data_5XEF # _entry.id 5XEF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XEF pdb_00005xef 10.2210/pdb5xef/pdb WWPDB D_1300003389 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-06-27 2 'Structure model' 1 1 2019-02-20 3 'Structure model' 1 2 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity_src_gen 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 2 2 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5XEF _pdbx_database_status.recvd_initial_deposition_date 2017-04-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lee, C.' 1 ? 'Hong, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochem. Biophys. Res. Commun.' _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 487 _citation.language ? _citation.page_first 381 _citation.page_last 387 _citation.title ;Crystal structure of the flagellar chaperone FliS from Bacillus cereus and an invariant proline critical for FliS dimerization and flagellin recognition ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2017.04.070 _citation.pdbx_database_id_PubMed 28414127 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, C.' 1 ? primary 'Kim, M.I.' 2 ? primary 'Park, J.' 3 ? primary 'Jeon, B.Y.' 4 ? primary 'Yoon, S.I.' 5 ? primary 'Hong, M.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Flagellar protein fliS' 14894.370 1 ? ? ? ? 2 water nat water 18.015 100 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;PD(MSE)QAWQRY(MSE)QNDI(MSE)TSNPIKNTIFIYERCIIEFRKLEELLNTFKLQDGDELLEKLERIFEELKLQLN PDITKDLYDSLFGLYDWISIQIQT(MSE)KVTREVKDIDAIVQVLQDLIDGYRGALENE ; _entity_poly.pdbx_seq_one_letter_code_can ;PDMQAWQRYMQNDIMTSNPIKNTIFIYERCIIEFRKLEELLNTFKLQDGDELLEKLERIFEELKLQLNPDITKDLYDSLF GLYDWISIQIQTMKVTREVKDIDAIVQVLQDLIDGYRGALENE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ASP n 1 3 MSE n 1 4 GLN n 1 5 ALA n 1 6 TRP n 1 7 GLN n 1 8 ARG n 1 9 TYR n 1 10 MSE n 1 11 GLN n 1 12 ASN n 1 13 ASP n 1 14 ILE n 1 15 MSE n 1 16 THR n 1 17 SER n 1 18 ASN n 1 19 PRO n 1 20 ILE n 1 21 LYS n 1 22 ASN n 1 23 THR n 1 24 ILE n 1 25 PHE n 1 26 ILE n 1 27 TYR n 1 28 GLU n 1 29 ARG n 1 30 CYS n 1 31 ILE n 1 32 ILE n 1 33 GLU n 1 34 PHE n 1 35 ARG n 1 36 LYS n 1 37 LEU n 1 38 GLU n 1 39 GLU n 1 40 LEU n 1 41 LEU n 1 42 ASN n 1 43 THR n 1 44 PHE n 1 45 LYS n 1 46 LEU n 1 47 GLN n 1 48 ASP n 1 49 GLY n 1 50 ASP n 1 51 GLU n 1 52 LEU n 1 53 LEU n 1 54 GLU n 1 55 LYS n 1 56 LEU n 1 57 GLU n 1 58 ARG n 1 59 ILE n 1 60 PHE n 1 61 GLU n 1 62 GLU n 1 63 LEU n 1 64 LYS n 1 65 LEU n 1 66 GLN n 1 67 LEU n 1 68 ASN n 1 69 PRO n 1 70 ASP n 1 71 ILE n 1 72 THR n 1 73 LYS n 1 74 ASP n 1 75 LEU n 1 76 TYR n 1 77 ASP n 1 78 SER n 1 79 LEU n 1 80 PHE n 1 81 GLY n 1 82 LEU n 1 83 TYR n 1 84 ASP n 1 85 TRP n 1 86 ILE n 1 87 SER n 1 88 ILE n 1 89 GLN n 1 90 ILE n 1 91 GLN n 1 92 THR n 1 93 MSE n 1 94 LYS n 1 95 VAL n 1 96 THR n 1 97 ARG n 1 98 GLU n 1 99 VAL n 1 100 LYS n 1 101 ASP n 1 102 ILE n 1 103 ASP n 1 104 ALA n 1 105 ILE n 1 106 VAL n 1 107 GLN n 1 108 VAL n 1 109 LEU n 1 110 GLN n 1 111 ASP n 1 112 LEU n 1 113 ILE n 1 114 ASP n 1 115 GLY n 1 116 TYR n 1 117 ARG n 1 118 GLY n 1 119 ALA n 1 120 LEU n 1 121 GLU n 1 122 ASN n 1 123 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 123 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BC_1639 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus cereus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 226900 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 -1 -1 PRO PRO A . n A 1 2 ASP 2 0 0 ASP ASP A . n A 1 3 MSE 3 1 1 MSE MSE A . n A 1 4 GLN 4 2 2 GLN GLN A . n A 1 5 ALA 5 3 3 ALA ALA A . n A 1 6 TRP 6 4 4 TRP TRP A . n A 1 7 GLN 7 5 5 GLN GLN A . n A 1 8 ARG 8 6 6 ARG ARG A . n A 1 9 TYR 9 7 7 TYR TYR A . n A 1 10 MSE 10 8 8 MSE MSE A . n A 1 11 GLN 11 9 9 GLN GLN A . n A 1 12 ASN 12 10 10 ASN ASN A . n A 1 13 ASP 13 11 11 ASP ASP A . n A 1 14 ILE 14 12 12 ILE ILE A . n A 1 15 MSE 15 13 13 MSE MSE A . n A 1 16 THR 16 14 14 THR THR A . n A 1 17 SER 17 15 15 SER SER A . n A 1 18 ASN 18 16 16 ASN ASN A . n A 1 19 PRO 19 17 17 PRO PRO A . n A 1 20 ILE 20 18 18 ILE ILE A . n A 1 21 LYS 21 19 19 LYS LYS A . n A 1 22 ASN 22 20 20 ASN ASN A . n A 1 23 THR 23 21 21 THR THR A . n A 1 24 ILE 24 22 22 ILE ILE A . n A 1 25 PHE 25 23 23 PHE PHE A . n A 1 26 ILE 26 24 24 ILE ILE A . n A 1 27 TYR 27 25 25 TYR TYR A . n A 1 28 GLU 28 26 26 GLU GLU A . n A 1 29 ARG 29 27 27 ARG ARG A . n A 1 30 CYS 30 28 28 CYS CYS A . n A 1 31 ILE 31 29 29 ILE ILE A . n A 1 32 ILE 32 30 30 ILE ILE A . n A 1 33 GLU 33 31 31 GLU GLU A . n A 1 34 PHE 34 32 32 PHE PHE A . n A 1 35 ARG 35 33 33 ARG ARG A . n A 1 36 LYS 36 34 34 LYS LYS A . n A 1 37 LEU 37 35 35 LEU LEU A . n A 1 38 GLU 38 36 36 GLU GLU A . n A 1 39 GLU 39 37 37 GLU GLU A . n A 1 40 LEU 40 38 38 LEU LEU A . n A 1 41 LEU 41 39 39 LEU LEU A . n A 1 42 ASN 42 40 40 ASN ASN A . n A 1 43 THR 43 41 41 THR THR A . n A 1 44 PHE 44 42 42 PHE PHE A . n A 1 45 LYS 45 43 43 LYS LYS A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 GLN 47 45 45 GLN GLN A . n A 1 48 ASP 48 46 46 ASP ASP A . n A 1 49 GLY 49 47 47 GLY GLY A . n A 1 50 ASP 50 48 48 ASP ASP A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 LEU 52 50 50 LEU LEU A . n A 1 53 LEU 53 51 51 LEU LEU A . n A 1 54 GLU 54 52 52 GLU GLU A . n A 1 55 LYS 55 53 53 LYS LYS A . n A 1 56 LEU 56 54 54 LEU LEU A . n A 1 57 GLU 57 55 55 GLU GLU A . n A 1 58 ARG 58 56 56 ARG ARG A . n A 1 59 ILE 59 57 57 ILE ILE A . n A 1 60 PHE 60 58 58 PHE PHE A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 GLU 62 60 60 GLU GLU A . n A 1 63 LEU 63 61 61 LEU LEU A . n A 1 64 LYS 64 62 62 LYS LYS A . n A 1 65 LEU 65 63 63 LEU LEU A . n A 1 66 GLN 66 64 64 GLN GLN A . n A 1 67 LEU 67 65 65 LEU LEU A . n A 1 68 ASN 68 66 66 ASN ASN A . n A 1 69 PRO 69 67 67 PRO PRO A . n A 1 70 ASP 70 68 68 ASP ASP A . n A 1 71 ILE 71 69 69 ILE ILE A . n A 1 72 THR 72 70 70 THR THR A . n A 1 73 LYS 73 71 71 LYS LYS A . n A 1 74 ASP 74 72 72 ASP ASP A . n A 1 75 LEU 75 73 73 LEU LEU A . n A 1 76 TYR 76 74 74 TYR TYR A . n A 1 77 ASP 77 75 75 ASP ASP A . n A 1 78 SER 78 76 76 SER SER A . n A 1 79 LEU 79 77 77 LEU LEU A . n A 1 80 PHE 80 78 78 PHE PHE A . n A 1 81 GLY 81 79 79 GLY GLY A . n A 1 82 LEU 82 80 80 LEU LEU A . n A 1 83 TYR 83 81 81 TYR TYR A . n A 1 84 ASP 84 82 82 ASP ASP A . n A 1 85 TRP 85 83 83 TRP TRP A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 SER 87 85 85 SER SER A . n A 1 88 ILE 88 86 86 ILE ILE A . n A 1 89 GLN 89 87 87 GLN GLN A . n A 1 90 ILE 90 88 88 ILE ILE A . n A 1 91 GLN 91 89 89 GLN GLN A . n A 1 92 THR 92 90 90 THR THR A . n A 1 93 MSE 93 91 91 MSE MSE A . n A 1 94 LYS 94 92 92 LYS LYS A . n A 1 95 VAL 95 93 93 VAL VAL A . n A 1 96 THR 96 94 94 THR THR A . n A 1 97 ARG 97 95 95 ARG ARG A . n A 1 98 GLU 98 96 96 GLU GLU A . n A 1 99 VAL 99 97 97 VAL VAL A . n A 1 100 LYS 100 98 98 LYS LYS A . n A 1 101 ASP 101 99 99 ASP ASP A . n A 1 102 ILE 102 100 100 ILE ILE A . n A 1 103 ASP 103 101 101 ASP ASP A . n A 1 104 ALA 104 102 102 ALA ALA A . n A 1 105 ILE 105 103 103 ILE ILE A . n A 1 106 VAL 106 104 104 VAL VAL A . n A 1 107 GLN 107 105 105 GLN GLN A . n A 1 108 VAL 108 106 106 VAL VAL A . n A 1 109 LEU 109 107 107 LEU LEU A . n A 1 110 GLN 110 108 108 GLN GLN A . n A 1 111 ASP 111 109 109 ASP ASP A . n A 1 112 LEU 112 110 110 LEU LEU A . n A 1 113 ILE 113 111 111 ILE ILE A . n A 1 114 ASP 114 112 112 ASP ASP A . n A 1 115 GLY 115 113 113 GLY GLY A . n A 1 116 TYR 116 114 114 TYR TYR A . n A 1 117 ARG 117 115 115 ARG ARG A . n A 1 118 GLY 118 116 116 GLY GLY A . n A 1 119 ALA 119 117 117 ALA ALA A . n A 1 120 LEU 120 118 118 LEU LEU A . n A 1 121 GLU 121 119 119 GLU GLU A . n A 1 122 ASN 122 120 120 ASN ASN A . n A 1 123 GLU 123 121 121 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 24 HOH HOH A . B 2 HOH 2 202 30 HOH HOH A . B 2 HOH 3 203 9 HOH HOH A . B 2 HOH 4 204 20 HOH HOH A . B 2 HOH 5 205 47 HOH HOH A . B 2 HOH 6 206 10 HOH HOH A . B 2 HOH 7 207 21 HOH HOH A . B 2 HOH 8 208 52 HOH HOH A . B 2 HOH 9 209 16 HOH HOH A . B 2 HOH 10 210 93 HOH HOH A . B 2 HOH 11 211 8 HOH HOH A . B 2 HOH 12 212 41 HOH HOH A . B 2 HOH 13 213 103 HOH HOH A . B 2 HOH 14 214 11 HOH HOH A . B 2 HOH 15 215 33 HOH HOH A . B 2 HOH 16 216 56 HOH HOH A . B 2 HOH 17 217 3 HOH HOH A . B 2 HOH 18 218 7 HOH HOH A . B 2 HOH 19 219 2 HOH HOH A . B 2 HOH 20 220 1 HOH HOH A . B 2 HOH 21 221 48 HOH HOH A . B 2 HOH 22 222 63 HOH HOH A . B 2 HOH 23 223 15 HOH HOH A . B 2 HOH 24 224 28 HOH HOH A . B 2 HOH 25 225 18 HOH HOH A . B 2 HOH 26 226 17 HOH HOH A . B 2 HOH 27 227 67 HOH HOH A . B 2 HOH 28 228 12 HOH HOH A . B 2 HOH 29 229 89 HOH HOH A . B 2 HOH 30 230 14 HOH HOH A . B 2 HOH 31 231 81 HOH HOH A . B 2 HOH 32 232 58 HOH HOH A . B 2 HOH 33 233 65 HOH HOH A . B 2 HOH 34 234 57 HOH HOH A . B 2 HOH 35 235 27 HOH HOH A . B 2 HOH 36 236 60 HOH HOH A . B 2 HOH 37 237 100 HOH HOH A . B 2 HOH 38 238 25 HOH HOH A . B 2 HOH 39 239 35 HOH HOH A . B 2 HOH 40 240 32 HOH HOH A . B 2 HOH 41 241 92 HOH HOH A . B 2 HOH 42 242 4 HOH HOH A . B 2 HOH 43 243 22 HOH HOH A . B 2 HOH 44 244 5 HOH HOH A . B 2 HOH 45 245 83 HOH HOH A . B 2 HOH 46 246 46 HOH HOH A . B 2 HOH 47 247 34 HOH HOH A . B 2 HOH 48 248 51 HOH HOH A . B 2 HOH 49 249 64 HOH HOH A . B 2 HOH 50 250 38 HOH HOH A . B 2 HOH 51 251 71 HOH HOH A . B 2 HOH 52 252 85 HOH HOH A . B 2 HOH 53 253 70 HOH HOH A . B 2 HOH 54 254 59 HOH HOH A . B 2 HOH 55 255 36 HOH HOH A . B 2 HOH 56 256 53 HOH HOH A . B 2 HOH 57 257 45 HOH HOH A . B 2 HOH 58 258 43 HOH HOH A . B 2 HOH 59 259 84 HOH HOH A . B 2 HOH 60 260 96 HOH HOH A . B 2 HOH 61 261 40 HOH HOH A . B 2 HOH 62 262 98 HOH HOH A . B 2 HOH 63 263 77 HOH HOH A . B 2 HOH 64 264 68 HOH HOH A . B 2 HOH 65 265 88 HOH HOH A . B 2 HOH 66 266 97 HOH HOH A . B 2 HOH 67 267 6 HOH HOH A . B 2 HOH 68 268 37 HOH HOH A . B 2 HOH 69 269 101 HOH HOH A . B 2 HOH 70 270 13 HOH HOH A . B 2 HOH 71 271 23 HOH HOH A . B 2 HOH 72 272 94 HOH HOH A . B 2 HOH 73 273 86 HOH HOH A . B 2 HOH 74 274 62 HOH HOH A . B 2 HOH 75 275 39 HOH HOH A . B 2 HOH 76 276 95 HOH HOH A . B 2 HOH 77 277 26 HOH HOH A . B 2 HOH 78 278 82 HOH HOH A . B 2 HOH 79 279 102 HOH HOH A . B 2 HOH 80 280 19 HOH HOH A . B 2 HOH 81 281 55 HOH HOH A . B 2 HOH 82 282 54 HOH HOH A . B 2 HOH 83 283 29 HOH HOH A . B 2 HOH 84 284 72 HOH HOH A . B 2 HOH 85 285 91 HOH HOH A . B 2 HOH 86 286 49 HOH HOH A . B 2 HOH 87 287 66 HOH HOH A . B 2 HOH 88 288 87 HOH HOH A . B 2 HOH 89 289 80 HOH HOH A . B 2 HOH 90 290 90 HOH HOH A . B 2 HOH 91 291 99 HOH HOH A . B 2 HOH 92 292 75 HOH HOH A . B 2 HOH 93 293 61 HOH HOH A . B 2 HOH 94 294 78 HOH HOH A . B 2 HOH 95 295 74 HOH HOH A . B 2 HOH 96 296 76 HOH HOH A . B 2 HOH 97 297 44 HOH HOH A . B 2 HOH 98 298 42 HOH HOH A . B 2 HOH 99 299 73 HOH HOH A . B 2 HOH 100 300 69 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5XEF _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.207 _cell.length_a_esd ? _cell.length_b 83.207 _cell.length_b_esd ? _cell.length_c 47.771 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5XEF _symmetry.cell_setting ? _symmetry.Int_Tables_number 171 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XEF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1.5 M ammonium sulfate 4 % isopropanol ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 1' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-02-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97973 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97973 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5XEF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 72.06 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18292 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.400 _reflns.pdbx_Rmerge_I_obs 0.093 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.769 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.095 _reflns.pdbx_Rpim_I_all 0.023 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.000 2.050 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.186 ? ? ? ? ? ? ? ? 18.000 ? 2.115 ? ? 0.192 0.046 ? 1 1 0.995 ? 2.050 2.110 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.174 ? ? ? ? ? ? ? ? 18.700 ? 2.413 ? ? 0.179 0.042 ? 2 1 0.993 ? 2.110 2.170 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.154 ? ? ? ? ? ? ? ? 19.600 ? 2.783 ? ? 0.159 0.036 ? 3 1 0.996 ? 2.170 2.240 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.141 ? ? ? ? ? ? ? ? 19.400 ? 2.943 ? ? 0.145 0.033 ? 4 1 0.997 ? 2.240 2.320 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 19.000 ? 3.063 ? ? 0.135 0.031 ? 5 1 0.996 ? 2.320 2.420 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 18.400 ? 3.136 ? ? 0.125 0.030 ? 6 1 0.998 ? 2.420 2.530 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.118 ? ? ? ? ? ? ? ? 17.000 ? 3.382 ? ? 0.122 0.030 ? 7 1 0.997 ? 2.530 2.660 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 18.800 ? 3.578 ? ? 0.115 0.027 ? 8 1 0.997 ? 2.660 2.830 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 18.800 ? 3.807 ? ? 0.106 0.025 ? 9 1 0.997 ? 2.830 3.040 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 18.000 ? 4.121 ? ? 0.097 0.023 ? 10 1 0.998 ? 3.040 3.350 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 16.200 ? 4.218 ? ? 0.088 0.022 ? 11 1 0.997 ? 3.350 3.830 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 17.800 ? 4.217 ? ? 0.078 0.018 ? 12 1 0.999 ? 3.830 4.830 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 16.400 ? 4.258 ? ? 0.072 0.017 ? 13 1 0.998 ? 4.830 50.000 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 15.700 ? 4.205 ? ? 0.071 0.017 ? 14 1 0.999 ? # _refine.aniso_B[1][1] -1.4000 _refine.aniso_B[1][2] -0.7000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -1.4000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 4.5300 _refine.B_iso_max 73.370 _refine.B_iso_mean 26.0350 _refine.B_iso_min 13.060 _refine.correlation_coeff_Fo_to_Fc 0.9480 _refine.correlation_coeff_Fo_to_Fc_free 0.9250 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5XEF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0000 _refine.ls_d_res_low 72.0600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12238 _refine.ls_number_reflns_R_free 642 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9300 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1955 _refine.ls_R_factor_R_free 0.2274 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1939 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1510 _refine.pdbx_overall_ESU_R_Free 0.1410 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.1160 _refine.overall_SU_ML 0.0890 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.0000 _refine_hist.d_res_low 72.0600 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 100 _refine_hist.number_atoms_total 1132 _refine_hist.pdbx_number_residues_total 123 _refine_hist.pdbx_B_iso_mean_solvent 33.00 _refine_hist.pdbx_number_atoms_protein 1032 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.020 1048 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.283 1.988 1413 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.094 5.000 122 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.465 25.789 57 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.122 15.000 196 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.402 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.088 0.200 159 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 777 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0000 _refine_ls_shell.d_res_low 2.0520 _refine_ls_shell.number_reflns_all 947 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 47 _refine_ls_shell.number_reflns_R_work 900 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2940 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2170 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5XEF _struct.title 'Crystal structure of flagellar chaperone from bacteria' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XEF _struct_keywords.text 'flagellar chaperone, bacteria, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q81FF1_BACCR _struct_ref.pdbx_db_accession Q81FF1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQAWQRYMQNDIMTSNPIKNTIFIYERCIIEFRKLEELLNTFKLQDGDELLEKLERIFEELKLQLNPDITKDLYDSLFGL YDWISIQIQTMKVTREVKDIDAIVQVLQDLIDGYRGALENE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XEF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q81FF1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 121 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5XEF PRO A 1 ? UNP Q81FF1 ? ? 'expression tag' -1 1 1 5XEF ASP A 2 ? UNP Q81FF1 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8390 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details Homodimer # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 1 ? ILE A 14 ? PRO A -1 ILE A 12 1 ? 14 HELX_P HELX_P2 AA2 ASN A 18 ? THR A 43 ? ASN A 16 THR A 41 1 ? 26 HELX_P HELX_P3 AA3 LYS A 45 ? LEU A 67 ? LYS A 43 LEU A 65 1 ? 23 HELX_P HELX_P4 AA4 THR A 72 ? ARG A 97 ? THR A 70 ARG A 95 1 ? 26 HELX_P HELX_P5 AA5 ASP A 101 ? GLU A 123 ? ASP A 99 GLU A 121 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 2 C ? ? ? 1_555 A MSE 3 N ? ? A ASP 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale2 covale both ? A MSE 3 C ? ? ? 1_555 A GLN 4 N ? ? A MSE 1 A GLN 2 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale both ? A TYR 9 C ? ? ? 1_555 A MSE 10 N ? ? A TYR 7 A MSE 8 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale4 covale both ? A MSE 10 C ? ? ? 1_555 A GLN 11 N ? ? A MSE 8 A GLN 9 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale5 covale both ? A ILE 14 C ? ? ? 1_555 A MSE 15 N ? ? A ILE 12 A MSE 13 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale6 covale both ? A MSE 15 C ? ? ? 1_555 A THR 16 N ? ? A MSE 13 A THR 14 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale7 covale both ? A THR 92 C ? ? ? 1_555 A MSE 93 N ? ? A THR 90 A MSE 91 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale8 covale both ? A MSE 93 C ? ? ? 1_555 A LYS 94 N ? ? A MSE 91 A LYS 92 1_555 ? ? ? ? ? ? ? 1.335 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 3 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 10 ? . . . . MSE A 8 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 15 ? . . . . MSE A 13 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 93 ? . . . . MSE A 91 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _pdbx_entry_details.entry_id 5XEF _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 237 ? ? 1_555 O A HOH 237 ? ? 4_545 0.92 2 1 O A HOH 276 ? ? 1_555 O A HOH 276 ? ? 4_545 1.38 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id MSE _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 13 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -99.53 _pdbx_validate_torsion.psi 51.90 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 3 A MSE 1 ? MET 'modified residue' 2 A MSE 10 A MSE 8 ? MET 'modified residue' 3 A MSE 15 A MSE 13 ? MET 'modified residue' 4 A MSE 93 A MSE 91 ? MET 'modified residue' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 -0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 'X-RAY DIFFRACTION' 2 ? refined 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 -0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 'X-RAY DIFFRACTION' 3 ? refined 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 -0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 'X-RAY DIFFRACTION' 4 ? refined 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 -0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 'X-RAY DIFFRACTION' 5 ? refined 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 -0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 ILE N N N N 140 ILE CA C N S 141 ILE C C N N 142 ILE O O N N 143 ILE CB C N S 144 ILE CG1 C N N 145 ILE CG2 C N N 146 ILE CD1 C N N 147 ILE OXT O N N 148 ILE H H N N 149 ILE H2 H N N 150 ILE HA H N N 151 ILE HB H N N 152 ILE HG12 H N N 153 ILE HG13 H N N 154 ILE HG21 H N N 155 ILE HG22 H N N 156 ILE HG23 H N N 157 ILE HD11 H N N 158 ILE HD12 H N N 159 ILE HD13 H N N 160 ILE HXT H N N 161 LEU N N N N 162 LEU CA C N S 163 LEU C C N N 164 LEU O O N N 165 LEU CB C N N 166 LEU CG C N N 167 LEU CD1 C N N 168 LEU CD2 C N N 169 LEU OXT O N N 170 LEU H H N N 171 LEU H2 H N N 172 LEU HA H N N 173 LEU HB2 H N N 174 LEU HB3 H N N 175 LEU HG H N N 176 LEU HD11 H N N 177 LEU HD12 H N N 178 LEU HD13 H N N 179 LEU HD21 H N N 180 LEU HD22 H N N 181 LEU HD23 H N N 182 LEU HXT H N N 183 LYS N N N N 184 LYS CA C N S 185 LYS C C N N 186 LYS O O N N 187 LYS CB C N N 188 LYS CG C N N 189 LYS CD C N N 190 LYS CE C N N 191 LYS NZ N N N 192 LYS OXT O N N 193 LYS H H N N 194 LYS H2 H N N 195 LYS HA H N N 196 LYS HB2 H N N 197 LYS HB3 H N N 198 LYS HG2 H N N 199 LYS HG3 H N N 200 LYS HD2 H N N 201 LYS HD3 H N N 202 LYS HE2 H N N 203 LYS HE3 H N N 204 LYS HZ1 H N N 205 LYS HZ2 H N N 206 LYS HZ3 H N N 207 LYS HXT H N N 208 MSE N N N N 209 MSE CA C N S 210 MSE C C N N 211 MSE O O N N 212 MSE OXT O N N 213 MSE CB C N N 214 MSE CG C N N 215 MSE SE SE N N 216 MSE CE C N N 217 MSE H H N N 218 MSE H2 H N N 219 MSE HA H N N 220 MSE HXT H N N 221 MSE HB2 H N N 222 MSE HB3 H N N 223 MSE HG2 H N N 224 MSE HG3 H N N 225 MSE HE1 H N N 226 MSE HE2 H N N 227 MSE HE3 H N N 228 PHE N N N N 229 PHE CA C N S 230 PHE C C N N 231 PHE O O N N 232 PHE CB C N N 233 PHE CG C Y N 234 PHE CD1 C Y N 235 PHE CD2 C Y N 236 PHE CE1 C Y N 237 PHE CE2 C Y N 238 PHE CZ C Y N 239 PHE OXT O N N 240 PHE H H N N 241 PHE H2 H N N 242 PHE HA H N N 243 PHE HB2 H N N 244 PHE HB3 H N N 245 PHE HD1 H N N 246 PHE HD2 H N N 247 PHE HE1 H N N 248 PHE HE2 H N N 249 PHE HZ H N N 250 PHE HXT H N N 251 PRO N N N N 252 PRO CA C N S 253 PRO C C N N 254 PRO O O N N 255 PRO CB C N N 256 PRO CG C N N 257 PRO CD C N N 258 PRO OXT O N N 259 PRO H H N N 260 PRO HA H N N 261 PRO HB2 H N N 262 PRO HB3 H N N 263 PRO HG2 H N N 264 PRO HG3 H N N 265 PRO HD2 H N N 266 PRO HD3 H N N 267 PRO HXT H N N 268 SER N N N N 269 SER CA C N S 270 SER C C N N 271 SER O O N N 272 SER CB C N N 273 SER OG O N N 274 SER OXT O N N 275 SER H H N N 276 SER H2 H N N 277 SER HA H N N 278 SER HB2 H N N 279 SER HB3 H N N 280 SER HG H N N 281 SER HXT H N N 282 THR N N N N 283 THR CA C N S 284 THR C C N N 285 THR O O N N 286 THR CB C N R 287 THR OG1 O N N 288 THR CG2 C N N 289 THR OXT O N N 290 THR H H N N 291 THR H2 H N N 292 THR HA H N N 293 THR HB H N N 294 THR HG1 H N N 295 THR HG21 H N N 296 THR HG22 H N N 297 THR HG23 H N N 298 THR HXT H N N 299 TRP N N N N 300 TRP CA C N S 301 TRP C C N N 302 TRP O O N N 303 TRP CB C N N 304 TRP CG C Y N 305 TRP CD1 C Y N 306 TRP CD2 C Y N 307 TRP NE1 N Y N 308 TRP CE2 C Y N 309 TRP CE3 C Y N 310 TRP CZ2 C Y N 311 TRP CZ3 C Y N 312 TRP CH2 C Y N 313 TRP OXT O N N 314 TRP H H N N 315 TRP H2 H N N 316 TRP HA H N N 317 TRP HB2 H N N 318 TRP HB3 H N N 319 TRP HD1 H N N 320 TRP HE1 H N N 321 TRP HE3 H N N 322 TRP HZ2 H N N 323 TRP HZ3 H N N 324 TRP HH2 H N N 325 TRP HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MSE N CA sing N N 197 MSE N H sing N N 198 MSE N H2 sing N N 199 MSE CA C sing N N 200 MSE CA CB sing N N 201 MSE CA HA sing N N 202 MSE C O doub N N 203 MSE C OXT sing N N 204 MSE OXT HXT sing N N 205 MSE CB CG sing N N 206 MSE CB HB2 sing N N 207 MSE CB HB3 sing N N 208 MSE CG SE sing N N 209 MSE CG HG2 sing N N 210 MSE CG HG3 sing N N 211 MSE SE CE sing N N 212 MSE CE HE1 sing N N 213 MSE CE HE2 sing N N 214 MSE CE HE3 sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'the Ministry of Science, ICT & Future Planning' 'Korea, Republic Of' 2015R1D1A1A01057574 1 'the Ministry of Health & Welfare' 'Korea, Republic Of' HI15C2890 2 # _atom_sites.entry_id 5XEF _atom_sites.fract_transf_matrix[1][1] 0.012018 _atom_sites.fract_transf_matrix[1][2] 0.006939 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013877 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020933 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_