data_5XEK # _entry.id 5XEK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XEK pdb_00005xek 10.2210/pdb5xek/pdb WWPDB D_1300003396 ? ? BMRB 36072 ? 10.13018/BMR36072 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-02 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5XEK _pdbx_database_status.recvd_initial_deposition_date 2017-04-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'C-terminal zinc finger of RING finger protein 141' _pdbx_database_related.db_id 36072 _pdbx_database_related.content_type unspecified # _audit_author.name 'Miyamoto, K.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'C-terminal zinc finger of RING finger protein 141' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Miyamoto, K.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'RING finger protein 141' 4920.788 1 ? ? 'UNP residues 152-193' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger protein 230' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRL _entity_poly.pdbx_seq_one_letter_code_can EEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 GLU n 1 4 CYS n 1 5 CYS n 1 6 ILE n 1 7 CYS n 1 8 MET n 1 9 ASP n 1 10 GLY n 1 11 ARG n 1 12 ALA n 1 13 ASP n 1 14 LEU n 1 15 ILE n 1 16 LEU n 1 17 PRO n 1 18 CYS n 1 19 ALA n 1 20 HIS n 1 21 SER n 1 22 PHE n 1 23 CYS n 1 24 GLN n 1 25 LYS n 1 26 CYS n 1 27 ILE n 1 28 ASP n 1 29 LYS n 1 30 TRP n 1 31 SER n 1 32 ASP n 1 33 ARG n 1 34 HIS n 1 35 ARG n 1 36 ASN n 1 37 CYS n 1 38 PRO n 1 39 ILE n 1 40 CYS n 1 41 ARG n 1 42 LEU n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 42 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 202 401 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XEK _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5XEK _struct.title 'C-terminal zinc finger of RING finger protein 141' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XEK _struct_keywords.text 'RING finger protein 141, Zinc Finger, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RN141_HUMAN _struct_ref.pdbx_db_accession Q8WVD5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRL _struct_ref.pdbx_align_begin 152 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XEK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8WVD5 _struct_ref_seq.db_align_beg 152 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 193 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 42 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3790 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 23 ? ASP A 28 ? CYS A 23 ASP A 28 1 ? 6 HELX_P HELX_P2 AA2 CYS A 37 ? LEU A 42 ? CYS A 37 LEU A 42 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 4 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 4 A ZN 201 1_555 ? ? ? ? ? ? ? 2.335 ? ? metalc2 metalc ? ? A CYS 7 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 7 A ZN 201 1_555 ? ? ? ? ? ? ? 2.380 ? ? metalc3 metalc ? ? A CYS 18 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 18 A ZN 202 1_555 ? ? ? ? ? ? ? 2.271 ? ? metalc4 metalc ? ? A HIS 20 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 20 A ZN 202 1_555 ? ? ? ? ? ? ? 2.019 ? ? metalc5 metalc ? ? A CYS 23 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 23 A ZN 201 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc6 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 26 A ZN 201 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc7 metalc ? ? A CYS 37 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 202 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc8 metalc ? ? A CYS 40 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 40 A ZN 202 1_555 ? ? ? ? ? ? ? 2.371 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 4 ? A CYS 4 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 7 ? A CYS 7 ? 1_555 113.8 ? 2 SG ? A CYS 4 ? A CYS 4 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 23 ? A CYS 23 ? 1_555 116.6 ? 3 SG ? A CYS 7 ? A CYS 7 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 23 ? A CYS 23 ? 1_555 107.9 ? 4 SG ? A CYS 4 ? A CYS 4 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 115.6 ? 5 SG ? A CYS 7 ? A CYS 7 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 99.4 ? 6 SG ? A CYS 23 ? A CYS 23 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 101.6 ? 7 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 20 ? A HIS 20 ? 1_555 119.2 ? 8 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 108.0 ? 9 ND1 ? A HIS 20 ? A HIS 20 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 108.2 ? 10 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 101.9 ? 11 ND1 ? A HIS 20 ? A HIS 20 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 114.3 ? 12 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 104.3 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 4 'binding site for residue ZN A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 4 ? CYS A 4 . ? 1_555 ? 2 AC1 4 CYS A 7 ? CYS A 7 . ? 1_555 ? 3 AC1 4 CYS A 23 ? CYS A 23 . ? 1_555 ? 4 AC1 4 CYS A 26 ? CYS A 26 . ? 1_555 ? 5 AC2 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 6 AC2 4 HIS A 20 ? HIS A 20 . ? 1_555 ? 7 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 8 AC2 4 CYS A 40 ? CYS A 40 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 3 ? ? 61.44 149.93 2 1 ILE A 6 ? ? -141.47 -68.71 3 1 PRO A 17 ? ? -69.82 2.01 4 1 ALA A 19 ? ? 83.31 8.50 5 1 PHE A 22 ? ? -160.61 105.93 6 1 CYS A 23 ? ? -48.40 159.79 7 1 ASP A 32 ? ? 61.68 105.79 8 1 ARG A 35 ? ? 39.28 32.12 9 2 CYS A 4 ? ? -46.03 154.23 10 2 MET A 8 ? ? 38.42 44.07 11 2 LEU A 16 ? ? -46.47 159.72 12 2 PRO A 17 ? ? -69.59 2.56 13 2 ALA A 19 ? ? 83.24 47.11 14 2 PHE A 22 ? ? -157.65 89.32 15 2 HIS A 34 ? ? -172.87 -93.85 16 2 ARG A 35 ? ? -174.71 31.13 17 2 CYS A 37 ? ? 69.86 146.34 18 2 ILE A 39 ? ? -34.84 -78.85 19 3 GLU A 2 ? ? -125.73 -164.11 20 3 CYS A 4 ? ? -35.25 146.74 21 3 ILE A 6 ? ? -124.14 -65.59 22 3 MET A 8 ? ? 47.01 23.25 23 3 ARG A 11 ? ? -66.49 -176.93 24 3 PRO A 17 ? ? -69.82 1.48 25 3 ALA A 19 ? ? 81.89 22.53 26 3 PHE A 22 ? ? -161.72 93.35 27 3 ARG A 33 ? ? -41.22 95.64 28 3 HIS A 34 ? ? -146.10 -79.83 29 3 ARG A 35 ? ? 164.76 -24.44 30 4 CYS A 4 ? ? -37.18 131.84 31 4 ILE A 6 ? ? -101.49 -70.79 32 4 CYS A 7 ? ? -93.13 56.34 33 4 MET A 8 ? ? -48.88 90.83 34 4 ASP A 9 ? ? -146.12 -48.63 35 4 LEU A 16 ? ? -40.45 157.68 36 4 PRO A 17 ? ? -69.79 2.69 37 4 ALA A 19 ? ? 80.21 33.44 38 4 PHE A 22 ? ? -154.34 89.06 39 4 CYS A 23 ? ? -39.02 147.93 40 4 LYS A 25 ? ? -38.07 -38.45 41 4 TRP A 30 ? ? -72.45 -75.07 42 4 SER A 31 ? ? 48.59 98.04 43 4 ASP A 32 ? ? 40.55 -92.41 44 4 ARG A 33 ? ? 80.06 -61.85 45 4 ARG A 35 ? ? 81.99 -16.13 46 5 MET A 8 ? ? 81.88 55.91 47 5 ASP A 9 ? ? 166.40 -23.65 48 5 ARG A 11 ? ? 43.81 -161.99 49 5 PRO A 17 ? ? -69.73 2.70 50 5 ALA A 19 ? ? 81.13 43.48 51 5 SER A 31 ? ? 80.30 58.13 52 5 ILE A 39 ? ? -71.19 -74.15 53 6 CYS A 4 ? ? -44.61 153.03 54 6 MET A 8 ? ? 35.40 80.03 55 6 ASP A 9 ? ? -155.17 -42.80 56 6 LEU A 16 ? ? -42.61 157.25 57 6 PRO A 17 ? ? -69.68 2.67 58 6 ALA A 19 ? ? 83.32 17.16 59 6 GLN A 24 ? ? -37.07 -39.10 60 6 SER A 31 ? ? -37.42 139.25 61 6 ASN A 36 ? ? 37.67 -156.60 62 6 PRO A 38 ? ? -69.71 70.38 63 6 ILE A 39 ? ? -159.35 -42.71 64 7 CYS A 4 ? ? -35.87 153.11 65 7 ILE A 6 ? ? -138.80 -68.52 66 7 ASP A 9 ? ? -150.01 30.10 67 7 ARG A 11 ? ? 52.76 178.77 68 7 PRO A 17 ? ? -69.81 2.77 69 7 PHE A 22 ? ? -161.58 102.09 70 7 CYS A 23 ? ? -48.32 159.91 71 7 PRO A 38 ? ? -69.69 1.14 72 8 GLU A 2 ? ? 55.80 -179.01 73 8 CYS A 4 ? ? -39.27 141.68 74 8 ILE A 6 ? ? -88.50 -70.43 75 8 CYS A 7 ? ? -93.94 42.55 76 8 MET A 8 ? ? -34.59 93.47 77 8 ASP A 9 ? ? -149.59 -43.57 78 8 ARG A 11 ? ? -116.58 -168.05 79 8 LEU A 16 ? ? -41.19 155.14 80 8 PRO A 17 ? ? -69.82 2.62 81 8 ALA A 19 ? ? 82.72 23.45 82 8 CYS A 23 ? ? -48.03 176.85 83 8 LYS A 25 ? ? -53.57 -70.34 84 8 LYS A 29 ? ? -89.97 -74.79 85 8 SER A 31 ? ? -177.57 -167.13 86 8 ARG A 33 ? ? -36.26 94.96 87 8 HIS A 34 ? ? 170.49 33.49 88 8 ARG A 35 ? ? 38.43 49.60 89 9 GLU A 2 ? ? -130.70 -158.69 90 9 GLU A 3 ? ? 59.09 153.87 91 9 ILE A 6 ? ? -136.56 -77.30 92 9 PRO A 17 ? ? -69.76 2.59 93 9 ALA A 19 ? ? 76.00 50.90 94 9 PHE A 22 ? ? -162.08 113.52 95 9 SER A 31 ? ? -163.77 -60.49 96 9 ARG A 33 ? ? 165.64 -23.48 97 9 HIS A 34 ? ? 172.84 76.00 98 9 ILE A 39 ? ? -55.98 -73.76 99 10 CYS A 5 ? ? -93.26 42.22 100 10 ILE A 6 ? ? -145.89 -67.08 101 10 ARG A 11 ? ? 41.69 -154.90 102 10 PRO A 17 ? ? -69.77 2.73 103 10 ALA A 19 ? ? 72.32 34.17 104 10 LYS A 29 ? ? -69.16 -73.63 105 10 TRP A 30 ? ? -61.40 -171.71 106 10 ARG A 33 ? ? -120.76 -63.88 107 10 ASN A 36 ? ? -65.65 -170.42 108 11 GLU A 2 ? ? -117.24 -169.27 109 11 GLU A 3 ? ? 60.59 148.40 110 11 MET A 8 ? ? -34.51 93.42 111 11 ASP A 9 ? ? -153.44 -64.98 112 11 PRO A 17 ? ? -69.75 2.47 113 11 ALA A 19 ? ? 82.73 10.30 114 11 LYS A 29 ? ? -75.23 -85.95 115 11 TRP A 30 ? ? -48.70 105.97 116 11 SER A 31 ? ? -55.53 87.59 117 11 ARG A 35 ? ? -81.40 47.07 118 11 ASN A 36 ? ? -91.49 -67.54 119 11 CYS A 37 ? ? 177.59 81.30 120 11 PRO A 38 ? ? -69.82 2.97 121 12 CYS A 5 ? ? -95.52 35.42 122 12 ILE A 6 ? ? -148.60 -67.68 123 12 ASP A 9 ? ? -151.89 34.27 124 12 ARG A 11 ? ? 54.62 -176.93 125 12 PRO A 17 ? ? -69.80 2.77 126 12 ALA A 19 ? ? 77.94 33.22 127 12 PHE A 22 ? ? -162.00 98.74 128 12 LYS A 29 ? ? -94.21 -75.35 129 12 SER A 31 ? ? 51.93 82.57 130 12 ARG A 33 ? ? -72.10 -93.11 131 12 ARG A 35 ? ? 82.77 26.34 132 12 ASN A 36 ? ? -62.20 -167.95 133 13 GLU A 2 ? ? 45.24 -167.22 134 13 GLU A 3 ? ? 58.93 151.32 135 13 CYS A 5 ? ? -99.60 33.22 136 13 ILE A 6 ? ? -148.21 -55.19 137 13 ASP A 9 ? ? -162.57 22.62 138 13 ARG A 11 ? ? 56.33 -177.94 139 13 PRO A 17 ? ? -69.76 2.85 140 13 ALA A 19 ? ? 76.72 36.52 141 13 TRP A 30 ? ? -99.99 51.55 142 13 ARG A 33 ? ? -120.06 -82.48 143 13 HIS A 34 ? ? -148.63 -94.63 144 13 ARG A 35 ? ? -170.42 26.50 145 14 ASP A 9 ? ? -150.28 -46.21 146 14 LEU A 16 ? ? -40.24 153.51 147 14 PRO A 17 ? ? -69.77 2.85 148 14 ALA A 19 ? ? 75.08 46.66 149 14 PHE A 22 ? ? -160.94 90.77 150 14 LYS A 29 ? ? -79.94 -84.06 151 14 ARG A 35 ? ? 81.81 -12.01 152 14 ASN A 36 ? ? -60.76 -94.55 153 14 CYS A 37 ? ? 161.16 143.47 154 15 CYS A 4 ? ? -37.30 150.45 155 15 ILE A 6 ? ? -132.65 -33.88 156 15 MET A 8 ? ? -34.50 93.38 157 15 ASP A 9 ? ? 168.98 -30.51 158 15 ARG A 11 ? ? 54.20 169.59 159 15 LEU A 16 ? ? -47.34 155.73 160 15 PRO A 17 ? ? -69.80 2.96 161 15 ALA A 19 ? ? 81.54 39.40 162 15 PHE A 22 ? ? -162.76 87.14 163 15 SER A 31 ? ? 47.57 -169.78 164 15 ASP A 32 ? ? -166.42 -87.86 165 15 ARG A 35 ? ? 81.74 -16.04 166 16 ILE A 6 ? ? -150.86 -67.19 167 16 ASP A 9 ? ? -153.28 56.47 168 16 ARG A 11 ? ? 53.85 -172.63 169 16 PRO A 17 ? ? -69.70 1.21 170 16 ALA A 19 ? ? 79.41 48.06 171 16 PHE A 22 ? ? -161.87 91.39 172 16 CYS A 23 ? ? -46.80 170.77 173 16 LYS A 29 ? ? -80.18 -78.15 174 16 TRP A 30 ? ? -38.80 -74.41 175 16 SER A 31 ? ? 38.16 75.20 176 16 ARG A 33 ? ? 77.05 -60.89 177 16 ARG A 35 ? ? -95.21 48.28 178 16 PRO A 38 ? ? -69.80 2.99 179 17 MET A 8 ? ? -49.47 90.55 180 17 ASP A 9 ? ? 175.06 -46.91 181 17 ARG A 11 ? ? 56.28 162.19 182 17 PRO A 17 ? ? -69.74 2.77 183 17 ALA A 19 ? ? 76.79 35.03 184 17 PHE A 22 ? ? -160.73 104.60 185 17 LYS A 25 ? ? -43.56 -70.22 186 18 CYS A 4 ? ? -42.39 151.36 187 18 ILE A 6 ? ? -70.45 -70.30 188 18 MET A 8 ? ? 37.24 49.05 189 18 LEU A 16 ? ? -40.64 155.28 190 18 PRO A 17 ? ? -69.84 2.90 191 18 ALA A 19 ? ? 78.71 50.90 192 18 PHE A 22 ? ? -159.13 86.94 193 18 ASN A 36 ? ? -49.92 -92.71 194 18 CYS A 37 ? ? 171.70 143.78 195 19 CYS A 5 ? ? -87.51 39.08 196 19 ILE A 6 ? ? -153.92 -79.77 197 19 ASP A 9 ? ? -173.64 28.47 198 19 ARG A 11 ? ? 57.55 170.75 199 19 PRO A 17 ? ? -69.70 2.88 200 19 ALA A 19 ? ? 75.55 37.55 201 19 PHE A 22 ? ? -160.25 86.98 202 19 CYS A 23 ? ? -38.60 141.39 203 19 SER A 31 ? ? 69.00 101.24 204 19 ARG A 33 ? ? 52.96 -91.74 205 19 CYS A 40 ? ? -34.35 -34.44 206 20 CYS A 4 ? ? -35.71 153.12 207 20 ASP A 9 ? ? -162.61 38.43 208 20 ARG A 11 ? ? 57.29 -179.20 209 20 PRO A 17 ? ? -69.75 1.93 210 20 ALA A 19 ? ? 75.19 62.39 211 20 PHE A 22 ? ? -162.03 86.99 212 20 ASP A 32 ? ? -53.69 -175.92 213 20 ARG A 33 ? ? -56.02 86.66 214 20 ASN A 36 ? ? -119.56 -169.98 215 20 CYS A 37 ? ? -155.86 83.18 # _pdbx_nmr_ensemble.entry_id 5XEK _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 5XEK _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0 mM [U-13C; U-15N] RING finger protein 141, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '15N 13C' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '20 mM Tris-d11-HCl buffer (pH 6.9)' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'RING finger protein 141' _pdbx_nmr_exptl_sample.concentration 1.0 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details '20 mM Tris-d11-HCl buffer' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D C(CO)NH' 1 isotropic # _pdbx_nmr_refine.details ? _pdbx_nmr_refine.entry_id 5XEK _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' 'Discovery Studio' 2.1 'Accelrys Software Inc.' 3 'chemical shift assignment' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 4 'peak picking' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 TRP N N N N 301 TRP CA C N S 302 TRP C C N N 303 TRP O O N N 304 TRP CB C N N 305 TRP CG C Y N 306 TRP CD1 C Y N 307 TRP CD2 C Y N 308 TRP NE1 N Y N 309 TRP CE2 C Y N 310 TRP CE3 C Y N 311 TRP CZ2 C Y N 312 TRP CZ3 C Y N 313 TRP CH2 C Y N 314 TRP OXT O N N 315 TRP H H N N 316 TRP H2 H N N 317 TRP HA H N N 318 TRP HB2 H N N 319 TRP HB3 H N N 320 TRP HD1 H N N 321 TRP HE1 H N N 322 TRP HE3 H N N 323 TRP HZ2 H N N 324 TRP HZ3 H N N 325 TRP HH2 H N N 326 TRP HXT H N N 327 ZN ZN ZN N N 328 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 TRP N CA sing N N 288 TRP N H sing N N 289 TRP N H2 sing N N 290 TRP CA C sing N N 291 TRP CA CB sing N N 292 TRP CA HA sing N N 293 TRP C O doub N N 294 TRP C OXT sing N N 295 TRP CB CG sing N N 296 TRP CB HB2 sing N N 297 TRP CB HB3 sing N N 298 TRP CG CD1 doub Y N 299 TRP CG CD2 sing Y N 300 TRP CD1 NE1 sing Y N 301 TRP CD1 HD1 sing N N 302 TRP CD2 CE2 doub Y N 303 TRP CD2 CE3 sing Y N 304 TRP NE1 CE2 sing Y N 305 TRP NE1 HE1 sing N N 306 TRP CE2 CZ2 sing Y N 307 TRP CE3 CZ3 doub Y N 308 TRP CE3 HE3 sing N N 309 TRP CZ2 CH2 doub Y N 310 TRP CZ2 HZ2 sing N N 311 TRP CZ3 CH2 sing Y N 312 TRP CZ3 HZ3 sing N N 313 TRP CH2 HH2 sing N N 314 TRP OXT HXT sing N N 315 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 5XEK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_