data_5XBN # _entry.id 5XBN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.288 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5XBN WWPDB D_1300003249 # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5XBV _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5XBN _pdbx_database_status.recvd_initial_deposition_date 2017-03-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dong, Y.H.' 1 ? 'Yang, X.Y.' 2 ? 'Wang, W.J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'crystal structure of Wss1 from saccharomyces cerevisiae' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Dong, Y.H.' 1 primary 'Yang, X.Y.' 2 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5XBN _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.195 _cell.length_a_esd ? _cell.length_b 75.195 _cell.length_b_esd ? _cell.length_c 43.739 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5XBN _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Wss1p 17657.355 1 ? ? 'UNP residues 1-148' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 80 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)KAEGIKSPSAKYHD(MSE)AGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYL(MSE)KENHFKVTN LVEFYPRDQRLLG(MSE)NVNHGSKI(MSE)LRLRCSTDEFQFLP(MSE)ECI(MSE)GT(MSE)LHELTHNLFGPHDKK FYNKLDELIGRQWVIEQRGL ; _entity_poly.pdbx_seq_one_letter_code_can ;MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYLMKENHFKVTNLVEFYPRDQRLL GMNVNHGSKIMLRLRCSTDEFQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 LYS n 1 3 ALA n 1 4 GLU n 1 5 GLY n 1 6 ILE n 1 7 LYS n 1 8 SER n 1 9 PRO n 1 10 SER n 1 11 ALA n 1 12 LYS n 1 13 TYR n 1 14 HIS n 1 15 ASP n 1 16 MSE n 1 17 ALA n 1 18 GLY n 1 19 SER n 1 20 GLN n 1 21 ARG n 1 22 ILE n 1 23 PRO n 1 24 HIS n 1 25 LYS n 1 26 ASN n 1 27 PRO n 1 28 HIS n 1 29 ILE n 1 30 GLN n 1 31 LYS n 1 32 VAL n 1 33 ALA n 1 34 VAL n 1 35 LEU n 1 36 GLN n 1 37 SER n 1 38 LYS n 1 39 PRO n 1 40 ASN n 1 41 LYS n 1 42 GLU n 1 43 ASP n 1 44 ALA n 1 45 LEU n 1 46 ASN n 1 47 LEU n 1 48 ILE n 1 49 LYS n 1 50 GLU n 1 51 ILE n 1 52 ALA n 1 53 HIS n 1 54 LYS n 1 55 VAL n 1 56 SER n 1 57 TYR n 1 58 LEU n 1 59 MSE n 1 60 LYS n 1 61 GLU n 1 62 ASN n 1 63 HIS n 1 64 PHE n 1 65 LYS n 1 66 VAL n 1 67 THR n 1 68 ASN n 1 69 LEU n 1 70 VAL n 1 71 GLU n 1 72 PHE n 1 73 TYR n 1 74 PRO n 1 75 ARG n 1 76 ASP n 1 77 GLN n 1 78 ARG n 1 79 LEU n 1 80 LEU n 1 81 GLY n 1 82 MSE n 1 83 ASN n 1 84 VAL n 1 85 ASN n 1 86 HIS n 1 87 GLY n 1 88 SER n 1 89 LYS n 1 90 ILE n 1 91 MSE n 1 92 LEU n 1 93 ARG n 1 94 LEU n 1 95 ARG n 1 96 CYS n 1 97 SER n 1 98 THR n 1 99 ASP n 1 100 GLU n 1 101 PHE n 1 102 GLN n 1 103 PHE n 1 104 LEU n 1 105 PRO n 1 106 MSE n 1 107 GLU n 1 108 CYS n 1 109 ILE n 1 110 MSE n 1 111 GLY n 1 112 THR n 1 113 MSE n 1 114 LEU n 1 115 HIS n 1 116 GLU n 1 117 LEU n 1 118 THR n 1 119 HIS n 1 120 ASN n 1 121 LEU n 1 122 PHE n 1 123 GLY n 1 124 PRO n 1 125 HIS n 1 126 ASP n 1 127 LYS n 1 128 LYS n 1 129 PHE n 1 130 TYR n 1 131 ASN n 1 132 LYS n 1 133 LEU n 1 134 ASP n 1 135 GLU n 1 136 LEU n 1 137 ILE n 1 138 GLY n 1 139 ARG n 1 140 GLN n 1 141 TRP n 1 142 VAL n 1 143 ILE n 1 144 GLU n 1 145 GLN n 1 146 ARG n 1 147 GLY n 1 148 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 148 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FOSTERSO_2154 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain FostersO _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae FostersO' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 764101 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E7NIN2_YEASO _struct_ref.pdbx_db_accession E7NIN2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYLMKENHFKVTNLVEFYPRDQRLL GMNVNHGSKIMLRLRCSTDEFQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XBN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E7NIN2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XBN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20%(w/v) PEG-3500, 8%(v/v) Tacsimate, pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-05-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5XBN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.76 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 28156 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 82.913 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ;AUTHORS TREATED THE DATA SET AS AN ANOMALOUS ONE IN REFINEMENT, HOWEVER, IT WAS TREATED AS A NATIVE ONE IN DATA COLLECTION STATISTICS. ; _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5XBN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.761 _refine.ls_d_res_low 37.597 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 27333 _refine.ls_number_reflns_R_free 2749 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.79 _refine.ls_percent_reflns_R_free 10.06 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1853 _refine.ls_R_factor_R_free 0.2137 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1822 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.31 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.17 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1057 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 80 _refine_hist.number_atoms_total 1138 _refine_hist.d_res_high 1.761 _refine_hist.d_res_low 37.597 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1081 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.022 ? 1453 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.247 ? 419 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 157 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 186 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7607 1.7911 . . 134 1201 99.00 . . . 0.2711 . 0.2437 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7911 1.8237 . . 146 1251 100.00 . . . 0.2141 . 0.2097 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8237 1.8588 . . 136 1220 100.00 . . . 0.2561 . 0.1933 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8588 1.8967 . . 144 1212 100.00 . . . 0.1980 . 0.1848 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8967 1.9379 . . 148 1240 100.00 . . . 0.2358 . 0.1873 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9379 1.9830 . . 140 1252 100.00 . . . 0.1954 . 0.1925 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9830 2.0326 . . 128 1238 100.00 . . . 0.2424 . 0.1871 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0326 2.0876 . . 134 1207 100.00 . . . 0.1995 . 0.1909 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0876 2.1490 . . 132 1248 100.00 . . . 0.2348 . 0.1953 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1490 2.2183 . . 132 1236 100.00 . . . 0.2442 . 0.1856 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2183 2.2976 . . 132 1237 100.00 . . . 0.2499 . 0.1927 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2976 2.3896 . . 126 1220 100.00 . . . 0.2423 . 0.1929 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3896 2.4983 . . 140 1253 100.00 . . . 0.2145 . 0.2000 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4983 2.6300 . . 142 1199 100.00 . . . 0.2221 . 0.1887 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6300 2.7947 . . 138 1264 100.00 . . . 0.2619 . 0.1927 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7947 3.0104 . . 138 1225 100.00 . . . 0.2423 . 0.1953 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0104 3.3132 . . 144 1221 100.00 . . . 0.2093 . 0.1915 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3132 3.7923 . . 128 1237 100.00 . . . 0.1930 . 0.1619 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7923 4.7763 . . 142 1227 100.00 . . . 0.1688 . 0.1423 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7763 37.6061 . . 145 1196 98.00 . . . 0.2036 . 0.1906 . . . . . . . . . . # _struct.entry_id 5XBN _struct.title 'crystal structure of Wss1 from saccharomyces cerevisiae' _struct.pdbx_descriptor Wss1p _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XBN _struct_keywords.text 'protease, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 40 ? VAL A 55 ? ASN A 40 VAL A 55 1 ? 16 HELX_P HELX_P2 AA2 VAL A 55 ? HIS A 63 ? VAL A 55 HIS A 63 1 ? 9 HELX_P HELX_P3 AA3 PRO A 105 ? HIS A 119 ? PRO A 105 HIS A 119 1 ? 15 HELX_P HELX_P4 AA4 ASP A 126 ? ARG A 146 ? ASP A 126 ARG A 146 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A LEU 58 C ? ? ? 1_555 A MSE 59 N ? ? A LEU 58 A MSE 59 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale both ? A MSE 59 C ? ? ? 1_555 A LYS 60 N ? ? A MSE 59 A LYS 60 1_555 ? ? ? ? ? ? ? 1.331 ? covale3 covale both ? A GLY 81 C ? ? ? 1_555 A MSE 82 N ? ? A GLY 81 A MSE 82 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale both ? A MSE 82 C ? ? ? 1_555 A ASN 83 N ? ? A MSE 82 A ASN 83 1_555 ? ? ? ? ? ? ? 1.324 ? covale5 covale both ? A ILE 90 C ? ? ? 1_555 A MSE 91 N ? ? A ILE 90 A MSE 91 1_555 ? ? ? ? ? ? ? 1.333 ? covale6 covale both ? A MSE 91 C ? ? ? 1_555 A LEU 92 N ? ? A MSE 91 A LEU 92 1_555 ? ? ? ? ? ? ? 1.329 ? covale7 covale both ? A PRO 105 C ? ? ? 1_555 A MSE 106 N ? ? A PRO 105 A MSE 106 1_555 ? ? ? ? ? ? ? 1.327 ? covale8 covale both ? A MSE 106 C ? ? ? 1_555 A GLU 107 N ? ? A MSE 106 A GLU 107 1_555 ? ? ? ? ? ? ? 1.332 ? covale9 covale both ? A ILE 109 C ? ? ? 1_555 A MSE 110 N ? ? A ILE 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.330 ? covale10 covale both ? A MSE 110 C ? ? ? 1_555 A GLY 111 N ? ? A MSE 110 A GLY 111 1_555 ? ? ? ? ? ? ? 1.332 ? covale11 covale both ? A THR 112 C ? ? ? 1_555 A MSE 113 N ? ? A THR 112 A MSE 113 1_555 ? ? ? ? ? ? ? 1.329 ? covale12 covale both ? A MSE 113 C ? ? ? 1_555 A LEU 114 N ? ? A MSE 113 A LEU 114 1_555 ? ? ? ? ? ? ? 1.331 ? metalc1 metalc ? ? A HIS 115 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 115 A ZN 201 1_555 ? ? ? ? ? ? ? 1.968 ? metalc2 metalc ? ? A HIS 119 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 119 A ZN 201 1_555 ? ? ? ? ? ? ? 2.062 ? metalc3 metalc ? ? A HIS 125 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 125 A ZN 201 1_555 ? ? ? ? ? ? ? 1.992 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 C HOH . O ? ? A ZN 201 A HOH 361 1_555 ? ? ? ? ? ? ? 1.963 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 29 ? ALA A 33 ? ILE A 29 ALA A 33 AA1 2 VAL A 66 ? PHE A 72 ? VAL A 66 PHE A 72 AA1 3 LYS A 89 ? ARG A 93 ? LYS A 89 ARG A 93 AA1 4 GLY A 81 ? VAL A 84 ? GLY A 81 VAL A 84 AA2 1 ARG A 95 ? CYS A 96 ? ARG A 95 CYS A 96 AA2 2 ASP A 99 ? PHE A 103 ? ASP A 99 PHE A 103 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 31 ? N LYS A 31 O LEU A 69 ? O LEU A 69 AA1 2 3 N ASN A 68 ? N ASN A 68 O ILE A 90 ? O ILE A 90 AA1 3 4 O LYS A 89 ? O LYS A 89 N VAL A 84 ? N VAL A 84 AA2 1 2 N CYS A 96 ? N CYS A 96 O GLN A 102 ? O GLN A 102 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 115 ? HIS A 115 . ? 1_555 ? 2 AC1 5 HIS A 119 ? HIS A 119 . ? 1_555 ? 3 AC1 5 HIS A 125 ? HIS A 125 . ? 1_555 ? 4 AC1 5 HOH C . ? HOH A 325 . ? 1_555 ? 5 AC1 5 HOH C . ? HOH A 361 . ? 1_555 ? # _atom_sites.entry_id 5XBN _atom_sites.fract_transf_matrix[1][1] 0.013299 _atom_sites.fract_transf_matrix[1][2] 0.007678 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015356 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022863 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 ILE 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 PRO 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 LYS 12 12 ? ? ? A . n A 1 13 TYR 13 13 ? ? ? A . n A 1 14 HIS 14 14 ? ? ? A . n A 1 15 ASP 15 15 ? ? ? A . n A 1 16 MSE 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 GLN 20 20 ? ? ? A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 MSE 59 59 59 MSE MSE A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 MSE 82 82 82 MSE MSE A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 MSE 91 91 91 MSE MSE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 MSE 106 106 106 MSE MSE A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 MSE 110 110 110 MSE MSE A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 MSE 113 113 113 MSE MSE A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 LEU 148 148 148 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 1 ZN ZN A . C 3 HOH 1 301 52 HOH HOH A . C 3 HOH 2 302 38 HOH HOH A . C 3 HOH 3 303 68 HOH HOH A . C 3 HOH 4 304 9 HOH HOH A . C 3 HOH 5 305 14 HOH HOH A . C 3 HOH 6 306 43 HOH HOH A . C 3 HOH 7 307 51 HOH HOH A . C 3 HOH 8 308 12 HOH HOH A . C 3 HOH 9 309 37 HOH HOH A . C 3 HOH 10 310 36 HOH HOH A . C 3 HOH 11 311 28 HOH HOH A . C 3 HOH 12 312 67 HOH HOH A . C 3 HOH 13 313 73 HOH HOH A . C 3 HOH 14 314 60 HOH HOH A . C 3 HOH 15 315 41 HOH HOH A . C 3 HOH 16 316 6 HOH HOH A . C 3 HOH 17 317 30 HOH HOH A . C 3 HOH 18 318 34 HOH HOH A . C 3 HOH 19 319 26 HOH HOH A . C 3 HOH 20 320 46 HOH HOH A . C 3 HOH 21 321 2 HOH HOH A . C 3 HOH 22 322 5 HOH HOH A . C 3 HOH 23 323 17 HOH HOH A . C 3 HOH 24 324 61 HOH HOH A . C 3 HOH 25 325 3 HOH HOH A . C 3 HOH 26 326 40 HOH HOH A . C 3 HOH 27 327 7 HOH HOH A . C 3 HOH 28 328 27 HOH HOH A . C 3 HOH 29 329 8 HOH HOH A . C 3 HOH 30 330 21 HOH HOH A . C 3 HOH 31 331 48 HOH HOH A . C 3 HOH 32 332 56 HOH HOH A . C 3 HOH 33 333 1 HOH HOH A . C 3 HOH 34 334 23 HOH HOH A . C 3 HOH 35 335 29 HOH HOH A . C 3 HOH 36 336 42 HOH HOH A . C 3 HOH 37 337 75 HOH HOH A . C 3 HOH 38 338 32 HOH HOH A . C 3 HOH 39 339 50 HOH HOH A . C 3 HOH 40 340 64 HOH HOH A . C 3 HOH 41 341 47 HOH HOH A . C 3 HOH 42 342 66 HOH HOH A . C 3 HOH 43 343 58 HOH HOH A . C 3 HOH 44 344 72 HOH HOH A . C 3 HOH 45 345 15 HOH HOH A . C 3 HOH 46 346 69 HOH HOH A . C 3 HOH 47 347 16 HOH HOH A . C 3 HOH 48 348 78 HOH HOH A . C 3 HOH 49 349 44 HOH HOH A . C 3 HOH 50 350 22 HOH HOH A . C 3 HOH 51 351 19 HOH HOH A . C 3 HOH 52 352 57 HOH HOH A . C 3 HOH 53 353 13 HOH HOH A . C 3 HOH 54 354 70 HOH HOH A . C 3 HOH 55 355 10 HOH HOH A . C 3 HOH 56 356 35 HOH HOH A . C 3 HOH 57 357 55 HOH HOH A . C 3 HOH 58 358 20 HOH HOH A . C 3 HOH 59 359 53 HOH HOH A . C 3 HOH 60 360 25 HOH HOH A . C 3 HOH 61 361 2 HOH HOH A . C 3 HOH 62 362 71 HOH HOH A . C 3 HOH 63 363 82 HOH HOH A . C 3 HOH 64 364 77 HOH HOH A . C 3 HOH 65 365 62 HOH HOH A . C 3 HOH 66 366 80 HOH HOH A . C 3 HOH 67 367 74 HOH HOH A . C 3 HOH 68 368 49 HOH HOH A . C 3 HOH 69 369 11 HOH HOH A . C 3 HOH 70 370 31 HOH HOH A . C 3 HOH 71 371 63 HOH HOH A . C 3 HOH 72 372 39 HOH HOH A . C 3 HOH 73 373 45 HOH HOH A . C 3 HOH 74 374 33 HOH HOH A . C 3 HOH 75 375 24 HOH HOH A . C 3 HOH 76 376 76 HOH HOH A . C 3 HOH 77 377 81 HOH HOH A . C 3 HOH 78 378 59 HOH HOH A . C 3 HOH 79 379 79 HOH HOH A . C 3 HOH 80 380 83 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 59 A MSE 59 ? MET 'modified residue' 2 A MSE 82 A MSE 82 ? MET 'modified residue' 3 A MSE 91 A MSE 91 ? MET 'modified residue' 4 A MSE 106 A MSE 106 ? MET 'modified residue' 5 A MSE 110 A MSE 110 ? MET 'modified residue' 6 A MSE 113 A MSE 113 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -35 ? 1 'SSA (A^2)' 7700 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 115 ? A HIS 115 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 119 ? A HIS 119 ? 1_555 105.4 ? 2 NE2 ? A HIS 115 ? A HIS 115 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 125 ? A HIS 125 ? 1_555 107.7 ? 3 NE2 ? A HIS 119 ? A HIS 119 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 125 ? A HIS 125 ? 1_555 103.7 ? 4 NE2 ? A HIS 115 ? A HIS 115 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 361 ? 1_555 117.9 ? 5 NE2 ? A HIS 119 ? A HIS 119 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 361 ? 1_555 120.0 ? 6 NE2 ? A HIS 125 ? A HIS 125 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 361 ? 1_555 100.4 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2018-03-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 325 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 361 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 99 ? ? -164.82 100.17 2 1 ASP A 126 ? ? -111.02 -163.25 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 78 ? CD ? A ARG 78 CD 2 1 Y 1 A ARG 78 ? NE ? A ARG 78 NE 3 1 Y 1 A ARG 78 ? CZ ? A ARG 78 CZ 4 1 Y 1 A ARG 78 ? NH1 ? A ARG 78 NH1 5 1 Y 1 A ARG 78 ? NH2 ? A ARG 78 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A ILE 6 ? A ILE 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A PRO 9 ? A PRO 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A LYS 12 ? A LYS 12 13 1 Y 1 A TYR 13 ? A TYR 13 14 1 Y 1 A HIS 14 ? A HIS 14 15 1 Y 1 A ASP 15 ? A ASP 15 16 1 Y 1 A MSE 16 ? A MSE 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A SER 19 ? A SER 19 20 1 Y 1 A GLN 20 ? A GLN 20 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31600597 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? #