data_5XEE # _entry.id 5XEE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XEE pdb_00005xee 10.2210/pdb5xee/pdb WWPDB D_1300003370 ? ? BMRB 36071 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB 'NMR solution structure of the aromatic mutant H43F H67F cytochrome b5' 36071 unspecified PDB . 5XE4 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5XEE _pdbx_database_status.recvd_initial_deposition_date 2017-04-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Balakrishnan, S.' 1 ? 'Sarma, S.P.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 1520-4995 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 56 _citation.language ? _citation.page_first 4346 _citation.page_last 4359 _citation.title 'Engineering Aromatic-Aromatic Interactions To Nucleate Folding in Intrinsically Disordered Regions of Proteins' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.7b00437 _citation.pdbx_database_id_PubMed 28738155 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Balakrishnan, S.' 1 ? primary 'Sarma, S.P.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cytochrome b5' _entity.formula_weight 11275.436 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'H43F, H67F, T77K' _entity.pdbx_fragment 'UNP residues 2-99' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEFPGGEEVLREQAGGDATENFEDVGFSTDARELSKKYII GELHPDDRSKIAKPSETL ; _entity_poly.pdbx_seq_one_letter_code_can ;AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEFPGGEEVLREQAGGDATENFEDVGFSTDARELSKKYII GELHPDDRSKIAKPSETL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 GLN n 1 4 SER n 1 5 ASP n 1 6 LYS n 1 7 ASP n 1 8 VAL n 1 9 LYS n 1 10 TYR n 1 11 TYR n 1 12 THR n 1 13 LEU n 1 14 GLU n 1 15 GLU n 1 16 ILE n 1 17 GLN n 1 18 LYS n 1 19 HIS n 1 20 LYS n 1 21 ASP n 1 22 SER n 1 23 LYS n 1 24 SER n 1 25 THR n 1 26 TRP n 1 27 VAL n 1 28 ILE n 1 29 LEU n 1 30 HIS n 1 31 HIS n 1 32 LYS n 1 33 VAL n 1 34 TYR n 1 35 ASP n 1 36 LEU n 1 37 THR n 1 38 LYS n 1 39 PHE n 1 40 LEU n 1 41 GLU n 1 42 GLU n 1 43 PHE n 1 44 PRO n 1 45 GLY n 1 46 GLY n 1 47 GLU n 1 48 GLU n 1 49 VAL n 1 50 LEU n 1 51 ARG n 1 52 GLU n 1 53 GLN n 1 54 ALA n 1 55 GLY n 1 56 GLY n 1 57 ASP n 1 58 ALA n 1 59 THR n 1 60 GLU n 1 61 ASN n 1 62 PHE n 1 63 GLU n 1 64 ASP n 1 65 VAL n 1 66 GLY n 1 67 PHE n 1 68 SER n 1 69 THR n 1 70 ASP n 1 71 ALA n 1 72 ARG n 1 73 GLU n 1 74 LEU n 1 75 SER n 1 76 LYS n 1 77 LYS n 1 78 TYR n 1 79 ILE n 1 80 ILE n 1 81 GLY n 1 82 GLU n 1 83 LEU n 1 84 HIS n 1 85 PRO n 1 86 ASP n 1 87 ASP n 1 88 ARG n 1 89 SER n 1 90 LYS n 1 91 ILE n 1 92 ALA n 1 93 LYS n 1 94 PRO n 1 95 SER n 1 96 GLU n 1 97 THR n 1 98 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 98 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Cyb5a, Cyb5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYB5_RAT _struct_ref.pdbx_db_accession P00173 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYII GELHPDDRSKIAKPSETL ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XEE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00173 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 99 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 98 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5XEE PHE A 43 ? UNP P00173 HIS 44 'engineered mutation' 43 1 1 5XEE PHE A 67 ? UNP P00173 HIS 68 'engineered mutation' 67 2 1 5XEE LYS A 77 ? UNP P00173 THR 78 'engineered mutation' 77 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 2 isotropic 2 1 2 '3D HNCACB' 2 isotropic 3 1 2 '3D CBCA(CO)NH' 2 isotropic 4 1 2 '3D HNCA' 2 isotropic 5 1 2 '3D HNCO' 1 isotropic 6 1 2 '3D HN(CO)CA' 2 isotropic 7 1 1 '3D 1H-15N NOESY' 1 isotropic 8 1 3 '3D 1H-15N NOESY' 1 isotropic 9 1 1 '2D 1H-1H NOESY' 2 isotropic 10 1 2 '3D HCCH-TOCSY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 283 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure 101325 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details 'Proline, Arginine and Glutamate were added to sample for stability' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'FFcytb5 with PRE' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-99% 15N] FFcytb5, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '0.5 mM [U-13C; U-15N] FFcytb5, 90% H2O/10% D2O' '90% H2O/10% D2O' '13C 15N' solution ? 3 '0.5 mM [U-13C; U-15N; U-2H] FFcytb5, 90% H2O/10% D2O' '90% H2O/10% D2O' '13C 15N 2H' solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 700 ? 2 'Uniform NMR System' ? Varian 600 ? # _pdbx_nmr_refine.entry_id 5XEE _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 5XEE _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5XEE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Analysis ? CCPN 4 'peak picking' Analysis ? CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XEE _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5XEE _struct.title 'NMR solution structure of the aromatic mutant H43F H67F cytochrome b5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XEE _struct_keywords.text 'aromatic interaction, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 12 ? GLN A 17 ? THR A 12 GLN A 17 1 ? 6 HELX_P HELX_P2 AA2 ASP A 21 ? SER A 24 ? ASP A 21 SER A 24 5 ? 4 HELX_P HELX_P3 AA3 GLU A 47 ? GLU A 52 ? GLU A 47 GLU A 52 1 ? 6 HELX_P HELX_P4 AA4 GLU A 60 ? VAL A 65 ? GLU A 60 VAL A 65 1 ? 6 HELX_P HELX_P5 AA5 THR A 69 ? TYR A 78 ? THR A 69 TYR A 78 1 ? 10 HELX_P HELX_P6 AA6 ASP A 86 ? ILE A 91 ? ASP A 86 ILE A 91 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 9 ? TYR A 11 ? LYS A 9 TYR A 11 AA1 2 GLY A 81 ? LEU A 83 ? GLY A 81 LEU A 83 AA2 1 TRP A 26 ? ILE A 28 ? TRP A 26 ILE A 28 AA2 2 VAL A 33 ? ASP A 35 ? VAL A 33 ASP A 35 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 11 ? N TYR A 11 O GLU A 82 ? O GLU A 82 AA2 1 2 N VAL A 27 ? N VAL A 27 O TYR A 34 ? O TYR A 34 # _atom_sites.entry_id 5XEE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 LEU 98 98 98 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6360 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-14 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 FFcytb5 0.5 ? mM '[U-99% 15N]' 2 FFcytb5 0.5 ? mM '[U-13C; U-15N]' 3 FFcytb5 0.5 ? mM '[U-13C; U-15N; U-2H]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 6 ? ? -90.08 58.44 2 1 ASP A 7 ? ? -160.45 117.36 3 1 VAL A 8 ? ? 64.55 93.59 4 1 LYS A 18 ? ? -95.10 40.36 5 1 HIS A 19 ? ? -64.64 81.34 6 1 HIS A 30 ? ? -177.28 -44.87 7 1 PRO A 44 ? ? -57.22 98.03 8 1 ALA A 58 ? ? -150.96 -6.64 9 1 TYR A 78 ? ? -90.99 41.87 10 2 VAL A 8 ? ? 56.94 78.76 11 2 LYS A 18 ? ? -84.75 35.18 12 2 HIS A 30 ? ? -175.52 -74.44 13 2 PRO A 44 ? ? -68.46 79.27 14 2 ALA A 58 ? ? -156.31 -18.01 15 2 ILE A 91 ? ? -107.20 52.66 16 3 ASP A 5 ? ? -96.25 58.67 17 3 LYS A 18 ? ? -90.45 57.01 18 3 HIS A 30 ? ? -176.37 -57.51 19 3 PRO A 44 ? ? -60.54 98.60 20 3 ALA A 58 ? ? -155.48 -5.16 21 4 GLU A 2 ? ? -102.79 71.50 22 4 ASP A 7 ? ? -95.92 -60.93 23 4 LYS A 18 ? ? -80.00 28.07 24 4 HIS A 30 ? ? -173.32 -35.53 25 4 HIS A 31 ? ? -132.89 -32.17 26 4 PRO A 44 ? ? -65.91 93.93 27 4 ALA A 58 ? ? -160.83 -25.36 28 4 LYS A 90 ? ? -71.07 -70.81 29 4 LYS A 93 ? ? -151.58 74.55 30 4 SER A 95 ? ? 179.92 164.34 31 4 THR A 97 ? ? -142.26 -57.97 32 5 HIS A 30 ? ? -171.34 -26.42 33 5 HIS A 31 ? ? -139.47 -33.29 34 5 PRO A 44 ? ? -69.15 91.12 35 5 ALA A 58 ? ? -151.38 -13.64 36 5 TYR A 78 ? ? -88.74 42.19 37 5 LYS A 93 ? ? -168.63 105.36 38 6 HIS A 30 ? ? -172.35 -37.27 39 6 PRO A 44 ? ? -60.03 95.91 40 6 ALA A 58 ? ? -153.71 -12.95 41 6 PRO A 94 ? ? -56.40 93.88 42 7 HIS A 30 ? ? -175.01 -54.69 43 7 PRO A 44 ? ? -59.07 91.78 44 7 ALA A 58 ? ? -149.94 -15.98 45 7 TYR A 78 ? ? -91.88 35.86 46 7 LYS A 93 ? ? -170.94 96.16 47 7 SER A 95 ? ? -107.68 -168.33 48 7 THR A 97 ? ? -159.74 -45.00 49 8 VAL A 8 ? ? 62.38 64.38 50 8 LYS A 18 ? ? -84.30 43.01 51 8 HIS A 19 ? ? -81.37 42.48 52 8 HIS A 30 ? ? -178.59 -57.27 53 8 PRO A 44 ? ? -63.82 92.70 54 8 ALA A 58 ? ? -146.99 -17.54 55 8 TYR A 78 ? ? -91.90 32.73 56 8 ILE A 91 ? ? -104.61 59.36 57 9 GLN A 3 ? ? -53.23 107.83 58 9 HIS A 30 ? ? -175.43 -44.15 59 9 PRO A 44 ? ? -61.85 94.13 60 9 ALA A 58 ? ? -153.44 -18.40 61 9 TYR A 78 ? ? -96.55 30.19 62 10 VAL A 8 ? ? 59.52 103.45 63 10 HIS A 30 ? ? 178.89 -54.69 64 10 PRO A 44 ? ? -66.50 87.79 65 10 ALA A 58 ? ? -155.56 5.82 66 10 SER A 95 ? ? -135.64 -60.92 67 10 THR A 97 ? ? -160.65 -32.26 68 11 ASP A 7 ? ? -155.66 -64.32 69 11 HIS A 30 ? ? -171.59 -56.91 70 11 PRO A 44 ? ? -54.56 86.82 71 11 ALA A 58 ? ? -158.29 -24.46 72 11 LYS A 93 ? ? -171.51 92.89 73 11 SER A 95 ? ? -165.30 -36.83 74 11 THR A 97 ? ? -162.43 -33.60 75 12 GLU A 2 ? ? 62.45 107.31 76 12 ASP A 7 ? ? -157.98 -56.62 77 12 LYS A 18 ? ? -86.02 41.56 78 12 HIS A 30 ? ? -170.79 -46.04 79 12 PRO A 44 ? ? -59.49 93.17 80 12 ALA A 58 ? ? -133.38 -32.35 81 12 TYR A 78 ? ? -90.42 38.24 82 13 GLU A 2 ? ? -128.99 -63.73 83 13 ASP A 7 ? ? -52.35 87.89 84 13 LYS A 18 ? ? -85.00 41.40 85 13 HIS A 19 ? ? -82.94 42.37 86 13 HIS A 30 ? ? -168.90 -63.20 87 13 PRO A 44 ? ? -65.77 90.30 88 13 ALA A 58 ? ? -151.58 -21.08 89 13 TYR A 78 ? ? -90.71 47.47 90 13 LYS A 93 ? ? -163.63 78.15 91 14 HIS A 30 ? ? -173.66 -40.79 92 14 PRO A 44 ? ? -57.21 96.39 93 14 ALA A 58 ? ? -153.13 -5.25 94 14 TYR A 78 ? ? -91.06 40.39 95 15 LYS A 18 ? ? -79.82 30.08 96 15 HIS A 19 ? ? -79.26 37.64 97 15 HIS A 30 ? ? -175.54 -22.97 98 15 PRO A 44 ? ? -60.66 92.50 99 15 ALA A 58 ? ? -159.29 -10.11 100 15 TYR A 78 ? ? -90.95 30.87 101 15 PRO A 94 ? ? -59.79 105.63 102 16 LYS A 18 ? ? -85.43 33.14 103 16 HIS A 30 ? ? 178.34 -38.92 104 16 HIS A 31 ? ? -133.46 -32.63 105 16 ALA A 58 ? ? -151.89 -11.17 106 16 SER A 95 ? ? -142.56 -143.82 107 16 THR A 97 ? ? -142.95 -13.33 108 17 VAL A 8 ? ? 64.04 97.91 109 17 HIS A 19 ? ? -149.92 45.33 110 17 HIS A 30 ? ? -170.80 -55.43 111 17 PRO A 44 ? ? -60.12 99.40 112 17 ALA A 58 ? ? -146.27 -27.91 113 17 TYR A 78 ? ? -91.30 34.44 114 17 LYS A 90 ? ? -58.35 -70.75 115 17 ILE A 91 ? ? -100.96 54.60 116 18 VAL A 8 ? ? 54.63 79.03 117 18 LYS A 18 ? ? -82.70 44.81 118 18 HIS A 19 ? ? -78.55 22.53 119 18 HIS A 30 ? ? -171.48 -32.74 120 18 HIS A 31 ? ? -140.17 -21.69 121 18 PRO A 44 ? ? -59.89 91.35 122 18 ALA A 58 ? ? -148.29 -24.85 123 18 PHE A 67 ? ? -66.93 -78.10 124 18 SER A 68 ? ? -162.76 -80.38 125 18 ILE A 91 ? ? -104.66 58.15 126 19 VAL A 8 ? ? -68.74 90.76 127 19 HIS A 30 ? ? -179.80 -65.70 128 19 ALA A 58 ? ? -162.15 -28.35 129 19 TYR A 78 ? ? -90.94 33.10 130 20 VAL A 8 ? ? 57.99 70.23 131 20 HIS A 30 ? ? -173.00 -73.01 132 20 PRO A 44 ? ? -64.55 86.24 133 20 ALA A 58 ? ? -153.84 -28.40 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #