data_5X4Y # _entry.id 5X4Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.284 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5X4Y WWPDB D_1300002938 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5X4W unspecified PDB . 5X4X unspecified PDB . 5X5A unspecified PDB . 5X5D unspecified PDB . 5X5Q unspecified PDB . 5X66 unspecified PDB . 5X67 unspecified PDB . 5X69 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5X4Y _pdbx_database_status.recvd_initial_deposition_date 2017-02-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, D.' 1 ? 'Jansson, A.' 2 ? 'Larsson, A.' 3 ? 'Nordlund, P.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 292 _citation.language ? _citation.page_first 13449 _citation.page_last 13458 _citation.title ;Structural analyses of human thymidylate synthase reveal a site that may control conformational switching between active and inactive states ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M117.787267 _citation.pdbx_database_id_PubMed 28634233 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chen, D.' 1 primary 'Jansson, A.' 2 primary 'Sim, D.' 3 primary 'Larsson, A.' 4 primary 'Nordlund, P.' 5 # _cell.length_a 95.951 _cell.length_b 95.951 _cell.length_c 80.890 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 5X4Y _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.entry_id 5X4Y _symmetry.Int_Tables_number 152 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thymidylate synthase' 35847.996 1 2.1.1.45 M190K ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 140 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name TSase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRV FWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVD QLQRVIDTIKTNPDDRRIIMCAWNPRDLPLKALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAH ITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV ; _entity_poly.pdbx_seq_one_letter_code_can ;SMPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRV FWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVD QLQRVIDTIKTNPDDRRIIMCAWNPRDLPLKALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAH ITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 PRO n 1 4 VAL n 1 5 ALA n 1 6 GLY n 1 7 SER n 1 8 GLU n 1 9 LEU n 1 10 PRO n 1 11 ARG n 1 12 ARG n 1 13 PRO n 1 14 LEU n 1 15 PRO n 1 16 PRO n 1 17 ALA n 1 18 ALA n 1 19 GLN n 1 20 GLU n 1 21 ARG n 1 22 ASP n 1 23 ALA n 1 24 GLU n 1 25 PRO n 1 26 ARG n 1 27 PRO n 1 28 PRO n 1 29 HIS n 1 30 GLY n 1 31 GLU n 1 32 LEU n 1 33 GLN n 1 34 TYR n 1 35 LEU n 1 36 GLY n 1 37 GLN n 1 38 ILE n 1 39 GLN n 1 40 HIS n 1 41 ILE n 1 42 LEU n 1 43 ARG n 1 44 CYS n 1 45 GLY n 1 46 VAL n 1 47 ARG n 1 48 LYS n 1 49 ASP n 1 50 ASP n 1 51 ARG n 1 52 THR n 1 53 GLY n 1 54 THR n 1 55 GLY n 1 56 THR n 1 57 LEU n 1 58 SER n 1 59 VAL n 1 60 PHE n 1 61 GLY n 1 62 MET n 1 63 GLN n 1 64 ALA n 1 65 ARG n 1 66 TYR n 1 67 SER n 1 68 LEU n 1 69 ARG n 1 70 ASP n 1 71 GLU n 1 72 PHE n 1 73 PRO n 1 74 LEU n 1 75 LEU n 1 76 THR n 1 77 THR n 1 78 LYS n 1 79 ARG n 1 80 VAL n 1 81 PHE n 1 82 TRP n 1 83 LYS n 1 84 GLY n 1 85 VAL n 1 86 LEU n 1 87 GLU n 1 88 GLU n 1 89 LEU n 1 90 LEU n 1 91 TRP n 1 92 PHE n 1 93 ILE n 1 94 LYS n 1 95 GLY n 1 96 SER n 1 97 THR n 1 98 ASN n 1 99 ALA n 1 100 LYS n 1 101 GLU n 1 102 LEU n 1 103 SER n 1 104 SER n 1 105 LYS n 1 106 GLY n 1 107 VAL n 1 108 LYS n 1 109 ILE n 1 110 TRP n 1 111 ASP n 1 112 ALA n 1 113 ASN n 1 114 GLY n 1 115 SER n 1 116 ARG n 1 117 ASP n 1 118 PHE n 1 119 LEU n 1 120 ASP n 1 121 SER n 1 122 LEU n 1 123 GLY n 1 124 PHE n 1 125 SER n 1 126 THR n 1 127 ARG n 1 128 GLU n 1 129 GLU n 1 130 GLY n 1 131 ASP n 1 132 LEU n 1 133 GLY n 1 134 PRO n 1 135 VAL n 1 136 TYR n 1 137 GLY n 1 138 PHE n 1 139 GLN n 1 140 TRP n 1 141 ARG n 1 142 HIS n 1 143 PHE n 1 144 GLY n 1 145 ALA n 1 146 GLU n 1 147 TYR n 1 148 ARG n 1 149 ASP n 1 150 MET n 1 151 GLU n 1 152 SER n 1 153 ASP n 1 154 TYR n 1 155 SER n 1 156 GLY n 1 157 GLN n 1 158 GLY n 1 159 VAL n 1 160 ASP n 1 161 GLN n 1 162 LEU n 1 163 GLN n 1 164 ARG n 1 165 VAL n 1 166 ILE n 1 167 ASP n 1 168 THR n 1 169 ILE n 1 170 LYS n 1 171 THR n 1 172 ASN n 1 173 PRO n 1 174 ASP n 1 175 ASP n 1 176 ARG n 1 177 ARG n 1 178 ILE n 1 179 ILE n 1 180 MET n 1 181 CYS n 1 182 ALA n 1 183 TRP n 1 184 ASN n 1 185 PRO n 1 186 ARG n 1 187 ASP n 1 188 LEU n 1 189 PRO n 1 190 LEU n 1 191 LYS n 1 192 ALA n 1 193 LEU n 1 194 PRO n 1 195 PRO n 1 196 CYS n 1 197 HIS n 1 198 ALA n 1 199 LEU n 1 200 CYS n 1 201 GLN n 1 202 PHE n 1 203 TYR n 1 204 VAL n 1 205 VAL n 1 206 ASN n 1 207 SER n 1 208 GLU n 1 209 LEU n 1 210 SER n 1 211 CYS n 1 212 GLN n 1 213 LEU n 1 214 TYR n 1 215 GLN n 1 216 ARG n 1 217 SER n 1 218 GLY n 1 219 ASP n 1 220 MET n 1 221 GLY n 1 222 LEU n 1 223 GLY n 1 224 VAL n 1 225 PRO n 1 226 PHE n 1 227 ASN n 1 228 ILE n 1 229 ALA n 1 230 SER n 1 231 TYR n 1 232 ALA n 1 233 LEU n 1 234 LEU n 1 235 THR n 1 236 TYR n 1 237 MET n 1 238 ILE n 1 239 ALA n 1 240 HIS n 1 241 ILE n 1 242 THR n 1 243 GLY n 1 244 LEU n 1 245 LYS n 1 246 PRO n 1 247 GLY n 1 248 ASP n 1 249 PHE n 1 250 ILE n 1 251 HIS n 1 252 THR n 1 253 LEU n 1 254 GLY n 1 255 ASP n 1 256 ALA n 1 257 HIS n 1 258 ILE n 1 259 TYR n 1 260 LEU n 1 261 ASN n 1 262 HIS n 1 263 ILE n 1 264 GLU n 1 265 PRO n 1 266 LEU n 1 267 LYS n 1 268 ILE n 1 269 GLN n 1 270 LEU n 1 271 GLN n 1 272 ARG n 1 273 GLU n 1 274 PRO n 1 275 ARG n 1 276 PRO n 1 277 PHE n 1 278 PRO n 1 279 LYS n 1 280 LEU n 1 281 ARG n 1 282 ILE n 1 283 LEU n 1 284 ARG n 1 285 LYS n 1 286 VAL n 1 287 GLU n 1 288 LYS n 1 289 ILE n 1 290 ASP n 1 291 ASP n 1 292 PHE n 1 293 LYS n 1 294 ALA n 1 295 GLU n 1 296 ASP n 1 297 PHE n 1 298 GLN n 1 299 ILE n 1 300 GLU n 1 301 GLY n 1 302 TYR n 1 303 ASN n 1 304 PRO n 1 305 HIS n 1 306 PRO n 1 307 THR n 1 308 ILE n 1 309 LYS n 1 310 MET n 1 311 GLU n 1 312 MET n 1 313 ALA n 1 314 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 314 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TYMS, TS, OK/SW-cl.29' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TYSY_HUMAN _struct_ref.pdbx_db_accession P04818 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVF WKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQ LQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHI TGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5X4Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 314 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04818 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 313 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 313 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5X4Y SER A 1 ? UNP P04818 ? ? 'expression tag' 0 1 1 5X4Y LYS A 191 ? UNP P04818 MET 190 'engineered mutation' 190 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5X4Y _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.28 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM MES, pH 6.5, 1.6M ammonium sulfate, 10% 1,4-dioxane' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-09-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.entry_id 5X4Y _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 83.096 _reflns.d_resolution_high 2.200 _reflns.number_obs 22239 _reflns.number_all 22239 _reflns.percent_possible_obs 99.900 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.062 _reflns.pdbx_netI_over_sigmaI 26.700 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11.900 _reflns.pdbx_Rrim_I_all 0.065 _reflns.pdbx_Rpim_I_all 0.019 _reflns.pdbx_CC_half ? _reflns.pdbx_netI_over_av_sigmaI 9.400 _reflns.pdbx_number_measured_all 263957 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_chi_squared ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 2.200 2.320 ? 38252 ? ? 0.355 2.000 0.355 ? 12.000 ? 7.700 ? 3200 ? ? ? ? 100.000 0.371 0.107 ? 1 2 2.320 2.460 ? 36924 ? ? 0.235 3.200 0.235 ? 12.100 ? 10.000 ? 3051 ? ? ? ? 100.000 0.245 0.070 ? 1 3 2.460 2.630 ? 34225 ? ? 0.172 4.400 0.172 ? 12.100 ? 13.200 ? 2836 ? ? ? ? 100.000 0.179 0.051 ? 1 4 2.630 2.840 ? 32245 ? ? 0.111 6.700 0.111 ? 12.100 ? 19.600 ? 2672 ? ? ? ? 100.000 0.116 0.033 ? 1 5 2.840 3.110 ? 29547 ? ? 0.078 9.300 0.078 ? 12.000 ? 26.500 ? 2463 ? ? ? ? 100.000 0.082 0.024 ? 1 6 3.110 3.480 ? 26780 ? ? 0.055 12.300 0.055 ? 12.000 ? 37.200 ? 2239 ? ? ? ? 100.000 0.057 0.017 ? 1 7 3.480 4.020 ? 23621 ? ? 0.044 14.300 0.044 ? 11.800 ? 47.900 ? 1998 ? ? ? ? 100.000 0.046 0.013 ? 1 8 4.020 4.920 ? 19539 ? ? 0.037 16.200 0.037 ? 11.700 ? 58.000 ? 1676 ? ? ? ? 100.000 0.039 0.011 ? 1 9 4.920 6.960 ? 15178 ? ? 0.041 13.600 0.041 ? 11.300 ? 49.600 ? 1342 ? ? ? ? 100.000 0.043 0.013 ? 1 10 6.960 26.963 ? 7646 ? ? 0.026 23.000 0.026 ? 10.000 ? 54.000 ? 762 ? ? ? ? 98.200 0.027 0.008 ? # _refine.entry_id 5X4Y _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.2000 _refine.ls_d_res_low 83.1000 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.6400 _refine.ls_number_reflns_obs 21018 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1893 _refine.ls_R_factor_R_work 0.1868 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2353 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_number_reflns_R_free 1136 _refine.ls_number_reflns_R_work ? _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 38.6150 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -0.7500 _refine.aniso_B[2][2] -0.7500 _refine.aniso_B[3][3] 2.4400 _refine.aniso_B[1][2] -0.3800 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9560 _refine.correlation_coeff_Fo_to_Fc_free 0.9280 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.1890 _refine.pdbx_overall_ESU_R_Free 0.1770 _refine.overall_SU_ML 0.1160 _refine.overall_SU_B 4.5770 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 1HW3 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 99.800 _refine.B_iso_min 15.000 _refine.pdbx_overall_phase_error ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2000 _refine_hist.d_res_low 83.1000 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 140 _refine_hist.number_atoms_total 2365 _refine_hist.pdbx_number_residues_total 278 _refine_hist.pdbx_B_iso_mean_ligand 58.11 _refine_hist.pdbx_B_iso_mean_solvent 40.95 _refine_hist.pdbx_number_atoms_protein 2215 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' r_bond_refined_d 2279 0.019 0.019 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 2118 0.002 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 3087 1.820 1.961 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 4866 1.050 3.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 276 6.693 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 111 37.622 23.514 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 376 14.693 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 17 16.844 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 330 0.119 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 2574 0.010 0.021 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 545 0.002 0.020 ? ? # _refine_ls_shell.d_res_high 2.2000 _refine_ls_shell.d_res_low 2.2570 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 98.3900 _refine_ls_shell.number_reflns_R_work 1514 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.3750 _refine_ls_shell.R_factor_R_free 0.4490 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 71 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.number_reflns_all 1585 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_obs ? # _struct.entry_id 5X4Y _struct.title 'Mutant human thymidylate synthase M190K crystallized in a sulfate-containing condition' _struct.pdbx_descriptor 'Thymidylate synthase (E.C.2.1.1.45)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5X4Y _struct_keywords.text 'methyltransferase, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 30 ? GLY A 45 ? GLY A 29 GLY A 44 1 ? 16 HELX_P HELX_P2 AA2 PHE A 81 ? LYS A 94 ? PHE A 80 LYS A 93 1 ? 14 HELX_P HELX_P3 AA3 ASN A 98 ? SER A 104 ? ASN A 97 SER A 103 1 ? 7 HELX_P HELX_P4 AA4 ARG A 116 ? SER A 121 ? ARG A 115 SER A 120 1 ? 6 HELX_P HELX_P5 AA5 GLY A 123 ? GLY A 130 ? GLY A 122 GLY A 129 1 ? 8 HELX_P HELX_P6 AA6 TYR A 136 ? HIS A 142 ? TYR A 135 HIS A 141 1 ? 7 HELX_P HELX_P7 AA7 ASP A 160 ? ASN A 172 ? ASP A 159 ASN A 171 1 ? 13 HELX_P HELX_P8 AA8 ASN A 184 ? LEU A 188 ? ASN A 183 LEU A 187 5 ? 5 HELX_P HELX_P9 AA9 PRO A 189 ? LEU A 193 ? PRO A 188 LEU A 192 5 ? 5 HELX_P HELX_P10 AB1 LEU A 222 ? THR A 242 ? LEU A 221 THR A 241 1 ? 21 HELX_P HELX_P11 AB2 HIS A 262 ? LEU A 270 ? HIS A 261 LEU A 269 1 ? 9 HELX_P HELX_P12 AB3 LYS A 288 ? PHE A 292 ? LYS A 287 PHE A 291 5 ? 5 HELX_P HELX_P13 AB4 LYS A 293 ? GLU A 295 ? LYS A 292 GLU A 294 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 188 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 187 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 189 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 188 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 21.62 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 46 ? ASP A 49 ? VAL A 45 ASP A 48 AA1 2 GLY A 55 ? SER A 67 ? GLY A 54 SER A 66 AA1 3 LYS A 245 ? TYR A 259 ? LYS A 244 TYR A 258 AA1 4 GLU A 208 ? ASP A 219 ? GLU A 207 ASP A 218 AA1 5 ALA A 198 ? VAL A 205 ? ALA A 197 VAL A 204 AA1 6 ILE A 179 ? ALA A 182 ? ILE A 178 ALA A 181 AA2 1 LYS A 279 ? ILE A 282 ? LYS A 278 ILE A 281 AA2 2 PHE A 297 ? GLU A 300 ? PHE A 296 GLU A 299 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 46 ? N VAL A 45 O SER A 58 ? O SER A 57 AA1 2 3 N TYR A 66 ? N TYR A 65 O PHE A 249 ? O PHE A 248 AA1 3 4 O THR A 252 ? O THR A 251 N LEU A 213 ? N LEU A 212 AA1 4 5 O TYR A 214 ? O TYR A 213 N LEU A 199 ? N LEU A 198 AA1 5 6 O CYS A 200 ? O CYS A 199 N MET A 180 ? N MET A 179 AA2 1 2 N ARG A 281 ? N ARG A 280 O GLN A 298 ? O GLN A 297 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 401 ? 3 'binding site for residue SO4 A 401' AC2 Software A SO4 402 ? 5 'binding site for residue SO4 A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ARG A 51 ? ARG A 50 . ? 1_555 ? 2 AC1 3 ARG A 177 ? ARG A 176 . ? 5_675 ? 3 AC1 3 ARG A 186 ? ARG A 185 . ? 1_555 ? 4 AC2 5 ARG A 176 ? ARG A 175 . ? 5_675 ? 5 AC2 5 ASN A 184 ? ASN A 183 . ? 1_555 ? 6 AC2 5 ARG A 186 ? ARG A 185 . ? 1_555 ? 7 AC2 5 ARG A 216 ? ARG A 215 . ? 1_555 ? 8 AC2 5 SER A 217 ? SER A 216 . ? 1_555 ? # _atom_sites.entry_id 5X4Y _atom_sites.fract_transf_matrix[1][1] 0.010422 _atom_sites.fract_transf_matrix[1][2] 0.006017 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012034 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012362 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 PRO 3 2 ? ? ? A . n A 1 4 VAL 4 3 ? ? ? A . n A 1 5 ALA 5 4 ? ? ? A . n A 1 6 GLY 6 5 ? ? ? A . n A 1 7 SER 7 6 ? ? ? A . n A 1 8 GLU 8 7 ? ? ? A . n A 1 9 LEU 9 8 ? ? ? A . n A 1 10 PRO 10 9 ? ? ? A . n A 1 11 ARG 11 10 ? ? ? A . n A 1 12 ARG 12 11 ? ? ? A . n A 1 13 PRO 13 12 ? ? ? A . n A 1 14 LEU 14 13 ? ? ? A . n A 1 15 PRO 15 14 ? ? ? A . n A 1 16 PRO 16 15 ? ? ? A . n A 1 17 ALA 17 16 ? ? ? A . n A 1 18 ALA 18 17 ? ? ? A . n A 1 19 GLN 19 18 ? ? ? A . n A 1 20 GLU 20 19 ? ? ? A . n A 1 21 ARG 21 20 ? ? ? A . n A 1 22 ASP 22 21 ? ? ? A . n A 1 23 ALA 23 22 ? ? ? A . n A 1 24 GLU 24 23 ? ? ? A . n A 1 25 PRO 25 24 ? ? ? A . n A 1 26 ARG 26 25 ? ? ? A . n A 1 27 PRO 27 26 ? ? ? A . n A 1 28 PRO 28 27 27 PRO PRO A . n A 1 29 HIS 29 28 28 HIS HIS A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 GLU 31 30 30 GLU GLU A . n A 1 32 LEU 32 31 31 LEU LEU A . n A 1 33 GLN 33 32 32 GLN GLN A . n A 1 34 TYR 34 33 33 TYR TYR A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 GLY 36 35 35 GLY GLY A . n A 1 37 GLN 37 36 36 GLN GLN A . n A 1 38 ILE 38 37 37 ILE ILE A . n A 1 39 GLN 39 38 38 GLN GLN A . n A 1 40 HIS 40 39 39 HIS HIS A . n A 1 41 ILE 41 40 40 ILE ILE A . n A 1 42 LEU 42 41 41 LEU LEU A . n A 1 43 ARG 43 42 42 ARG ARG A . n A 1 44 CYS 44 43 43 CYS CYS A . n A 1 45 GLY 45 44 44 GLY GLY A . n A 1 46 VAL 46 45 45 VAL VAL A . n A 1 47 ARG 47 46 46 ARG ARG A . n A 1 48 LYS 48 47 47 LYS LYS A . n A 1 49 ASP 49 48 48 ASP ASP A . n A 1 50 ASP 50 49 49 ASP ASP A . n A 1 51 ARG 51 50 50 ARG ARG A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 GLY 53 52 52 GLY GLY A . n A 1 54 THR 54 53 53 THR THR A . n A 1 55 GLY 55 54 54 GLY GLY A . n A 1 56 THR 56 55 55 THR THR A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 SER 58 57 57 SER SER A . n A 1 59 VAL 59 58 58 VAL VAL A . n A 1 60 PHE 60 59 59 PHE PHE A . n A 1 61 GLY 61 60 60 GLY GLY A . n A 1 62 MET 62 61 61 MET MET A . n A 1 63 GLN 63 62 62 GLN GLN A . n A 1 64 ALA 64 63 63 ALA ALA A . n A 1 65 ARG 65 64 64 ARG ARG A . n A 1 66 TYR 66 65 65 TYR TYR A . n A 1 67 SER 67 66 66 SER SER A . n A 1 68 LEU 68 67 67 LEU LEU A . n A 1 69 ARG 69 68 68 ARG ARG A . n A 1 70 ASP 70 69 69 ASP ASP A . n A 1 71 GLU 71 70 70 GLU GLU A . n A 1 72 PHE 72 71 71 PHE PHE A . n A 1 73 PRO 73 72 72 PRO PRO A . n A 1 74 LEU 74 73 73 LEU LEU A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 THR 76 75 75 THR THR A . n A 1 77 THR 77 76 76 THR THR A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 ARG 79 78 78 ARG ARG A . n A 1 80 VAL 80 79 79 VAL VAL A . n A 1 81 PHE 81 80 80 PHE PHE A . n A 1 82 TRP 82 81 81 TRP TRP A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 VAL 85 84 84 VAL VAL A . n A 1 86 LEU 86 85 85 LEU LEU A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 LEU 89 88 88 LEU LEU A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 TRP 91 90 90 TRP TRP A . n A 1 92 PHE 92 91 91 PHE PHE A . n A 1 93 ILE 93 92 92 ILE ILE A . n A 1 94 LYS 94 93 93 LYS LYS A . n A 1 95 GLY 95 94 94 GLY GLY A . n A 1 96 SER 96 95 95 SER SER A . n A 1 97 THR 97 96 96 THR THR A . n A 1 98 ASN 98 97 97 ASN ASN A . n A 1 99 ALA 99 98 98 ALA ALA A . n A 1 100 LYS 100 99 99 LYS LYS A . n A 1 101 GLU 101 100 100 GLU GLU A . n A 1 102 LEU 102 101 101 LEU LEU A . n A 1 103 SER 103 102 102 SER SER A . n A 1 104 SER 104 103 103 SER SER A . n A 1 105 LYS 105 104 104 LYS LYS A . n A 1 106 GLY 106 105 105 GLY GLY A . n A 1 107 VAL 107 106 106 VAL VAL A . n A 1 108 LYS 108 107 ? ? ? A . n A 1 109 ILE 109 108 ? ? ? A . n A 1 110 TRP 110 109 ? ? ? A . n A 1 111 ASP 111 110 ? ? ? A . n A 1 112 ALA 112 111 ? ? ? A . n A 1 113 ASN 113 112 ? ? ? A . n A 1 114 GLY 114 113 ? ? ? A . n A 1 115 SER 115 114 114 SER SER A . n A 1 116 ARG 116 115 115 ARG ARG A . n A 1 117 ASP 117 116 116 ASP ASP A . n A 1 118 PHE 118 117 117 PHE PHE A . n A 1 119 LEU 119 118 118 LEU LEU A . n A 1 120 ASP 120 119 119 ASP ASP A . n A 1 121 SER 121 120 120 SER SER A . n A 1 122 LEU 122 121 121 LEU LEU A . n A 1 123 GLY 123 122 122 GLY GLY A . n A 1 124 PHE 124 123 123 PHE PHE A . n A 1 125 SER 125 124 124 SER SER A . n A 1 126 THR 126 125 125 THR THR A . n A 1 127 ARG 127 126 126 ARG ARG A . n A 1 128 GLU 128 127 127 GLU GLU A . n A 1 129 GLU 129 128 128 GLU GLU A . n A 1 130 GLY 130 129 129 GLY GLY A . n A 1 131 ASP 131 130 130 ASP ASP A . n A 1 132 LEU 132 131 131 LEU LEU A . n A 1 133 GLY 133 132 132 GLY GLY A . n A 1 134 PRO 134 133 133 PRO PRO A . n A 1 135 VAL 135 134 134 VAL VAL A . n A 1 136 TYR 136 135 135 TYR TYR A . n A 1 137 GLY 137 136 136 GLY GLY A . n A 1 138 PHE 138 137 137 PHE PHE A . n A 1 139 GLN 139 138 138 GLN GLN A . n A 1 140 TRP 140 139 139 TRP TRP A . n A 1 141 ARG 141 140 140 ARG ARG A . n A 1 142 HIS 142 141 141 HIS HIS A . n A 1 143 PHE 143 142 142 PHE PHE A . n A 1 144 GLY 144 143 143 GLY GLY A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 GLU 146 145 145 GLU GLU A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 ARG 148 147 147 ARG ARG A . n A 1 149 ASP 149 148 148 ASP ASP A . n A 1 150 MET 150 149 149 MET MET A . n A 1 151 GLU 151 150 150 GLU GLU A . n A 1 152 SER 152 151 151 SER SER A . n A 1 153 ASP 153 152 152 ASP ASP A . n A 1 154 TYR 154 153 153 TYR TYR A . n A 1 155 SER 155 154 154 SER SER A . n A 1 156 GLY 156 155 155 GLY GLY A . n A 1 157 GLN 157 156 156 GLN GLN A . n A 1 158 GLY 158 157 157 GLY GLY A . n A 1 159 VAL 159 158 158 VAL VAL A . n A 1 160 ASP 160 159 159 ASP ASP A . n A 1 161 GLN 161 160 160 GLN GLN A . n A 1 162 LEU 162 161 161 LEU LEU A . n A 1 163 GLN 163 162 162 GLN GLN A . n A 1 164 ARG 164 163 163 ARG ARG A . n A 1 165 VAL 165 164 164 VAL VAL A . n A 1 166 ILE 166 165 165 ILE ILE A . n A 1 167 ASP 167 166 166 ASP ASP A . n A 1 168 THR 168 167 167 THR THR A . n A 1 169 ILE 169 168 168 ILE ILE A . n A 1 170 LYS 170 169 169 LYS LYS A . n A 1 171 THR 171 170 170 THR THR A . n A 1 172 ASN 172 171 171 ASN ASN A . n A 1 173 PRO 173 172 172 PRO PRO A . n A 1 174 ASP 174 173 173 ASP ASP A . n A 1 175 ASP 175 174 174 ASP ASP A . n A 1 176 ARG 176 175 175 ARG ARG A . n A 1 177 ARG 177 176 176 ARG ARG A . n A 1 178 ILE 178 177 177 ILE ILE A . n A 1 179 ILE 179 178 178 ILE ILE A . n A 1 180 MET 180 179 179 MET MET A . n A 1 181 CYS 181 180 180 CYS CYS A . n A 1 182 ALA 182 181 181 ALA ALA A . n A 1 183 TRP 183 182 182 TRP TRP A . n A 1 184 ASN 184 183 183 ASN ASN A . n A 1 185 PRO 185 184 184 PRO PRO A . n A 1 186 ARG 186 185 185 ARG ARG A . n A 1 187 ASP 187 186 186 ASP ASP A . n A 1 188 LEU 188 187 187 LEU LEU A . n A 1 189 PRO 189 188 188 PRO PRO A . n A 1 190 LEU 190 189 189 LEU LEU A . n A 1 191 LYS 191 190 190 LYS LYS A . n A 1 192 ALA 192 191 191 ALA ALA A . n A 1 193 LEU 193 192 192 LEU LEU A . n A 1 194 PRO 194 193 193 PRO PRO A . n A 1 195 PRO 195 194 194 PRO PRO A . n A 1 196 CYS 196 195 195 CYS CYS A . n A 1 197 HIS 197 196 196 HIS HIS A . n A 1 198 ALA 198 197 197 ALA ALA A . n A 1 199 LEU 199 198 198 LEU LEU A . n A 1 200 CYS 200 199 199 CYS CYS A . n A 1 201 GLN 201 200 200 GLN GLN A . n A 1 202 PHE 202 201 201 PHE PHE A . n A 1 203 TYR 203 202 202 TYR TYR A . n A 1 204 VAL 204 203 203 VAL VAL A . n A 1 205 VAL 205 204 204 VAL VAL A . n A 1 206 ASN 206 205 205 ASN ASN A . n A 1 207 SER 207 206 206 SER SER A . n A 1 208 GLU 208 207 207 GLU GLU A . n A 1 209 LEU 209 208 208 LEU LEU A . n A 1 210 SER 210 209 209 SER SER A . n A 1 211 CYS 211 210 210 CYS CYS A . n A 1 212 GLN 212 211 211 GLN GLN A . n A 1 213 LEU 213 212 212 LEU LEU A . n A 1 214 TYR 214 213 213 TYR TYR A . n A 1 215 GLN 215 214 214 GLN GLN A . n A 1 216 ARG 216 215 215 ARG ARG A . n A 1 217 SER 217 216 216 SER SER A . n A 1 218 GLY 218 217 217 GLY GLY A . n A 1 219 ASP 219 218 218 ASP ASP A . n A 1 220 MET 220 219 219 MET MET A . n A 1 221 GLY 221 220 220 GLY GLY A . n A 1 222 LEU 222 221 221 LEU LEU A . n A 1 223 GLY 223 222 222 GLY GLY A . n A 1 224 VAL 224 223 223 VAL VAL A . n A 1 225 PRO 225 224 224 PRO PRO A . n A 1 226 PHE 226 225 225 PHE PHE A . n A 1 227 ASN 227 226 226 ASN ASN A . n A 1 228 ILE 228 227 227 ILE ILE A . n A 1 229 ALA 229 228 228 ALA ALA A . n A 1 230 SER 230 229 229 SER SER A . n A 1 231 TYR 231 230 230 TYR TYR A . n A 1 232 ALA 232 231 231 ALA ALA A . n A 1 233 LEU 233 232 232 LEU LEU A . n A 1 234 LEU 234 233 233 LEU LEU A . n A 1 235 THR 235 234 234 THR THR A . n A 1 236 TYR 236 235 235 TYR TYR A . n A 1 237 MET 237 236 236 MET MET A . n A 1 238 ILE 238 237 237 ILE ILE A . n A 1 239 ALA 239 238 238 ALA ALA A . n A 1 240 HIS 240 239 239 HIS HIS A . n A 1 241 ILE 241 240 240 ILE ILE A . n A 1 242 THR 242 241 241 THR THR A . n A 1 243 GLY 243 242 242 GLY GLY A . n A 1 244 LEU 244 243 243 LEU LEU A . n A 1 245 LYS 245 244 244 LYS LYS A . n A 1 246 PRO 246 245 245 PRO PRO A . n A 1 247 GLY 247 246 246 GLY GLY A . n A 1 248 ASP 248 247 247 ASP ASP A . n A 1 249 PHE 249 248 248 PHE PHE A . n A 1 250 ILE 250 249 249 ILE ILE A . n A 1 251 HIS 251 250 250 HIS HIS A . n A 1 252 THR 252 251 251 THR THR A . n A 1 253 LEU 253 252 252 LEU LEU A . n A 1 254 GLY 254 253 253 GLY GLY A . n A 1 255 ASP 255 254 254 ASP ASP A . n A 1 256 ALA 256 255 255 ALA ALA A . n A 1 257 HIS 257 256 256 HIS HIS A . n A 1 258 ILE 258 257 257 ILE ILE A . n A 1 259 TYR 259 258 258 TYR TYR A . n A 1 260 LEU 260 259 259 LEU LEU A . n A 1 261 ASN 261 260 260 ASN ASN A . n A 1 262 HIS 262 261 261 HIS HIS A . n A 1 263 ILE 263 262 262 ILE ILE A . n A 1 264 GLU 264 263 263 GLU GLU A . n A 1 265 PRO 265 264 264 PRO PRO A . n A 1 266 LEU 266 265 265 LEU LEU A . n A 1 267 LYS 267 266 266 LYS LYS A . n A 1 268 ILE 268 267 267 ILE ILE A . n A 1 269 GLN 269 268 268 GLN GLN A . n A 1 270 LEU 270 269 269 LEU LEU A . n A 1 271 GLN 271 270 270 GLN GLN A . n A 1 272 ARG 272 271 271 ARG ARG A . n A 1 273 GLU 273 272 272 GLU GLU A . n A 1 274 PRO 274 273 273 PRO PRO A . n A 1 275 ARG 275 274 274 ARG ARG A . n A 1 276 PRO 276 275 275 PRO PRO A . n A 1 277 PHE 277 276 276 PHE PHE A . n A 1 278 PRO 278 277 277 PRO PRO A . n A 1 279 LYS 279 278 278 LYS LYS A . n A 1 280 LEU 280 279 279 LEU LEU A . n A 1 281 ARG 281 280 280 ARG ARG A . n A 1 282 ILE 282 281 281 ILE ILE A . n A 1 283 LEU 283 282 282 LEU LEU A . n A 1 284 ARG 284 283 283 ARG ARG A . n A 1 285 LYS 285 284 284 LYS LYS A . n A 1 286 VAL 286 285 285 VAL VAL A . n A 1 287 GLU 287 286 286 GLU GLU A . n A 1 288 LYS 288 287 287 LYS LYS A . n A 1 289 ILE 289 288 288 ILE ILE A . n A 1 290 ASP 290 289 289 ASP ASP A . n A 1 291 ASP 291 290 290 ASP ASP A . n A 1 292 PHE 292 291 291 PHE PHE A . n A 1 293 LYS 293 292 292 LYS LYS A . n A 1 294 ALA 294 293 293 ALA ALA A . n A 1 295 GLU 295 294 294 GLU GLU A . n A 1 296 ASP 296 295 295 ASP ASP A . n A 1 297 PHE 297 296 296 PHE PHE A . n A 1 298 GLN 298 297 297 GLN GLN A . n A 1 299 ILE 299 298 298 ILE ILE A . n A 1 300 GLU 300 299 299 GLU GLU A . n A 1 301 GLY 301 300 300 GLY GLY A . n A 1 302 TYR 302 301 301 TYR TYR A . n A 1 303 ASN 303 302 302 ASN ASN A . n A 1 304 PRO 304 303 303 PRO PRO A . n A 1 305 HIS 305 304 304 HIS HIS A . n A 1 306 PRO 306 305 305 PRO PRO A . n A 1 307 THR 307 306 306 THR THR A . n A 1 308 ILE 308 307 307 ILE ILE A . n A 1 309 LYS 309 308 308 LYS LYS A . n A 1 310 MET 310 309 309 MET MET A . n A 1 311 GLU 311 310 310 GLU GLU A . n A 1 312 MET 312 311 311 MET MET A . n A 1 313 ALA 313 312 ? ? ? A . n A 1 314 VAL 314 313 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 1 SO4 SO4 A . C 2 SO4 1 402 2 SO4 SO4 A . D 3 HOH 1 501 184 HOH HOH A . D 3 HOH 2 502 196 HOH HOH A . D 3 HOH 3 503 192 HOH HOH A . D 3 HOH 4 504 187 HOH HOH A . D 3 HOH 5 505 224 HOH HOH A . D 3 HOH 6 506 190 HOH HOH A . D 3 HOH 7 507 72 HOH HOH A . D 3 HOH 8 508 58 HOH HOH A . D 3 HOH 9 509 210 HOH HOH A . D 3 HOH 10 510 10 HOH HOH A . D 3 HOH 11 511 48 HOH HOH A . D 3 HOH 12 512 138 HOH HOH A . D 3 HOH 13 513 221 HOH HOH A . D 3 HOH 14 514 13 HOH HOH A . D 3 HOH 15 515 185 HOH HOH A . D 3 HOH 16 516 21 HOH HOH A . D 3 HOH 17 517 32 HOH HOH A . D 3 HOH 18 518 36 HOH HOH A . D 3 HOH 19 519 197 HOH HOH A . D 3 HOH 20 520 186 HOH HOH A . D 3 HOH 21 521 2 HOH HOH A . D 3 HOH 22 522 18 HOH HOH A . D 3 HOH 23 523 77 HOH HOH A . D 3 HOH 24 524 64 HOH HOH A . D 3 HOH 25 525 34 HOH HOH A . D 3 HOH 26 526 79 HOH HOH A . D 3 HOH 27 527 188 HOH HOH A . D 3 HOH 28 528 44 HOH HOH A . D 3 HOH 29 529 31 HOH HOH A . D 3 HOH 30 530 189 HOH HOH A . D 3 HOH 31 531 4 HOH HOH A . D 3 HOH 32 532 46 HOH HOH A . D 3 HOH 33 533 55 HOH HOH A . D 3 HOH 34 534 37 HOH HOH A . D 3 HOH 35 535 76 HOH HOH A . D 3 HOH 36 536 35 HOH HOH A . D 3 HOH 37 537 230 HOH HOH A . D 3 HOH 38 538 11 HOH HOH A . D 3 HOH 39 539 14 HOH HOH A . D 3 HOH 40 540 68 HOH HOH A . D 3 HOH 41 541 59 HOH HOH A . D 3 HOH 42 542 52 HOH HOH A . D 3 HOH 43 543 195 HOH HOH A . D 3 HOH 44 544 106 HOH HOH A . D 3 HOH 45 545 191 HOH HOH A . D 3 HOH 46 546 81 HOH HOH A . D 3 HOH 47 547 17 HOH HOH A . D 3 HOH 48 548 26 HOH HOH A . D 3 HOH 49 549 74 HOH HOH A . D 3 HOH 50 550 219 HOH HOH A . D 3 HOH 51 551 22 HOH HOH A . D 3 HOH 52 552 71 HOH HOH A . D 3 HOH 53 553 91 HOH HOH A . D 3 HOH 54 554 209 HOH HOH A . D 3 HOH 55 555 180 HOH HOH A . D 3 HOH 56 556 201 HOH HOH A . D 3 HOH 57 557 212 HOH HOH A . D 3 HOH 58 558 203 HOH HOH A . D 3 HOH 59 559 182 HOH HOH A . D 3 HOH 60 560 23 HOH HOH A . D 3 HOH 61 561 27 HOH HOH A . D 3 HOH 62 562 204 HOH HOH A . D 3 HOH 63 563 42 HOH HOH A . D 3 HOH 64 564 66 HOH HOH A . D 3 HOH 65 565 12 HOH HOH A . D 3 HOH 66 566 85 HOH HOH A . D 3 HOH 67 567 16 HOH HOH A . D 3 HOH 68 568 124 HOH HOH A . D 3 HOH 69 569 25 HOH HOH A . D 3 HOH 70 570 8 HOH HOH A . D 3 HOH 71 571 40 HOH HOH A . D 3 HOH 72 572 5 HOH HOH A . D 3 HOH 73 573 29 HOH HOH A . D 3 HOH 74 574 70 HOH HOH A . D 3 HOH 75 575 84 HOH HOH A . D 3 HOH 76 576 1 HOH HOH A . D 3 HOH 77 577 225 HOH HOH A . D 3 HOH 78 578 98 HOH HOH A . D 3 HOH 79 579 229 HOH HOH A . D 3 HOH 80 580 215 HOH HOH A . D 3 HOH 81 581 105 HOH HOH A . D 3 HOH 82 582 181 HOH HOH A . D 3 HOH 83 583 3 HOH HOH A . D 3 HOH 84 584 216 HOH HOH A . D 3 HOH 85 585 53 HOH HOH A . D 3 HOH 86 586 111 HOH HOH A . D 3 HOH 87 587 49 HOH HOH A . D 3 HOH 88 588 183 HOH HOH A . D 3 HOH 89 589 43 HOH HOH A . D 3 HOH 90 590 38 HOH HOH A . D 3 HOH 91 591 33 HOH HOH A . D 3 HOH 92 592 132 HOH HOH A . D 3 HOH 93 593 198 HOH HOH A . D 3 HOH 94 594 208 HOH HOH A . D 3 HOH 95 595 51 HOH HOH A . D 3 HOH 96 596 166 HOH HOH A . D 3 HOH 97 597 211 HOH HOH A . D 3 HOH 98 598 163 HOH HOH A . D 3 HOH 99 599 28 HOH HOH A . D 3 HOH 100 600 57 HOH HOH A . D 3 HOH 101 601 82 HOH HOH A . D 3 HOH 102 602 86 HOH HOH A . D 3 HOH 103 603 7 HOH HOH A . D 3 HOH 104 604 199 HOH HOH A . D 3 HOH 105 605 168 HOH HOH A . D 3 HOH 106 606 140 HOH HOH A . D 3 HOH 107 607 171 HOH HOH A . D 3 HOH 108 608 206 HOH HOH A . D 3 HOH 109 609 24 HOH HOH A . D 3 HOH 110 610 178 HOH HOH A . D 3 HOH 111 611 207 HOH HOH A . D 3 HOH 112 612 220 HOH HOH A . D 3 HOH 113 613 103 HOH HOH A . D 3 HOH 114 614 223 HOH HOH A . D 3 HOH 115 615 218 HOH HOH A . D 3 HOH 116 616 96 HOH HOH A . D 3 HOH 117 617 134 HOH HOH A . D 3 HOH 118 618 214 HOH HOH A . D 3 HOH 119 619 222 HOH HOH A . D 3 HOH 120 620 213 HOH HOH A . D 3 HOH 121 621 200 HOH HOH A . D 3 HOH 122 622 116 HOH HOH A . D 3 HOH 123 623 161 HOH HOH A . D 3 HOH 124 624 167 HOH HOH A . D 3 HOH 125 625 60 HOH HOH A . D 3 HOH 126 626 165 HOH HOH A . D 3 HOH 127 627 194 HOH HOH A . D 3 HOH 128 628 54 HOH HOH A . D 3 HOH 129 629 226 HOH HOH A . D 3 HOH 130 630 228 HOH HOH A . D 3 HOH 131 631 169 HOH HOH A . D 3 HOH 132 632 205 HOH HOH A . D 3 HOH 133 633 170 HOH HOH A . D 3 HOH 134 634 179 HOH HOH A . D 3 HOH 135 635 227 HOH HOH A . D 3 HOH 136 636 217 HOH HOH A . D 3 HOH 137 637 164 HOH HOH A . D 3 HOH 138 638 193 HOH HOH A . D 3 HOH 139 639 172 HOH HOH A . D 3 HOH 140 640 202 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4860 ? 1 MORE -71 ? 1 'SSA (A^2)' 23190 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_675 x-y+1,-y+2,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 166.1920070370 0.0000000000 0.0000000000 -1.0000000000 53.9266666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-28 2 'Structure model' 1 1 2017-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0155 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.22 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 135 ? ? 50.22 -126.62 2 1 ARG A 147 ? ? -121.79 -86.75 3 1 SER A 151 ? ? -45.97 154.44 4 1 ASN A 171 ? ? -158.30 85.60 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 42 ? CG ? A ARG 43 CG 2 1 Y 1 A ARG 42 ? CD ? A ARG 43 CD 3 1 Y 1 A ARG 42 ? NE ? A ARG 43 NE 4 1 Y 1 A ARG 42 ? CZ ? A ARG 43 CZ 5 1 Y 1 A ARG 42 ? NH1 ? A ARG 43 NH1 6 1 Y 1 A ARG 42 ? NH2 ? A ARG 43 NH2 7 1 Y 1 A LYS 99 ? CG ? A LYS 100 CG 8 1 Y 1 A LYS 99 ? CD ? A LYS 100 CD 9 1 Y 1 A LYS 99 ? CE ? A LYS 100 CE 10 1 Y 1 A LYS 99 ? NZ ? A LYS 100 NZ 11 1 Y 1 A ARG 115 ? CG ? A ARG 116 CG 12 1 Y 1 A ARG 115 ? CD ? A ARG 116 CD 13 1 Y 1 A ARG 115 ? NE ? A ARG 116 NE 14 1 Y 1 A ARG 115 ? CZ ? A ARG 116 CZ 15 1 Y 1 A ARG 115 ? NH1 ? A ARG 116 NH1 16 1 Y 1 A ARG 115 ? NH2 ? A ARG 116 NH2 17 1 Y 1 A LYS 190 ? CG ? A LYS 191 CG 18 1 Y 1 A LYS 190 ? CD ? A LYS 191 CD 19 1 Y 1 A LYS 190 ? CE ? A LYS 191 CE 20 1 Y 1 A LYS 190 ? NZ ? A LYS 191 NZ 21 1 Y 1 A LEU 192 ? CG ? A LEU 193 CG 22 1 Y 1 A LEU 192 ? CD1 ? A LEU 193 CD1 23 1 Y 1 A LEU 192 ? CD2 ? A LEU 193 CD2 24 1 Y 1 A LYS 244 ? CD ? A LYS 245 CD 25 1 Y 1 A LYS 244 ? CE ? A LYS 245 CE 26 1 Y 1 A LYS 244 ? NZ ? A LYS 245 NZ 27 1 Y 1 A LYS 284 ? CD ? A LYS 285 CD 28 1 Y 1 A LYS 284 ? CE ? A LYS 285 CE 29 1 Y 1 A LYS 284 ? NZ ? A LYS 285 NZ 30 1 Y 1 A LYS 308 ? CD ? A LYS 309 CD 31 1 Y 1 A LYS 308 ? CE ? A LYS 309 CE 32 1 Y 1 A LYS 308 ? NZ ? A LYS 309 NZ 33 1 Y 1 A MET 311 ? CG ? A MET 312 CG 34 1 Y 1 A MET 311 ? SD ? A MET 312 SD 35 1 Y 1 A MET 311 ? CE ? A MET 312 CE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 0 ? A SER 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A PRO 2 ? A PRO 3 4 1 Y 1 A VAL 3 ? A VAL 4 5 1 Y 1 A ALA 4 ? A ALA 5 6 1 Y 1 A GLY 5 ? A GLY 6 7 1 Y 1 A SER 6 ? A SER 7 8 1 Y 1 A GLU 7 ? A GLU 8 9 1 Y 1 A LEU 8 ? A LEU 9 10 1 Y 1 A PRO 9 ? A PRO 10 11 1 Y 1 A ARG 10 ? A ARG 11 12 1 Y 1 A ARG 11 ? A ARG 12 13 1 Y 1 A PRO 12 ? A PRO 13 14 1 Y 1 A LEU 13 ? A LEU 14 15 1 Y 1 A PRO 14 ? A PRO 15 16 1 Y 1 A PRO 15 ? A PRO 16 17 1 Y 1 A ALA 16 ? A ALA 17 18 1 Y 1 A ALA 17 ? A ALA 18 19 1 Y 1 A GLN 18 ? A GLN 19 20 1 Y 1 A GLU 19 ? A GLU 20 21 1 Y 1 A ARG 20 ? A ARG 21 22 1 Y 1 A ASP 21 ? A ASP 22 23 1 Y 1 A ALA 22 ? A ALA 23 24 1 Y 1 A GLU 23 ? A GLU 24 25 1 Y 1 A PRO 24 ? A PRO 25 26 1 Y 1 A ARG 25 ? A ARG 26 27 1 Y 1 A PRO 26 ? A PRO 27 28 1 Y 1 A LYS 107 ? A LYS 108 29 1 Y 1 A ILE 108 ? A ILE 109 30 1 Y 1 A TRP 109 ? A TRP 110 31 1 Y 1 A ASP 110 ? A ASP 111 32 1 Y 1 A ALA 111 ? A ALA 112 33 1 Y 1 A ASN 112 ? A ASN 113 34 1 Y 1 A GLY 113 ? A GLY 114 35 1 Y 1 A ALA 312 ? A ALA 313 36 1 Y 1 A VAL 313 ? A VAL 314 # _pdbx_audit_support.funding_organization 'Nanyang Technological University' _pdbx_audit_support.country Singapore _pdbx_audit_support.grant_number M060080004.70301200 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #