data_5X0S # _entry.id 5X0S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5X0S pdb_00005x0s 10.2210/pdb5x0s/pdb WWPDB D_1300002701 ? ? BMRB 36047 ? 10.13018/BMR36047 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-24 2 'Structure model' 1 1 2018-02-07 3 'Structure model' 1 2 2018-02-28 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' pdbx_nmr_software 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_DOI' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' 9 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 10 4 'Structure model' '_pdbx_nmr_software.name' 11 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5X0S _pdbx_database_status.recvd_initial_deposition_date 2017-01-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR structure of peptide toxin SsTx from Scolopendra subspinipes mutilans' _pdbx_database_related.db_id 36047 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wu, F.' 1 ? 'Luo, L.' 2 ? 'Qu, D.' 3 ? 'Zhang, L.' 4 ? 'Tian, C.' 5 ? 'Lai, R.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 115 _citation.language ? _citation.page_first 1646 _citation.page_last 1651 _citation.title 'Centipedes subdue giant prey by blocking KCNQ channels' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1714760115 _citation.pdbx_database_id_PubMed 29358396 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Luo, L.' 1 ? primary 'Li, B.' 2 ? primary 'Wang, S.' 3 ? primary 'Wu, F.' 4 ? primary 'Wang, X.' 5 ? primary 'Liang, P.' 6 ? primary 'Ombati, R.' 7 ? primary 'Chen, J.' 8 ? primary 'Lu, X.' 9 ? primary 'Cui, J.' 10 ? primary 'Lu, Q.' 11 ? primary 'Zhang, L.' 12 ? primary 'Zhou, M.' 13 ? primary 'Tian, C.' 14 ? primary 'Yang, S.' 15 ? primary 'Lai, R.' 16 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description SsTx _entity.formula_weight 6032.960 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG _entity_poly.pdbx_seq_one_letter_code_can EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 VAL n 1 3 ILE n 1 4 LYS n 1 5 LYS n 1 6 ASP n 1 7 THR n 1 8 PRO n 1 9 TYR n 1 10 LYS n 1 11 LYS n 1 12 ARG n 1 13 LYS n 1 14 PHE n 1 15 PRO n 1 16 TYR n 1 17 LYS n 1 18 SER n 1 19 GLU n 1 20 CYS n 1 21 LEU n 1 22 LYS n 1 23 ALA n 1 24 CYS n 1 25 ALA n 1 26 THR n 1 27 SER n 1 28 PHE n 1 29 THR n 1 30 GLY n 1 31 GLY n 1 32 ASP n 1 33 GLU n 1 34 SER n 1 35 ARG n 1 36 ILE n 1 37 GLN n 1 38 GLU n 1 39 GLY n 1 40 LYS n 1 41 PRO n 1 42 GLY n 1 43 PHE n 1 44 PHE n 1 45 LYS n 1 46 CYS n 1 47 THR n 1 48 CYS n 1 49 TYR n 1 50 PHE n 1 51 THR n 1 52 THR n 1 53 GLY n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 53 _pdbx_entity_src_syn.organism_scientific 'Scolopendra mutilans' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 251420 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLY 53 53 53 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5X0S _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5X0S _struct.title 'Solution NMR structure of peptide toxin SsTx from Scolopendra subspinipes mutilans' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5X0S _struct_keywords.text 'peptide toxin, Chinese red-headed centipede, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5X0S _struct_ref.pdbx_db_accession 5X0S _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5X0S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5X0S _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 53 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 53 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4470 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 17 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 27 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 17 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 27 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 20 A CYS 46 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 24 A CYS 48 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 20 ? CYS A 46 ? CYS A 20 ? 1_555 CYS A 46 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 24 ? CYS A 48 ? CYS A 24 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 4 ? PRO A 8 ? LYS A 4 PRO A 8 AA1 2 LYS A 45 ? PHE A 50 ? LYS A 45 PHE A 50 AA1 3 GLN A 37 ? GLY A 39 ? GLN A 37 GLY A 39 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 7 ? N THR A 7 O CYS A 46 ? O CYS A 46 AA1 2 3 O TYR A 49 ? O TYR A 49 N GLU A 38 ? N GLU A 38 # _pdbx_entry_details.entry_id 5X0S _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 36 ? ? H A GLU 38 ? ? 1.53 2 1 O A TYR 16 ? ? H A SER 18 ? ? 1.55 3 1 HE22 A GLN 37 ? ? O A THR 51 ? ? 1.58 4 1 O A ILE 36 ? ? O A TYR 49 ? ? 2.17 5 2 O A ILE 36 ? ? H A GLU 38 ? ? 1.52 6 2 O A ILE 36 ? ? O A TYR 49 ? ? 2.16 7 3 O A ILE 36 ? ? H A GLU 38 ? ? 1.44 8 3 O A TYR 16 ? ? H A SER 18 ? ? 1.58 9 3 O A LYS 5 ? ? H A CYS 48 ? ? 1.59 10 3 O A ILE 36 ? ? O A TYR 49 ? ? 2.13 11 4 O A ILE 36 ? ? H A GLU 38 ? ? 1.54 12 4 O A LYS 22 ? ? H A THR 26 ? ? 1.59 13 4 O A ILE 36 ? ? O A TYR 49 ? ? 2.13 14 4 O A LYS 5 ? ? O A CYS 48 ? ? 2.17 15 5 O A ILE 36 ? ? H A GLU 38 ? ? 1.54 16 5 O A LYS 5 ? ? H A CYS 48 ? ? 1.56 17 5 O A ILE 36 ? ? O A TYR 49 ? ? 2.19 18 6 O A ILE 36 ? ? H A GLU 38 ? ? 1.47 19 6 H A LYS 5 ? ? O A CYS 48 ? ? 1.56 20 6 O A ILE 36 ? ? O A TYR 49 ? ? 2.15 21 7 O A LYS 5 ? ? H A CYS 48 ? ? 1.55 22 7 O A ILE 36 ? ? H A GLU 38 ? ? 1.55 23 7 O A ILE 36 ? ? O A TYR 49 ? ? 2.14 24 8 HG A SER 27 ? ? HH22 A ARG 35 ? ? 1.28 25 8 O A ILE 36 ? ? H A GLU 38 ? ? 1.49 26 8 H A LYS 5 ? ? O A CYS 48 ? ? 1.56 27 8 O A ILE 36 ? ? O A TYR 49 ? ? 2.14 28 9 HG1 A THR 29 ? ? H A GLY 30 ? ? 1.23 29 9 H2 A GLU 1 ? ? H A VAL 2 ? ? 1.34 30 9 O A ILE 36 ? ? H A GLU 38 ? ? 1.50 31 9 O A ILE 36 ? ? O A TYR 49 ? ? 2.17 32 9 O A GLY 42 ? ? O A LYS 45 ? ? 2.18 33 10 O A ILE 36 ? ? H A GLU 38 ? ? 1.50 34 10 O A TYR 16 ? ? H A SER 18 ? ? 1.54 35 10 O A SER 18 ? ? H A LYS 22 ? ? 1.58 36 10 O A ILE 36 ? ? O A TYR 49 ? ? 2.18 37 11 O A ILE 36 ? ? H A GLU 38 ? ? 1.53 38 11 O A TYR 16 ? ? H A SER 18 ? ? 1.56 39 11 O A ILE 36 ? ? O A TYR 49 ? ? 2.17 40 12 O A ILE 36 ? ? H A GLU 38 ? ? 1.42 41 12 O A LYS 5 ? ? H A CYS 48 ? ? 1.57 42 12 O A PHE 50 ? ? H A THR 52 ? ? 1.59 43 12 O A ILE 36 ? ? O A TYR 49 ? ? 2.11 44 13 O A ILE 36 ? ? H A GLU 38 ? ? 1.46 45 13 O A PHE 50 ? ? H A THR 52 ? ? 1.56 46 13 H A LYS 5 ? ? O A CYS 48 ? ? 1.56 47 13 O A SER 18 ? ? H A LYS 22 ? ? 1.59 48 13 O A ILE 36 ? ? O A TYR 49 ? ? 2.13 49 14 O A ILE 36 ? ? H A GLU 38 ? ? 1.55 50 14 O A LYS 5 ? ? H A CYS 48 ? ? 1.56 51 14 O A ILE 36 ? ? O A TYR 49 ? ? 2.17 52 15 O A ILE 36 ? ? H A GLU 38 ? ? 1.53 53 15 O A TYR 16 ? ? H A SER 18 ? ? 1.58 54 15 O A ILE 36 ? ? O A TYR 49 ? ? 2.15 55 15 O A GLY 42 ? ? O A LYS 45 ? ? 2.19 56 16 O A ILE 36 ? ? H A GLU 38 ? ? 1.52 57 16 O A SER 18 ? ? H A LYS 22 ? ? 1.56 58 16 HZ2 A LYS 5 ? ? OG A SER 27 ? ? 1.57 59 16 O A TYR 16 ? ? H A SER 18 ? ? 1.58 60 16 O A ILE 36 ? ? O A TYR 49 ? ? 2.19 61 17 O A ILE 36 ? ? H A GLU 38 ? ? 1.52 62 17 O A LYS 5 ? ? H A CYS 48 ? ? 1.57 63 17 O A TYR 16 ? ? H A GLU 19 ? ? 1.59 64 17 O A ILE 36 ? ? O A TYR 49 ? ? 2.14 65 18 O A ILE 36 ? ? H A GLU 38 ? ? 1.51 66 18 O A TYR 16 ? ? H A SER 18 ? ? 1.57 67 18 O A ILE 36 ? ? O A TYR 49 ? ? 2.17 68 19 O A ILE 36 ? ? H A GLU 38 ? ? 1.54 69 19 O A SER 18 ? ? H A LYS 22 ? ? 1.57 70 19 O A ILE 36 ? ? O A TYR 49 ? ? 2.12 71 20 H1 A GLU 1 ? ? H A VAL 2 ? ? 1.30 72 20 H A LYS 5 ? ? O A CYS 48 ? ? 1.51 73 20 O A ILE 36 ? ? O A TYR 49 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 9 ? ? -131.69 -36.23 2 1 LYS A 10 ? ? 73.92 -71.02 3 1 LYS A 11 ? ? 152.91 44.67 4 1 LYS A 13 ? ? 53.82 -125.39 5 1 LYS A 17 ? ? 67.44 -56.41 6 1 ASP A 32 ? ? -54.56 78.08 7 1 GLU A 33 ? ? 54.82 -0.05 8 1 SER A 34 ? ? -53.01 90.56 9 1 ARG A 35 ? ? 154.49 -20.36 10 1 ILE A 36 ? ? -140.75 -68.43 11 1 GLN A 37 ? ? 64.81 -34.95 12 1 PHE A 44 ? ? 70.62 -0.14 13 1 LYS A 45 ? ? 179.88 169.80 14 1 THR A 51 ? ? -56.38 85.20 15 2 VAL A 2 ? ? 29.37 100.11 16 2 ILE A 3 ? ? -26.20 138.73 17 2 LYS A 10 ? ? -176.17 41.03 18 2 LYS A 11 ? ? 35.39 68.44 19 2 ARG A 12 ? ? -29.74 -48.51 20 2 LYS A 13 ? ? -163.52 -15.51 21 2 PHE A 14 ? ? 173.23 -48.27 22 2 TYR A 16 ? ? -131.72 -37.03 23 2 LYS A 17 ? ? -40.30 -104.44 24 2 SER A 18 ? ? -49.19 -19.49 25 2 ASP A 32 ? ? 80.18 17.04 26 2 GLU A 33 ? ? -151.49 -141.97 27 2 SER A 34 ? ? 27.64 87.43 28 2 ARG A 35 ? ? 154.02 -23.73 29 2 ILE A 36 ? ? -145.43 -64.28 30 2 GLN A 37 ? ? 64.66 -35.40 31 2 LYS A 45 ? ? 169.43 164.27 32 2 THR A 51 ? ? -50.09 103.57 33 3 TYR A 9 ? ? -160.18 78.29 34 3 LYS A 11 ? ? 22.29 94.53 35 3 LYS A 13 ? ? 45.43 85.23 36 3 PHE A 14 ? ? 57.12 150.98 37 3 TYR A 16 ? ? -149.35 -35.21 38 3 LYS A 17 ? ? 68.18 -44.96 39 3 SER A 27 ? ? -36.95 -74.25 40 3 PHE A 28 ? ? 61.48 99.74 41 3 THR A 29 ? ? -169.42 13.51 42 3 ASP A 32 ? ? 179.96 -148.68 43 3 SER A 34 ? ? -39.99 95.52 44 3 ARG A 35 ? ? 153.68 -28.08 45 3 ILE A 36 ? ? -138.78 -66.80 46 3 GLN A 37 ? ? 65.64 -41.29 47 3 THR A 51 ? ? -62.62 92.26 48 4 VAL A 2 ? ? -38.01 -24.45 49 4 ILE A 3 ? ? 63.57 133.10 50 4 TYR A 9 ? ? -149.65 -68.42 51 4 LYS A 10 ? ? 41.86 12.76 52 4 ARG A 12 ? ? 76.00 170.77 53 4 LYS A 13 ? ? 68.37 -27.15 54 4 PRO A 15 ? ? -39.22 164.77 55 4 LYS A 17 ? ? -29.77 -83.85 56 4 PHE A 28 ? ? -123.52 -164.07 57 4 ASP A 32 ? ? -161.51 31.43 58 4 GLU A 33 ? ? 43.02 9.73 59 4 SER A 34 ? ? -67.25 90.05 60 4 ARG A 35 ? ? 157.79 -23.70 61 4 ILE A 36 ? ? -145.03 -62.68 62 4 GLN A 37 ? ? 65.28 -34.82 63 4 LYS A 45 ? ? 160.47 -179.29 64 4 THR A 51 ? ? -55.88 91.33 65 5 VAL A 2 ? ? 64.94 -111.93 66 5 TYR A 9 ? ? -102.63 -67.67 67 5 LYS A 10 ? ? 44.09 9.61 68 5 ARG A 12 ? ? 44.20 90.52 69 5 LYS A 13 ? ? -152.20 -96.99 70 5 TYR A 16 ? ? 174.80 31.38 71 5 LYS A 17 ? ? -144.80 -78.58 72 5 ASP A 32 ? ? -136.92 -135.13 73 5 GLU A 33 ? ? -71.24 -160.93 74 5 SER A 34 ? ? 66.76 119.66 75 5 ARG A 35 ? ? 80.95 -13.89 76 5 ILE A 36 ? ? -143.50 -72.45 77 5 GLN A 37 ? ? 63.33 -31.27 78 5 PHE A 44 ? ? 81.19 4.81 79 5 LYS A 45 ? ? 174.16 162.97 80 5 THR A 51 ? ? -58.00 96.15 81 6 TYR A 9 ? ? -145.45 -146.39 82 6 LYS A 10 ? ? -177.90 -57.69 83 6 LYS A 11 ? ? 150.36 45.74 84 6 PHE A 14 ? ? 64.96 157.14 85 6 PRO A 15 ? ? -35.44 101.80 86 6 LYS A 17 ? ? -48.77 -14.87 87 6 SER A 27 ? ? -36.97 -25.20 88 6 GLU A 33 ? ? -143.84 -48.56 89 6 SER A 34 ? ? -58.43 85.58 90 6 ARG A 35 ? ? 168.88 -33.26 91 6 ILE A 36 ? ? -143.28 -56.72 92 6 GLN A 37 ? ? 65.08 -52.56 93 6 THR A 51 ? ? -44.56 102.70 94 7 ILE A 3 ? ? -26.12 137.91 95 7 TYR A 9 ? ? 171.70 177.10 96 7 LYS A 10 ? ? 104.16 -27.07 97 7 LYS A 11 ? ? -57.36 4.49 98 7 PHE A 14 ? ? 80.00 133.57 99 7 PRO A 15 ? ? -44.65 -166.48 100 7 TYR A 16 ? ? -116.17 -82.25 101 7 LYS A 17 ? ? 29.98 -86.80 102 7 THR A 29 ? ? -166.32 73.97 103 7 GLU A 33 ? ? 72.36 -42.38 104 7 SER A 34 ? ? -54.97 84.62 105 7 ARG A 35 ? ? 164.67 -31.62 106 7 ILE A 36 ? ? -147.63 -50.46 107 7 GLN A 37 ? ? 66.45 -61.32 108 7 PHE A 43 ? ? -34.85 118.39 109 7 PHE A 44 ? ? 85.54 26.51 110 7 LYS A 45 ? ? 155.31 -178.39 111 8 TYR A 9 ? ? -166.30 71.34 112 8 LYS A 10 ? ? -24.58 -83.08 113 8 LYS A 11 ? ? -179.57 35.21 114 8 ARG A 12 ? ? -22.32 143.13 115 8 LYS A 13 ? ? -36.65 141.86 116 8 TYR A 16 ? ? -160.07 91.50 117 8 LYS A 17 ? ? -25.32 -38.53 118 8 GLU A 19 ? ? -48.28 -19.87 119 8 SER A 27 ? ? -36.58 -26.57 120 8 THR A 29 ? ? 73.09 89.00 121 8 SER A 34 ? ? -44.74 91.86 122 8 ARG A 35 ? ? 157.37 -19.77 123 8 ILE A 36 ? ? -145.81 -65.95 124 8 GLN A 37 ? ? 63.25 -34.29 125 8 PHE A 44 ? ? 54.39 17.70 126 8 THR A 51 ? ? -40.64 103.11 127 9 ILE A 3 ? ? 53.72 162.62 128 9 LYS A 10 ? ? 55.27 0.11 129 9 PRO A 15 ? ? -53.97 109.45 130 9 TYR A 16 ? ? -170.60 119.65 131 9 SER A 27 ? ? -40.24 -17.57 132 9 PHE A 28 ? ? -177.81 144.17 133 9 THR A 29 ? ? 29.08 -89.23 134 9 ASP A 32 ? ? -147.78 -43.63 135 9 GLU A 33 ? ? -131.69 -47.83 136 9 ARG A 35 ? ? 151.28 -28.50 137 9 ILE A 36 ? ? -145.40 -57.87 138 9 GLN A 37 ? ? 65.64 -50.12 139 9 LYS A 45 ? ? 156.76 157.63 140 9 THR A 51 ? ? -57.73 78.46 141 9 THR A 52 ? ? -116.58 -136.07 142 10 VAL A 2 ? ? 56.35 111.16 143 10 ILE A 3 ? ? -36.21 128.91 144 10 LYS A 10 ? ? 56.02 -73.41 145 10 LYS A 11 ? ? 14.05 -94.94 146 10 LYS A 13 ? ? -68.86 -156.52 147 10 PHE A 14 ? ? 52.01 74.21 148 10 LYS A 17 ? ? 63.55 -59.19 149 10 GLU A 19 ? ? -34.45 -30.57 150 10 SER A 27 ? ? -35.58 -39.33 151 10 ASP A 32 ? ? 61.05 -127.63 152 10 ARG A 35 ? ? 77.18 -4.75 153 10 ILE A 36 ? ? -145.92 -76.30 154 10 GLN A 37 ? ? 66.01 -37.08 155 10 THR A 51 ? ? -50.14 102.37 156 10 THR A 52 ? ? -167.65 103.28 157 11 TYR A 9 ? ? 175.28 170.12 158 11 LYS A 10 ? ? 93.44 32.49 159 11 ARG A 12 ? ? -82.83 -128.62 160 11 PHE A 14 ? ? 60.68 130.49 161 11 LYS A 17 ? ? 61.08 -67.38 162 11 THR A 29 ? ? -169.10 -82.42 163 11 ASP A 32 ? ? -172.08 135.75 164 11 GLU A 33 ? ? 58.79 -83.18 165 11 SER A 34 ? ? -27.94 135.18 166 11 ARG A 35 ? ? 80.35 -9.21 167 11 ILE A 36 ? ? -144.32 -76.22 168 11 GLN A 37 ? ? 67.66 -45.78 169 11 PHE A 44 ? ? 80.57 29.92 170 11 LYS A 45 ? ? 160.63 171.56 171 11 THR A 51 ? ? -30.03 94.62 172 12 VAL A 2 ? ? -79.83 35.94 173 12 ILE A 3 ? ? 57.40 144.28 174 12 TYR A 9 ? ? 179.19 80.56 175 12 LYS A 11 ? ? 20.70 87.09 176 12 LYS A 13 ? ? -142.79 -92.75 177 12 TYR A 16 ? ? -152.43 45.45 178 12 LYS A 17 ? ? -172.39 -91.51 179 12 SER A 27 ? ? -43.56 -17.37 180 12 THR A 29 ? ? -31.92 -87.42 181 12 ASP A 32 ? ? 36.50 43.52 182 12 GLU A 33 ? ? 55.48 -89.33 183 12 SER A 34 ? ? -34.84 97.22 184 12 ARG A 35 ? ? 150.41 -42.92 185 12 ILE A 36 ? ? -139.01 -55.88 186 12 GLN A 37 ? ? 61.82 -58.74 187 12 LYS A 45 ? ? 175.19 172.66 188 12 THR A 51 ? ? -54.31 71.10 189 13 VAL A 2 ? ? -70.45 46.01 190 13 ILE A 3 ? ? 56.50 136.08 191 13 LYS A 11 ? ? -25.08 -99.98 192 13 PRO A 15 ? ? -45.95 -124.79 193 13 TYR A 16 ? ? -177.11 30.67 194 13 LYS A 17 ? ? 58.87 -78.96 195 13 SER A 27 ? ? -39.83 -15.71 196 13 PHE A 28 ? ? -24.54 106.86 197 13 GLU A 33 ? ? 56.00 -83.79 198 13 SER A 34 ? ? -33.36 100.03 199 13 ARG A 35 ? ? 150.52 -36.65 200 13 ILE A 36 ? ? -145.27 -58.56 201 13 GLN A 37 ? ? 67.25 -47.68 202 13 LYS A 45 ? ? 169.46 -172.45 203 13 THR A 51 ? ? -60.76 67.98 204 14 VAL A 2 ? ? -79.22 -120.42 205 14 LYS A 10 ? ? 31.65 49.37 206 14 LYS A 11 ? ? 20.54 54.76 207 14 ARG A 12 ? ? -36.00 -100.07 208 14 LYS A 13 ? ? -85.28 -114.79 209 14 TYR A 16 ? ? -168.73 82.52 210 14 LYS A 17 ? ? -42.14 -19.87 211 14 GLU A 19 ? ? -47.16 -15.42 212 14 ASP A 32 ? ? -150.15 -66.15 213 14 GLU A 33 ? ? -142.54 -67.25 214 14 SER A 34 ? ? -23.34 132.51 215 14 ARG A 35 ? ? 75.42 -9.06 216 14 ILE A 36 ? ? -138.47 -74.78 217 14 GLN A 37 ? ? 66.21 -35.37 218 14 PHE A 44 ? ? 47.98 14.09 219 14 THR A 51 ? ? -56.60 88.98 220 15 ILE A 3 ? ? -38.74 160.93 221 15 TYR A 9 ? ? -172.62 -179.62 222 15 LYS A 10 ? ? 97.54 -45.69 223 15 LYS A 11 ? ? -56.46 -1.43 224 15 LYS A 13 ? ? 63.53 142.78 225 15 PHE A 14 ? ? -37.25 156.65 226 15 PRO A 15 ? ? -40.80 152.34 227 15 TYR A 16 ? ? -154.34 -40.81 228 15 LYS A 17 ? ? 68.93 -51.64 229 15 THR A 29 ? ? -46.25 175.92 230 15 GLU A 33 ? ? -124.63 -160.79 231 15 SER A 34 ? ? 57.86 117.53 232 15 ARG A 35 ? ? 77.47 -5.48 233 15 ILE A 36 ? ? -147.35 -74.99 234 15 GLN A 37 ? ? 68.81 -41.50 235 15 LYS A 45 ? ? 163.82 -172.02 236 15 THR A 51 ? ? -61.10 98.45 237 16 TYR A 9 ? ? -157.38 72.74 238 16 LYS A 10 ? ? -42.82 87.10 239 16 LYS A 11 ? ? -20.66 87.46 240 16 LYS A 13 ? ? 54.90 70.40 241 16 PHE A 14 ? ? 60.15 150.44 242 16 LYS A 17 ? ? 69.67 -49.14 243 16 GLU A 19 ? ? -37.15 -19.65 244 16 PHE A 28 ? ? -124.26 -72.36 245 16 THR A 29 ? ? -101.27 -106.91 246 16 ASP A 32 ? ? -173.91 13.48 247 16 SER A 34 ? ? 58.89 123.81 248 16 ARG A 35 ? ? 82.70 -17.59 249 16 ILE A 36 ? ? -144.11 -70.17 250 16 GLN A 37 ? ? 66.04 -39.28 251 16 LYS A 45 ? ? -178.94 146.74 252 17 VAL A 2 ? ? -26.93 122.46 253 17 ILE A 3 ? ? -28.21 143.43 254 17 LYS A 10 ? ? 46.48 6.72 255 17 LYS A 11 ? ? -66.08 -80.45 256 17 ARG A 12 ? ? 70.52 -28.11 257 17 PRO A 15 ? ? -44.60 79.92 258 17 TYR A 16 ? ? -156.37 88.41 259 17 ASP A 32 ? ? -109.45 -77.53 260 17 SER A 34 ? ? 179.94 99.67 261 17 ARG A 35 ? ? 88.83 -6.59 262 17 ILE A 36 ? ? -144.68 -71.65 263 17 GLN A 37 ? ? 62.59 -29.94 264 17 PHE A 44 ? ? 84.95 0.61 265 17 LYS A 45 ? ? 178.03 172.83 266 17 THR A 51 ? ? -27.68 89.23 267 18 VAL A 2 ? ? -38.50 152.92 268 18 TYR A 9 ? ? -96.82 -79.14 269 18 LYS A 10 ? ? 46.71 7.49 270 18 LYS A 11 ? ? -51.48 -81.67 271 18 LYS A 13 ? ? -82.80 44.85 272 18 PRO A 15 ? ? -46.52 103.43 273 18 LYS A 17 ? ? 64.94 -62.51 274 18 SER A 18 ? ? -66.05 -70.77 275 18 GLU A 19 ? ? -34.07 -25.73 276 18 ASP A 32 ? ? 45.24 -142.94 277 18 GLU A 33 ? ? -132.88 -38.37 278 18 SER A 34 ? ? -58.80 86.62 279 18 ARG A 35 ? ? 169.26 -23.23 280 18 ILE A 36 ? ? -144.05 -66.51 281 18 GLN A 37 ? ? 62.79 -32.38 282 18 LYS A 45 ? ? 169.54 171.89 283 18 THR A 51 ? ? -38.41 90.31 284 19 LYS A 10 ? ? 66.35 -71.48 285 19 LYS A 11 ? ? 154.82 38.17 286 19 LYS A 13 ? ? 43.84 20.39 287 19 PHE A 14 ? ? 58.51 147.65 288 19 LYS A 17 ? ? 65.53 -66.19 289 19 SER A 27 ? ? -37.27 -28.89 290 19 PHE A 28 ? ? -170.28 114.75 291 19 ASP A 32 ? ? -175.42 148.73 292 19 GLU A 33 ? ? 35.42 -145.60 293 19 ARG A 35 ? ? 166.14 -27.34 294 19 ILE A 36 ? ? -148.82 -36.63 295 19 GLN A 37 ? ? 53.48 -69.57 296 19 PHE A 44 ? ? 59.92 3.29 297 19 THR A 51 ? ? -43.61 107.17 298 20 VAL A 2 ? ? -46.28 150.37 299 20 ILE A 3 ? ? -33.69 126.83 300 20 TYR A 9 ? ? -139.53 -44.73 301 20 LYS A 10 ? ? 75.10 -64.83 302 20 LYS A 11 ? ? 153.15 36.85 303 20 ARG A 12 ? ? -42.65 99.79 304 20 LYS A 13 ? ? 64.98 -136.95 305 20 TYR A 16 ? ? -158.16 18.53 306 20 LYS A 17 ? ? 51.46 -75.64 307 20 PHE A 28 ? ? -126.03 -61.79 308 20 THR A 29 ? ? 76.52 -152.37 309 20 ARG A 35 ? ? 100.37 -8.96 310 20 ILE A 36 ? ? -144.99 -75.02 311 20 GLN A 37 ? ? 70.76 -44.96 312 20 LYS A 45 ? ? 173.25 156.36 # _pdbx_nmr_ensemble.entry_id 5X0S _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5X0S _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50mM sodium chloride, 50mM sodium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label NA_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium chloride' 50 ? mM 'natural abundance' 1 'sodium phosphate' 50 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.35 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.01 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.01 _pdbx_nmr_exptl_sample_conditions.temperature_err 0.2 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D DQF-COSY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 5X0S _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'chemical shift assignment' Sparky ? Goddard 3 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 4 collection VNMR ? Varian # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 ILE N N N N 120 ILE CA C N S 121 ILE C C N N 122 ILE O O N N 123 ILE CB C N S 124 ILE CG1 C N N 125 ILE CG2 C N N 126 ILE CD1 C N N 127 ILE OXT O N N 128 ILE H H N N 129 ILE H2 H N N 130 ILE HA H N N 131 ILE HB H N N 132 ILE HG12 H N N 133 ILE HG13 H N N 134 ILE HG21 H N N 135 ILE HG22 H N N 136 ILE HG23 H N N 137 ILE HD11 H N N 138 ILE HD12 H N N 139 ILE HD13 H N N 140 ILE HXT H N N 141 LEU N N N N 142 LEU CA C N S 143 LEU C C N N 144 LEU O O N N 145 LEU CB C N N 146 LEU CG C N N 147 LEU CD1 C N N 148 LEU CD2 C N N 149 LEU OXT O N N 150 LEU H H N N 151 LEU H2 H N N 152 LEU HA H N N 153 LEU HB2 H N N 154 LEU HB3 H N N 155 LEU HG H N N 156 LEU HD11 H N N 157 LEU HD12 H N N 158 LEU HD13 H N N 159 LEU HD21 H N N 160 LEU HD22 H N N 161 LEU HD23 H N N 162 LEU HXT H N N 163 LYS N N N N 164 LYS CA C N S 165 LYS C C N N 166 LYS O O N N 167 LYS CB C N N 168 LYS CG C N N 169 LYS CD C N N 170 LYS CE C N N 171 LYS NZ N N N 172 LYS OXT O N N 173 LYS H H N N 174 LYS H2 H N N 175 LYS HA H N N 176 LYS HB2 H N N 177 LYS HB3 H N N 178 LYS HG2 H N N 179 LYS HG3 H N N 180 LYS HD2 H N N 181 LYS HD3 H N N 182 LYS HE2 H N N 183 LYS HE3 H N N 184 LYS HZ1 H N N 185 LYS HZ2 H N N 186 LYS HZ3 H N N 187 LYS HXT H N N 188 PHE N N N N 189 PHE CA C N S 190 PHE C C N N 191 PHE O O N N 192 PHE CB C N N 193 PHE CG C Y N 194 PHE CD1 C Y N 195 PHE CD2 C Y N 196 PHE CE1 C Y N 197 PHE CE2 C Y N 198 PHE CZ C Y N 199 PHE OXT O N N 200 PHE H H N N 201 PHE H2 H N N 202 PHE HA H N N 203 PHE HB2 H N N 204 PHE HB3 H N N 205 PHE HD1 H N N 206 PHE HD2 H N N 207 PHE HE1 H N N 208 PHE HE2 H N N 209 PHE HZ H N N 210 PHE HXT H N N 211 PRO N N N N 212 PRO CA C N S 213 PRO C C N N 214 PRO O O N N 215 PRO CB C N N 216 PRO CG C N N 217 PRO CD C N N 218 PRO OXT O N N 219 PRO H H N N 220 PRO HA H N N 221 PRO HB2 H N N 222 PRO HB3 H N N 223 PRO HG2 H N N 224 PRO HG3 H N N 225 PRO HD2 H N N 226 PRO HD3 H N N 227 PRO HXT H N N 228 SER N N N N 229 SER CA C N S 230 SER C C N N 231 SER O O N N 232 SER CB C N N 233 SER OG O N N 234 SER OXT O N N 235 SER H H N N 236 SER H2 H N N 237 SER HA H N N 238 SER HB2 H N N 239 SER HB3 H N N 240 SER HG H N N 241 SER HXT H N N 242 THR N N N N 243 THR CA C N S 244 THR C C N N 245 THR O O N N 246 THR CB C N R 247 THR OG1 O N N 248 THR CG2 C N N 249 THR OXT O N N 250 THR H H N N 251 THR H2 H N N 252 THR HA H N N 253 THR HB H N N 254 THR HG1 H N N 255 THR HG21 H N N 256 THR HG22 H N N 257 THR HG23 H N N 258 THR HXT H N N 259 TYR N N N N 260 TYR CA C N S 261 TYR C C N N 262 TYR O O N N 263 TYR CB C N N 264 TYR CG C Y N 265 TYR CD1 C Y N 266 TYR CD2 C Y N 267 TYR CE1 C Y N 268 TYR CE2 C Y N 269 TYR CZ C Y N 270 TYR OH O N N 271 TYR OXT O N N 272 TYR H H N N 273 TYR H2 H N N 274 TYR HA H N N 275 TYR HB2 H N N 276 TYR HB3 H N N 277 TYR HD1 H N N 278 TYR HD2 H N N 279 TYR HE1 H N N 280 TYR HE2 H N N 281 TYR HH H N N 282 TYR HXT H N N 283 VAL N N N N 284 VAL CA C N S 285 VAL C C N N 286 VAL O O N N 287 VAL CB C N N 288 VAL CG1 C N N 289 VAL CG2 C N N 290 VAL OXT O N N 291 VAL H H N N 292 VAL H2 H N N 293 VAL HA H N N 294 VAL HB H N N 295 VAL HG11 H N N 296 VAL HG12 H N N 297 VAL HG13 H N N 298 VAL HG21 H N N 299 VAL HG22 H N N 300 VAL HG23 H N N 301 VAL HXT H N N 302 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 ILE N CA sing N N 113 ILE N H sing N N 114 ILE N H2 sing N N 115 ILE CA C sing N N 116 ILE CA CB sing N N 117 ILE CA HA sing N N 118 ILE C O doub N N 119 ILE C OXT sing N N 120 ILE CB CG1 sing N N 121 ILE CB CG2 sing N N 122 ILE CB HB sing N N 123 ILE CG1 CD1 sing N N 124 ILE CG1 HG12 sing N N 125 ILE CG1 HG13 sing N N 126 ILE CG2 HG21 sing N N 127 ILE CG2 HG22 sing N N 128 ILE CG2 HG23 sing N N 129 ILE CD1 HD11 sing N N 130 ILE CD1 HD12 sing N N 131 ILE CD1 HD13 sing N N 132 ILE OXT HXT sing N N 133 LEU N CA sing N N 134 LEU N H sing N N 135 LEU N H2 sing N N 136 LEU CA C sing N N 137 LEU CA CB sing N N 138 LEU CA HA sing N N 139 LEU C O doub N N 140 LEU C OXT sing N N 141 LEU CB CG sing N N 142 LEU CB HB2 sing N N 143 LEU CB HB3 sing N N 144 LEU CG CD1 sing N N 145 LEU CG CD2 sing N N 146 LEU CG HG sing N N 147 LEU CD1 HD11 sing N N 148 LEU CD1 HD12 sing N N 149 LEU CD1 HD13 sing N N 150 LEU CD2 HD21 sing N N 151 LEU CD2 HD22 sing N N 152 LEU CD2 HD23 sing N N 153 LEU OXT HXT sing N N 154 LYS N CA sing N N 155 LYS N H sing N N 156 LYS N H2 sing N N 157 LYS CA C sing N N 158 LYS CA CB sing N N 159 LYS CA HA sing N N 160 LYS C O doub N N 161 LYS C OXT sing N N 162 LYS CB CG sing N N 163 LYS CB HB2 sing N N 164 LYS CB HB3 sing N N 165 LYS CG CD sing N N 166 LYS CG HG2 sing N N 167 LYS CG HG3 sing N N 168 LYS CD CE sing N N 169 LYS CD HD2 sing N N 170 LYS CD HD3 sing N N 171 LYS CE NZ sing N N 172 LYS CE HE2 sing N N 173 LYS CE HE3 sing N N 174 LYS NZ HZ1 sing N N 175 LYS NZ HZ2 sing N N 176 LYS NZ HZ3 sing N N 177 LYS OXT HXT sing N N 178 PHE N CA sing N N 179 PHE N H sing N N 180 PHE N H2 sing N N 181 PHE CA C sing N N 182 PHE CA CB sing N N 183 PHE CA HA sing N N 184 PHE C O doub N N 185 PHE C OXT sing N N 186 PHE CB CG sing N N 187 PHE CB HB2 sing N N 188 PHE CB HB3 sing N N 189 PHE CG CD1 doub Y N 190 PHE CG CD2 sing Y N 191 PHE CD1 CE1 sing Y N 192 PHE CD1 HD1 sing N N 193 PHE CD2 CE2 doub Y N 194 PHE CD2 HD2 sing N N 195 PHE CE1 CZ doub Y N 196 PHE CE1 HE1 sing N N 197 PHE CE2 CZ sing Y N 198 PHE CE2 HE2 sing N N 199 PHE CZ HZ sing N N 200 PHE OXT HXT sing N N 201 PRO N CA sing N N 202 PRO N CD sing N N 203 PRO N H sing N N 204 PRO CA C sing N N 205 PRO CA CB sing N N 206 PRO CA HA sing N N 207 PRO C O doub N N 208 PRO C OXT sing N N 209 PRO CB CG sing N N 210 PRO CB HB2 sing N N 211 PRO CB HB3 sing N N 212 PRO CG CD sing N N 213 PRO CG HG2 sing N N 214 PRO CG HG3 sing N N 215 PRO CD HD2 sing N N 216 PRO CD HD3 sing N N 217 PRO OXT HXT sing N N 218 SER N CA sing N N 219 SER N H sing N N 220 SER N H2 sing N N 221 SER CA C sing N N 222 SER CA CB sing N N 223 SER CA HA sing N N 224 SER C O doub N N 225 SER C OXT sing N N 226 SER CB OG sing N N 227 SER CB HB2 sing N N 228 SER CB HB3 sing N N 229 SER OG HG sing N N 230 SER OXT HXT sing N N 231 THR N CA sing N N 232 THR N H sing N N 233 THR N H2 sing N N 234 THR CA C sing N N 235 THR CA CB sing N N 236 THR CA HA sing N N 237 THR C O doub N N 238 THR C OXT sing N N 239 THR CB OG1 sing N N 240 THR CB CG2 sing N N 241 THR CB HB sing N N 242 THR OG1 HG1 sing N N 243 THR CG2 HG21 sing N N 244 THR CG2 HG22 sing N N 245 THR CG2 HG23 sing N N 246 THR OXT HXT sing N N 247 TYR N CA sing N N 248 TYR N H sing N N 249 TYR N H2 sing N N 250 TYR CA C sing N N 251 TYR CA CB sing N N 252 TYR CA HA sing N N 253 TYR C O doub N N 254 TYR C OXT sing N N 255 TYR CB CG sing N N 256 TYR CB HB2 sing N N 257 TYR CB HB3 sing N N 258 TYR CG CD1 doub Y N 259 TYR CG CD2 sing Y N 260 TYR CD1 CE1 sing Y N 261 TYR CD1 HD1 sing N N 262 TYR CD2 CE2 doub Y N 263 TYR CD2 HD2 sing N N 264 TYR CE1 CZ doub Y N 265 TYR CE1 HE1 sing N N 266 TYR CE2 CZ sing Y N 267 TYR CE2 HE2 sing N N 268 TYR CZ OH sing N N 269 TYR OH HH sing N N 270 TYR OXT HXT sing N N 271 VAL N CA sing N N 272 VAL N H sing N N 273 VAL N H2 sing N N 274 VAL CA C sing N N 275 VAL CA CB sing N N 276 VAL CA HA sing N N 277 VAL C O doub N N 278 VAL C OXT sing N N 279 VAL CB CG1 sing N N 280 VAL CB CG2 sing N N 281 VAL CB HB sing N N 282 VAL CG1 HG11 sing N N 283 VAL CG1 HG12 sing N N 284 VAL CG1 HG13 sing N N 285 VAL CG2 HG21 sing N N 286 VAL CG2 HG22 sing N N 287 VAL CG2 HG23 sing N N 288 VAL OXT HXT sing N N 289 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Science and Technology of China' China 2013CB911304 1 'National Natural Science Foundation of China' China 31470740 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 5X0S _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_