 ? ? metalc2 metalc ? ? A HIS 4 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 314 A NI 401 7_555 ? ? ? ? ? ? ? 1.976 ? ? metalc3 metalc ? ? A HIS 6 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 316 A NI 401 1_555 ? ? ? ? ? ? ? 2.072 ? ? metalc4 metalc ? ? A HIS 6 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 316 A NI 401 7_555 ? ? ? ? ? ? ? 2.072 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 17 ? ARG A 22 ? THR A 327 ARG A 332 AA1 2 VAL A 60 ? GLY A 65 ? VAL A 370 GLY A 375 AA1 3 TYR A 49 ? VAL A 51 ? TYR A 359 VAL A 361 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 21 ? N VAL A 331 O PHE A 61 ? O PHE A 371 AA1 2 3 O THR A 64 ? O THR A 374 N TYR A 49 ? N TYR A 359 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NI _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue NI A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 4 ? HIS A 314 . ? 7_555 ? 2 AC1 4 HIS A 4 ? HIS A 314 . ? 1_555 ? 3 AC1 4 HIS A 6 ? HIS A 316 . ? 1_555 ? 4 AC1 4 HIS A 6 ? HIS A 316 . ? 7_555 ? # _atom_sites.entry_id 5WWX _atom_sites.fract_transf_matrix[1][1] 0.013403 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013403 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.030736 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N NI O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 311 ? ? ? A . n A 1 2 GLY 2 312 ? ? ? A . n A 1 3 HIS 3 313 313 HIS HIS A . n A 1 4 HIS 4 314 314 HIS HIS A . n A 1 5 HIS 5 315 315 HIS HIS A . n A 1 6 HIS 6 316 316 HIS HIS A . n A 1 7 HIS 7 317 317 HIS HIS A . n A 1 8 HIS 8 318 318 HIS HIS A . n A 1 9 MET 9 319 319 MET MET A . n A 1 10 SER 10 320 320 SER SER A . n A 1 11 PRO 11 321 321 PRO PRO A . n A 1 12 ASN 12 322 322 ASN ASN A . n A 1 13 LEU 13 323 323 LEU LEU A . n A 1 14 PRO 14 324 324 PRO PRO A . n A 1 15 GLY 15 325 325 GLY GLY A . n A 1 16 GLN 16 326 326 GLN GLN A . n A 1 17 THR 17 327 327 THR THR A . n A 1 18 THR 18 328 328 THR THR A . n A 1 19 VAL 19 329 329 VAL VAL A . n A 1 20 GLN 20 330 330 GLN GLN A . n A 1 21 VAL 21 331 331 VAL VAL A . n A 1 22 ARG 22 332 332 ARG ARG A . n A 1 23 VAL 23 333 333 VAL VAL A . n A 1 24 PRO 24 334 334 PRO PRO A . n A 1 25 TYR 25 335 335 TYR TYR A . n A 1 26 ARG 26 336 336 ARG ARG A . n A 1 27 VAL 27 337 337 VAL VAL A . n A 1 28 VAL 28 338 338 VAL VAL A . n A 1 29 GLY 29 339 339 GLY GLY A . n A 1 30 LEU 30 340 340 LEU LEU A . n A 1 31 VAL 31 341 341 VAL VAL A . n A 1 32 VAL 32 342 342 VAL VAL A . n A 1 33 GLY 33 343 343 GLY GLY A . n A 1 34 PRO 34 344 344 PRO PRO A . n A 1 35 LYS 35 345 345 LYS LYS A . n A 1 36 GLY 36 346 346 GLY GLY A . n A 1 37 ALA 37 347 347 ALA ALA A . n A 1 38 THR 38 348 348 THR THR A . n A 1 39 ILE 39 349 349 ILE ILE A . n A 1 40 LYS 40 350 350 LYS LYS A . n A 1 41 ARG 41 351 351 ARG ARG A . n A 1 42 ILE 42 352 352 ILE ILE A . n A 1 43 GLN 43 353 353 GLN GLN A . n A 1 44 GLN 44 354 354 GLN GLN A . n A 1 45 GLN 45 355 355 GLN GLN A . n A 1 46 THR 46 356 356 THR THR A . n A 1 47 HIS 47 357 357 HIS HIS A . n A 1 48 THR 48 358 358 THR THR A . n A 1 49 TYR 49 359 359 TYR TYR A . n A 1 50 ILE 50 360 360 ILE ILE A . n A 1 51 VAL 51 361 361 VAL VAL A . n A 1 52 THR 52 362 362 THR THR A . n A 1 53 PRO 53 363 363 PRO PRO A . n A 1 54 SER 54 364 364 SER SER A . n A 1 55 ARG 55 365 365 ARG ARG A . n A 1 56 ASP 56 366 366 ASP ASP A . n A 1 57 LYS 57 367 367 LYS LYS A . n A 1 58 GLU 58 368 368 GLU GLU A . n A 1 59 PRO 59 369 369 PRO PRO A . n A 1 60 VAL 60 370 370 VAL VAL A . n A 1 61 PHE 61 371 371 PHE PHE A . n A 1 62 GLU 62 372 372 GLU GLU A . n A 1 63 VAL 63 373 373 VAL VAL A . n A 1 64 THR 64 374 374 THR THR A . n A 1 65 GLY 65 375 375 GLY GLY A . n A 1 66 MET 66 376 376 MET MET A . n A 1 67 PRO 67 377 377 PRO PRO A . n A 1 68 GLU 68 378 378 GLU GLU A . n A 1 69 ASN 69 379 379 ASN ASN A . n A 1 70 VAL 70 380 380 VAL VAL A . n A 1 71 ASP 71 381 381 ASP ASP A . n A 1 72 ARG 72 382 382 ARG ARG A . n A 1 73 ALA 73 383 383 ALA ALA A . n A 1 74 ARG 74 384 384 ARG ARG A . n A 1 75 GLU 75 385 385 GLU GLU A . n A 1 76 GLU 76 386 386 GLU GLU A . n A 1 77 ILE 77 387 387 ILE ILE A . n A 1 78 GLU 78 388 388 GLU GLU A . n A 1 79 MET 79 389 389 MET MET A . n A 1 80 HIS 80 390 390 HIS HIS A . n A 1 81 ILE 81 391 391 ILE ILE A . n A 1 82 ALA 82 392 392 ALA ALA A . n A 1 83 MET 83 393 393 MET MET A . n A 1 84 ARG 84 394 394 ARG ARG A . n A 1 85 THR 85 395 395 THR THR A . n A 1 86 GLY 86 396 396 GLY GLY A . n B 2 1 A 1 1 1 A A C . n B 2 2 G 2 2 2 G G C . n B 2 3 A 3 3 3 A A C . n B 2 4 G 4 4 4 G G C . n B 2 5 U 5 5 5 U U C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NI 1 401 1 NI NI A . D 4 HOH 1 501 33 HOH HOH A . D 4 HOH 2 502 43 HOH HOH A . D 4 HOH 3 503 12 HOH HOH A . D 4 HOH 4 504 7 HOH HOH A . D 4 HOH 5 505 58 HOH HOH A . D 4 HOH 6 506 5 HOH HOH A . D 4 HOH 7 507 1 HOH HOH A . D 4 HOH 8 508 32 HOH HOH A . D 4 HOH 9 509 57 HOH HOH A . D 4 HOH 10 510 55 HOH HOH A . D 4 HOH 11 511 35 HOH HOH A . D 4 HOH 12 512 6 HOH HOH A . D 4 HOH 13 513 39 HOH HOH A . D 4 HOH 14 514 28 HOH HOH A . D 4 HOH 15 515 10 HOH HOH A . D 4 HOH 16 516 17 HOH HOH A . D 4 HOH 17 517 2 HOH HOH A . D 4 HOH 18 518 42 HOH HOH A . D 4 HOH 19 519 3 HOH HOH A . D 4 HOH 20 520 18 HOH HOH A . D 4 HOH 21 521 11 HOH HOH A . D 4 HOH 22 522 26 HOH HOH A . D 4 HOH 23 523 40 HOH HOH A . D 4 HOH 24 524 30 HOH HOH A . D 4 HOH 25 525 8 HOH HOH A . D 4 HOH 26 526 31 HOH HOH A . D 4 HOH 27 527 44 HOH HOH A . D 4 HOH 28 528 41 HOH HOH A . D 4 HOH 29 529 29 HOH HOH A . D 4 HOH 30 530 19 HOH HOH A . D 4 HOH 31 531 53 HOH HOH A . D 4 HOH 32 532 54 HOH HOH A . D 4 HOH 33 533 20 HOH HOH A . D 4 HOH 34 534 52 HOH HOH A . D 4 HOH 35 535 56 HOH HOH A . D 4 HOH 36 536 60 HOH HOH A . D 4 HOH 37 537 59 HOH HOH A . D 4 HOH 38 538 50 HOH HOH A . D 4 HOH 39 539 34 HOH HOH A . D 4 HOH 40 540 45 HOH HOH A . D 4 HOH 41 541 61 HOH HOH A . D 4 HOH 42 542 62 HOH HOH A . D 4 HOH 43 543 49 HOH HOH A . D 4 HOH 44 544 36 HOH HOH A . D 4 HOH 45 545 25 HOH HOH A . D 4 HOH 46 546 37 HOH HOH A . D 4 HOH 47 547 47 HOH HOH A . D 4 HOH 48 548 27 HOH HOH A . D 4 HOH 49 549 38 HOH HOH A . E 4 HOH 1 101 51 HOH HOH C . E 4 HOH 2 102 9 HOH HOH C . E 4 HOH 3 103 15 HOH HOH C . E 4 HOH 4 104 13 HOH HOH C . E 4 HOH 5 105 46 HOH HOH C . E 4 HOH 6 106 22 HOH HOH C . E 4 HOH 7 107 16 HOH HOH C . E 4 HOH 8 108 24 HOH HOH C . E 4 HOH 9 109 21 HOH HOH C . E 4 HOH 10 110 23 HOH HOH C . E 4 HOH 11 111 14 HOH HOH C . E 4 HOH 12 112 4 HOH HOH C . E 4 HOH 13 113 48 HOH HOH C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1360 ? 1 MORE 0 ? 1 'SSA (A^2)' 6710 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A NI 401 ? C NI . 2 1 A HOH 548 ? D HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 4 ? A HIS 314 ? 1_555 NI ? C NI . ? A NI 401 ? 1_555 NE2 ? A HIS 4 ? A HIS 314 ? 1_555 0.0 ? 2 NE2 ? A HIS 4 ? A HIS 314 ? 1_555 NI ? C NI . ? A NI 401 ? 1_555 NE2 ? A HIS 6 ? A HIS 316 ? 1_555 102.5 ? 3 NE2 ? A HIS 4 ? A HIS 314 ? 1_555 NI ? C NI . ? A NI 401 ? 1_555 NE2 ? A HIS 6 ? A HIS 316 ? 1_555 102.5 ? 4 NE2 ? A HIS 4 ? A HIS 314 ? 1_555 NI ? C NI . ? A NI 401 ? 1_555 NE2 ? A HIS 6 ? A HIS 316 ? 1_555 102.5 ? 5 NE2 ? A HIS 4 ? A HIS 314 ? 1_555 NI ? C NI . ? A NI 401 ? 1_555 NE2 ? A HIS 6 ? A HIS 316 ? 1_555 102.5 ? 6 NE2 ? A HIS 6 ? A HIS 316 ? 1_555 NI ? C NI . ? A NI 401 ? 1_555 NE2 ? A HIS 6 ? A HIS 316 ? 1_555 0.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-23 2 'Structure model' 1 1 2017-08-30 3 'Structure model' 1 2 2017-10-11 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' refine 2 3 'Structure model' citation 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_refine.pdbx_starting_model' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.value' 12 4 'Structure model' '_struct_conn.pdbx_dist_value' 13 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 15 4 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10_2155 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL ? ? ? . 7 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 505 ? ? 1_555 O A HOH 505 ? ? 8_666 2.10 2 1 O A HOH 515 ? ? 1_555 O C HOH 113 ? ? 1_556 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 366 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -104.69 _pdbx_validate_torsion.psi 40.55 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 311 ? A MET 1 2 1 Y 1 A GLY 312 ? A GLY 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A OP3 O N N 1 A P P N N 2 A OP1 O N N 3 A OP2 O N N 4 A "O5'" O N N 5 A "C5'" C N N 6 A "C4'" C N R 7 A "O4'" O N N 8 A "C3'" C N S 9 A "O3'" O N N 10 A "C2'" C N R 11 A "O2'" O N N 12 A "C1'" C N R 13 A N9 N Y N 14 A C8 C Y N 15 A N7 N Y N 16 A C5 C Y N 17 A C6 C Y N 18 A N6 N N N 19 A N1 N Y N 20 A C2 C Y N 21 A N3 N Y N 22 A C4 C Y N 23 A HOP3 H N N 24 A HOP2 H N N 25 A "H5'" H N N 26 A "H5''" H N N 27 A "H4'" H N N 28 A "H3'" H N N 29 A "HO3'" H N N 30 A "H2'" H N N 31 A "HO2'" H N N 32 A "H1'" H N N 33 A H8 H N N 34 A H61 H N N 35 A H62 H N N 36 A H2 H N N 37 ALA N N N N 38 ALA CA C N S 39 ALA C C N N 40 ALA O O N N 41 ALA CB C N N 42 ALA OXT O N N 43 ALA H H N N 44 ALA H2 H N N 45 ALA HA H N N 46 ALA HB1 H N N 47 ALA HB2 H N N 48 ALA HB3 H N N 49 ALA HXT H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 G OP3 O N N 111 G P P N N 112 G OP1 O N N 113 G OP2 O N N 114 G "O5'" O N N 115 G "C5'" C N N 116 G "C4'" C N R 117 G "O4'" O N N 118 G "C3'" C N S 119 G "O3'" O N N 120 G "C2'" C N R 121 G "O2'" O N N 122 G "C1'" C N R 123 G N9 N Y N 124 G C8 C Y N 125 G N7 N Y N 126 G C5 C Y N 127 G C6 C N N 128 G O6 O N N 129 G N1 N N N 130 G C2 C N N 131 G N2 N N N 132 G N3 N N N 133 G C4 C Y N 134 G HOP3 H N N 135 G HOP2 H N N 136 G "H5'" H N N 137 G "H5''" H N N 138 G "H4'" H N N 139 G "H3'" H N N 140 G "HO3'" H N N 141 G "H2'" H N N 142 G "HO2'" H N N 143 G "H1'" H N N 144 G H8 H N N 145 G H1 H N N 146 G H21 H N N 147 G H22 H N N 148 GLN N N N N 149 GLN CA C N S 150 GLN C C N N 151 GLN O O N N 152 GLN CB C N N 153 GLN CG C N N 154 GLN CD C N N 155 GLN OE1 O N N 156 GLN NE2 N N N 157 GLN OXT O N N 158 GLN H H N N 159 GLN H2 H N N 160 GLN HA H N N 161 GLN HB2 H N N 162 GLN HB3 H N N 163 GLN HG2 H N N 164 GLN HG3 H N N 165 GLN HE21 H N N 166 GLN HE22 H N N 167 GLN HXT H N N 168 GLU N N N N 169 GLU CA C N S 170 GLU C C N N 171 GLU O O N N 172 GLU CB C N N 173 GLU CG C N N 174 GLU CD C N N 175 GLU OE1 O N N 176 GLU OE2 O N N 177 GLU OXT O N N 178 GLU H H N N 179 GLU H2 H N N 180 GLU HA H N N 181 GLU HB2 H N N 182 GLU HB3 H N N 183 GLU HG2 H N N 184 GLU HG3 H N N 185 GLU HE2 H N N 186 GLU HXT H N N 187 GLY N N N N 188 GLY CA C N N 189 GLY C C N N 190 GLY O O N N 191 GLY OXT O N N 192 GLY H H N N 193 GLY H2 H N N 194 GLY HA2 H N N 195 GLY HA3 H N N 196 GLY HXT H N N 197 HIS N N N N 198 HIS CA C N S 199 HIS C C N N 200 HIS O O N N 201 HIS CB C N N 202 HIS CG C Y N 203 HIS ND1 N Y N 204 HIS CD2 C Y N 205 HIS CE1 C Y N 206 HIS NE2 N Y N 207 HIS OXT O N N 208 HIS H H N N 209 HIS H2 H N N 210 HIS HA H N N 211 HIS HB2 H N N 212 HIS HB3 H N N 213 HIS HD1 H N N 214 HIS HD2 H N N 215 HIS HE1 H N N 216 HIS HE2 H N N 217 HIS HXT H N N 218 HOH O O N N 219 HOH H1 H N N 220 HOH H2 H N N 221 ILE N N N N 222 ILE CA C N S 223 ILE C C N N 224 ILE O O N N 225 ILE CB C N S 226 ILE CG1 C N N 227 ILE CG2 C N N 228 ILE CD1 C N N 229 ILE OXT O N N 230 ILE H H N N 231 ILE H2 H N N 232 ILE HA H N N 233 ILE HB H N N 234 ILE HG12 H N N 235 ILE HG13 H N N 236 ILE HG21 H N N 237 ILE HG22 H N N 238 ILE HG23 H N N 239 ILE HD11 H N N 240 ILE HD12 H N N 241 ILE HD13 H N N 242 ILE HXT H N N 243 LEU N N N N 244 LEU CA C N S 245 LEU C C N N 246 LEU O O N N 247 LEU CB C N N 248 LEU CG C N N 249 LEU CD1 C N N 250 LEU CD2 C N N 251 LEU OXT O N N 252 LEU H H N N 253 LEU H2 H N N 254 LEU HA H N N 255 LEU HB2 H N N 256 LEU HB3 H N N 257 LEU HG H N N 258 LEU HD11 H N N 259 LEU HD12 H N N 260 LEU HD13 H N N 261 LEU HD21 H N N 262 LEU HD22 H N N 263 LEU HD23 H N N 264 LEU HXT H N N 265 LYS N N N N 266 LYS CA C N S 267 LYS C C N N 268 LYS O O N N 269 LYS CB C N N 270 LYS CG C N N 271 LYS CD C N N 272 LYS CE C N N 273 LYS NZ N N N 274 LYS OXT O N N 275 LYS H H N N 276 LYS H2 H N N 277 LYS HA H N N 278 LYS HB2 H N N 279 LYS HB3 H N N 280 LYS HG2 H N N 281 LYS HG3 H N N 282 LYS HD2 H N N 283 LYS HD3 H N N 284 LYS HE2 H N N 285 LYS HE3 H N N 286 LYS HZ1 H N N 287 LYS HZ2 H N N 288 LYS HZ3 H N N 289 LYS HXT H N N 290 MET N N N N 291 MET CA C N S 292 MET C C N N 293 MET O O N N 294 MET CB C N N 295 MET CG C N N 296 MET SD S N N 297 MET CE C N N 298 MET OXT O N N 299 MET H H N N 300 MET H2 H N N 301 MET HA H N N 302 MET HB2 H N N 303 MET HB3 H N N 304 MET HG2 H N N 305 MET HG3 H N N 306 MET HE1 H N N 307 MET HE2 H N N 308 MET HE3 H N N 309 MET HXT H N N 310 NI NI NI N N 311 PHE N N N N 312 PHE CA C N S 313 PHE C C N N 314 PHE O O N N 315 PHE CB C N N 316 PHE CG C Y N 317 PHE CD1 C Y N 318 PHE CD2 C Y N 319 PHE CE1 C Y N 320 PHE CE2 C Y N 321 PHE CZ C Y N 322 PHE OXT O N N 323 PHE H H N N 324 PHE H2 H N N 325 PHE HA H N N 326 PHE HB2 H N N 327 PHE HB3 H N N 328 PHE HD1 H N N 329 PHE HD2 H N N 330 PHE HE1 H N N 331 PHE HE2 H N N 332 PHE HZ H N N 333 PHE HXT H N N 334 PRO N N N N 335 PRO CA C N S 336 PRO C C N N 337 PRO O O N N 338 PRO CB C N N 339 PRO CG C N N 340 PRO CD C N N 341 PRO OXT O N N 342 PRO H H N N 343 PRO HA H N N 344 PRO HB2 H N N 345 PRO HB3 H N N 346 PRO HG2 H N N 347 PRO HG3 H N N 348 PRO HD2 H N N 349 PRO HD3 H N N 350 PRO HXT H N N 351 SER N N N N 352 SER CA C N S 353 SER C C N N 354 SER O O N N 355 SER CB C N N 356 SER OG O N N 357 SER OXT O N N 358 SER H H N N 359 SER H2 H N N 360 SER HA H N N 361 SER HB2 H N N 362 SER HB3 H N N 363 SER HG H N N 364 SER HXT H N N 365 THR N N N N 366 THR CA C N S 367 THR C C N N 368 THR O O N N 369 THR CB C N R 370 THR OG1 O N N 371 THR CG2 C N N 372 THR OXT O N N 373 THR H H N N 374 THR H2 H N N 375 THR HA H N N 376 THR HB H N N 377 THR HG1 H N N 378 THR HG21 H N N 379 THR HG22 H N N 380 THR HG23 H N N 381 THR HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 U OP3 O N N 407 U P P N N 408 U OP1 O N N 409 U OP2 O N N 410 U "O5'" O N N 411 U "C5'" C N N 412 U "C4'" C N R 413 U "O4'" O N N 414 U "C3'" C N S 415 U "O3'" O N N 416 U "C2'" C N R 417 U "O2'" O N N 418 U "C1'" C N R 419 U N1 N N N 420 U C2 C N N 421 U O2 O N N 422 U N3 N N N 423 U C4 C N N 424 U O4 O N N 425 U C5 C N N 426 U C6 C N N 427 U HOP3 H N N 428 U HOP2 H N N 429 U "H5'" H N N 430 U "H5''" H N N 431 U "H4'" H N N 432 U "H3'" H N N 433 U "HO3'" H N N 434 U "H2'" H N N 435 U "HO2'" H N N 436 U "H1'" H N N 437 U H3 H N N 438 U H5 H N N 439 U H6 H N N 440 VAL N N N N 441 VAL CA C N S 442 VAL C C N N 443 VAL O O N N 444 VAL CB C N N 445 VAL CG1 C N N 446 VAL CG2 C N N 447 VAL OXT O N N 448 VAL H H N N 449 VAL H2 H N N 450 VAL HA H N N 451 VAL HB H N N 452 VAL HG11 H N N 453 VAL HG12 H N N 454 VAL HG13 H N N 455 VAL HG21 H N N 456 VAL HG22 H N N 457 VAL HG23 H N N 458 VAL HXT H N N 459 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A OP3 P sing N N 1 A OP3 HOP3 sing N N 2 A P OP1 doub N N 3 A P OP2 sing N N 4 A P "O5'" sing N N 5 A OP2 HOP2 sing N N 6 A "O5'" "C5'" sing N N 7 A "C5'" "C4'" sing N N 8 A "C5'" "H5'" sing N N 9 A "C5'" "H5''" sing N N 10 A "C4'" "O4'" sing N N 11 A "C4'" "C3'" sing N N 12 A "C4'" "H4'" sing N N 13 A "O4'" "C1'" sing N N 14 A "C3'" "O3'" sing N N 15 A "C3'" "C2'" sing N N 16 A "C3'" "H3'" sing N N 17 A "O3'" "HO3'" sing N N 18 A "C2'" "O2'" sing N N 19 A "C2'" "C1'" sing N N 20 A "C2'" "H2'" sing N N 21 A "O2'" "HO2'" sing N N 22 A "C1'" N9 sing N N 23 A "C1'" "H1'" sing N N 24 A N9 C8 sing Y N 25 A N9 C4 sing Y N 26 A C8 N7 doub Y N 27 A C8 H8 sing N N 28 A N7 C5 sing Y N 29 A C5 C6 sing Y N 30 A C5 C4 doub Y N 31 A C6 N6 sing N N 32 A C6 N1 doub Y N 33 A N6 H61 sing N N 34 A N6 H62 sing N N 35 A N1 C2 sing Y N 36 A C2 N3 doub Y N 37 A C2 H2 sing N N 38 A N3 C4 sing Y N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 G OP3 P sing N N 109 G OP3 HOP3 sing N N 110 G P OP1 doub N N 111 G P OP2 sing N N 112 G P "O5'" sing N N 113 G OP2 HOP2 sing N N 114 G "O5'" "C5'" sing N N 115 G "C5'" "C4'" sing N N 116 G "C5'" "H5'" sing N N 117 G "C5'" "H5''" sing N N 118 G "C4'" "O4'" sing N N 119 G "C4'" "C3'" sing N N 120 G "C4'" "H4'" sing N N 121 G "O4'" "C1'" sing N N 122 G "C3'" "O3'" sing N N 123 G "C3'" "C2'" sing N N 124 G "C3'" "H3'" sing N N 125 G "O3'" "HO3'" sing N N 126 G "C2'" "O2'" sing N N 127 G "C2'" "C1'" sing N N 128 G "C2'" "H2'" sing N N 129 G "O2'" "HO2'" sing N N 130 G "C1'" N9 sing N N 131 G "C1'" "H1'" sing N N 132 G N9 C8 sing Y N 133 G N9 C4 sing Y N 134 G C8 N7 doub Y N 135 G C8 H8 sing N N 136 G N7 C5 sing Y N 137 G C5 C6 sing N N 138 G C5 C4 doub Y N 139 G C6 O6 doub N N 140 G C6 N1 sing N N 141 G N1 C2 sing N N 142 G N1 H1 sing N N 143 G C2 N2 sing N N 144 G C2 N3 doub N N 145 G N2 H21 sing N N 146 G N2 H22 sing N N 147 G N3 C4 sing N N 148 GLN N CA sing N N 149 GLN N H sing N N 150 GLN N H2 sing N N 151 GLN CA C sing N N 152 GLN CA CB sing N N 153 GLN CA HA sing N N 154 GLN C O doub N N 155 GLN C OXT sing N N 156 GLN CB CG sing N N 157 GLN CB HB2 sing N N 158 GLN CB HB3 sing N N 159 GLN CG CD sing N N 160 GLN CG HG2 sing N N 161 GLN CG HG3 sing N N 162 GLN CD OE1 doub N N 163 GLN CD NE2 sing N N 164 GLN NE2 HE21 sing N N 165 GLN NE2 HE22 sing N N 166 GLN OXT HXT sing N N 167 GLU N CA sing N N 168 GLU N H sing N N 169 GLU N H2 sing N N 170 GLU CA C sing N N 171 GLU CA CB sing N N 172 GLU CA HA sing N N 173 GLU C O doub N N 174 GLU C OXT sing N N 175 GLU CB CG sing N N 176 GLU CB HB2 sing N N 177 GLU CB HB3 sing N N 178 GLU CG CD sing N N 179 GLU CG HG2 sing N N 180 GLU CG HG3 sing N N 181 GLU CD OE1 doub N N 182 GLU CD OE2 sing N N 183 GLU OE2 HE2 sing N N 184 GLU OXT HXT sing N N 185 GLY N CA sing N N 186 GLY N H sing N N 187 GLY N H2 sing N N 188 GLY CA C sing N N 189 GLY CA HA2 sing N N 190 GLY CA HA3 sing N N 191 GLY C O doub N N 192 GLY C OXT sing N N 193 GLY OXT HXT sing N N 194 HIS N CA sing N N 195 HIS N H sing N N 196 HIS N H2 sing N N 197 HIS CA C sing N N 198 HIS CA CB sing N N 199 HIS CA HA sing N N 200 HIS C O doub N N 201 HIS C OXT sing N N 202 HIS CB CG sing N N 203 HIS CB HB2 sing N N 204 HIS CB HB3 sing N N 205 HIS CG ND1 sing Y N 206 HIS CG CD2 doub Y N 207 HIS ND1 CE1 doub Y N 208 HIS ND1 HD1 sing N N 209 HIS CD2 NE2 sing Y N 210 HIS CD2 HD2 sing N N 211 HIS CE1 NE2 sing Y N 212 HIS CE1 HE1 sing N N 213 HIS NE2 HE2 sing N N 214 HIS OXT HXT sing N N 215 HOH O H1 sing N N 216 HOH O H2 sing N N 217 ILE N CA sing N N 218 ILE N H sing N N 219 ILE N H2 sing N N 220 ILE CA C sing N N 221 ILE CA CB sing N N 222 ILE CA HA sing N N 223 ILE C O doub N N 224 ILE C OXT sing N N 225 ILE CB CG1 sing N N 226 ILE CB CG2 sing N N 227 ILE CB HB sing N N 228 ILE CG1 CD1 sing N N 229 ILE CG1 HG12 sing N N 230 ILE CG1 HG13 sing N N 231 ILE CG2 HG21 sing N N 232 ILE CG2 HG22 sing N N 233 ILE CG2 HG23 sing N N 234 ILE CD1 HD11 sing N N 235 ILE CD1 HD12 sing N N 236 ILE CD1 HD13 sing N N 237 ILE OXT HXT sing N N 238 LEU N CA sing N N 239 LEU N H sing N N 240 LEU N H2 sing N N 241 LEU CA C sing N N 242 LEU CA CB sing N N 243 LEU CA HA sing N N 244 LEU C O doub N N 245 LEU C OXT sing N N 246 LEU CB CG sing N N 247 LEU CB HB2 sing N N 248 LEU CB HB3 sing N N 249 LEU CG CD1 sing N N 250 LEU CG CD2 sing N N 251 LEU CG HG sing N N 252 LEU CD1 HD11 sing N N 253 LEU CD1 HD12 sing N N 254 LEU CD1 HD13 sing N N 255 LEU CD2 HD21 sing N N 256 LEU CD2 HD22 sing N N 257 LEU CD2 HD23 sing N N 258 LEU OXT HXT sing N N 259 LYS N CA sing N N 260 LYS N H sing N N 261 LYS N H2 sing N N 262 LYS CA C sing N N 263 LYS CA CB sing N N 264 LYS CA HA sing N N 265 LYS C O doub N N 266 LYS C OXT sing N N 267 LYS CB CG sing N N 268 LYS CB HB2 sing N N 269 LYS CB HB3 sing N N 270 LYS CG CD sing N N 271 LYS CG HG2 sing N N 272 LYS CG HG3 sing N N 273 LYS CD CE sing N N 274 LYS CD HD2 sing N N 275 LYS CD HD3 sing N N 276 LYS CE NZ sing N N 277 LYS CE HE2 sing N N 278 LYS CE HE3 sing N N 279 LYS NZ HZ1 sing N N 280 LYS NZ HZ2 sing N N 281 LYS NZ HZ3 sing N N 282 LYS OXT HXT sing N N 283 MET N CA sing N N 284 MET N H sing N N 285 MET N H2 sing N N 286 MET CA C sing N N 287 MET CA CB sing N N 288 MET CA HA sing N N 289 MET C O doub N N 290 MET C OXT sing N N 291 MET CB CG sing N N 292 MET CB HB2 sing N N 293 MET CB HB3 sing N N 294 MET CG SD sing N N 295 MET CG HG2 sing N N 296 MET CG HG3 sing N N 297 MET SD CE sing N N 298 MET CE HE1 sing N N 299 MET CE HE2 sing N N 300 MET CE HE3 sing N N 301 MET OXT HXT sing N N 302 PHE N CA sing N N 303 PHE N H sing N N 304 PHE N H2 sing N N 305 PHE CA C sing N N 306 PHE CA CB sing N N 307 PHE CA HA sing N N 308 PHE C O doub N N 309 PHE C OXT sing N N 310 PHE CB CG sing N N 311 PHE CB HB2 sing N N 312 PHE CB HB3 sing N N 313 PHE CG CD1 doub Y N 314 PHE CG CD2 sing Y N 315 PHE CD1 CE1 sing Y N 316 PHE CD1 HD1 sing N N 317 PHE CD2 CE2 doub Y N 318 PHE CD2 HD2 sing N N 319 PHE CE1 CZ doub Y N 320 PHE CE1 HE1 sing N N 321 PHE CE2 CZ sing Y N 322 PHE CE2 HE2 sing N N 323 PHE CZ HZ sing N N 324 PHE OXT HXT sing N N 325 PRO N CA sing N N 326 PRO N CD sing N N 327 PRO N H sing N N 328 PRO CA C sing N N 329 PRO CA CB sing N N 330 PRO CA HA sing N N 331 PRO C O doub N N 332 PRO C OXT sing N N 333 PRO CB CG sing N N 334 PRO CB HB2 sing N N 335 PRO CB HB3 sing N N 336 PRO CG CD sing N N 337 PRO CG HG2 sing N N 338 PRO CG HG3 sing N N 339 PRO CD HD2 sing N N 340 PRO CD HD3 sing N N 341 PRO OXT HXT sing N N 342 SER N CA sing N N 343 SER N H sing N N 344 SER N H2 sing N N 345 SER CA C sing N N 346 SER CA CB sing N N 347 SER CA HA sing N N 348 SER C O doub N N 349 SER C OXT sing N N 350 SER CB OG sing N N 351 SER CB HB2 sing N N 352 SER CB HB3 sing N N 353 SER OG HG sing N N 354 SER OXT HXT sing N N 355 THR N CA sing N N 356 THR N H sing N N 357 THR N H2 sing N N 358 THR CA C sing N N 359 THR CA CB sing N N 360 THR CA HA sing N N 361 THR C O doub N N 362 THR C OXT sing N N 363 THR CB OG1 sing N N 364 THR CB CG2 sing N N 365 THR CB HB sing N N 366 THR OG1 HG1 sing N N 367 THR CG2 HG21 sing N N 368 THR CG2 HG22 sing N N 369 THR CG2 HG23 sing N N 370 THR OXT HXT sing N N 371 TYR N CA sing N N 372 TYR N H sing N N 373 TYR N H2 sing N N 374 TYR CA C sing N N 375 TYR CA CB sing N N 376 TYR CA HA sing N N 377 TYR C O doub N N 378 TYR C OXT sing N N 379 TYR CB CG sing N N 380 TYR CB HB2 sing N N 381 TYR CB HB3 sing N N 382 TYR CG CD1 doub Y N 383 TYR CG CD2 sing Y N 384 TYR CD1 CE1 sing Y N 385 TYR CD1 HD1 sing N N 386 TYR CD2 CE2 doub Y N 387 TYR CD2 HD2 sing N N 388 TYR CE1 CZ doub Y N 389 TYR CE1 HE1 sing N N 390 TYR CE2 CZ sing Y N 391 TYR CE2 HE2 sing N N 392 TYR CZ OH sing N N 393 TYR OH HH sing N N 394 TYR OXT HXT sing N N 395 U OP3 P sing N N 396 U OP3 HOP3 sing N N 397 U P OP1 doub N N 398 U P OP2 sing N N 399 U P "O5'" sing N N 400 U OP2 HOP2 sing N N 401 U "O5'" "C5'" sing N N 402 U "C5'" "C4'" sing N N 403 U "C5'" "H5'" sing N N 404 U "C5'" "H5''" sing N N 405 U "C4'" "O4'" sing N N 406 U "C4'" "C3'" sing N N 407 U "C4'" "H4'" sing N N 408 U "O4'" "C1'" sing N N 409 U "C3'" "O3'" sing N N 410 U "C3'" "C2'" sing N N 411 U "C3'" "H3'" sing N N 412 U "O3'" "HO3'" sing N N 413 U "C2'" "O2'" sing N N 414 U "C2'" "C1'" sing N N 415 U "C2'" "H2'" sing N N 416 U "O2'" "HO2'" sing N N 417 U "C1'" N1 sing N N 418 U "C1'" "H1'" sing N N 419 U N1 C2 sing N N 420 U N1 C6 sing N N 421 U C2 O2 doub N N 422 U C2 N3 sing N N 423 U N3 C4 sing N N 424 U N3 H3 sing N N 425 U C4 O4 doub N N 426 U C4 C5 sing N N 427 U C5 C6 doub N N 428 U C5 H5 sing N N 429 U C6 H6 sing N N 430 VAL N CA sing N N 431 VAL N H sing N N 432 VAL N H2 sing N N 433 VAL CA C sing N N 434 VAL CA CB sing N N 435 VAL CA HA sing N N 436 VAL C O doub N N 437 VAL C OXT sing N N 438 VAL CB CG1 sing N N 439 VAL CB CG2 sing N N 440 VAL CB HB sing N N 441 VAL CG1 HG11 sing N N 442 VAL CG1 HG12 sing N N 443 VAL CG1 HG13 sing N N 444 VAL CG2 HG21 sing N N 445 VAL CG2 HG22 sing N N 446 VAL CG2 HG23 sing N N 447 VAL OXT HXT sing N N 448 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'NICKEL (II) ION' NI 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5WWW _pdbx_initial_refinement_model.details ? #