data_5XG4 # _entry.id 5XG4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5XG4 WWPDB D_1300003454 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5XG4 _pdbx_database_status.recvd_initial_deposition_date 2017-04-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jiang, L.' 1 ? 'Huang, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Food Funct' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2042-650X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 2437 _citation.page_last 2443 _citation.title 'A structural mechanism of flavonoids in inhibiting serine proteases' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c6fo01825d _citation.pdbx_database_id_PubMed 28644504 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Xue, G.' 1 primary 'Gong, L.' 2 primary 'Yuan, C.' 3 primary 'Xu, M.' 4 primary 'Wang, X.' 5 primary 'Jiang, L.' 6 primary 'Huang, M.' 7 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5XG4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 119.969 _cell.length_a_esd ? _cell.length_b 119.969 _cell.length_b_esd ? _cell.length_c 41.780 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5XG4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Urokinase-type plasminogen activator' 27715.600 1 3.4.21.73 ? 'UNP residues 179-424' ? 2 non-polymer syn "3,5,7,3',4'-PENTAHYDROXYFLAVONE" 302.236 1 ? ? ? ? 3 non-polymer syn '1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE' 266.331 1 ? ? ? ? 4 water nat water 18.015 17 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name uPA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVEN LILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVK LISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW IRSHTK ; _entity_poly.pdbx_seq_one_letter_code_can ;IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVEN LILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVK LISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW IRSHTK ; _entity_poly.pdbx_strand_id U _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 ILE n 1 3 GLY n 1 4 GLY n 1 5 GLU n 1 6 PHE n 1 7 THR n 1 8 THR n 1 9 ILE n 1 10 GLU n 1 11 ASN n 1 12 GLN n 1 13 PRO n 1 14 TRP n 1 15 PHE n 1 16 ALA n 1 17 ALA n 1 18 ILE n 1 19 TYR n 1 20 ARG n 1 21 ARG n 1 22 HIS n 1 23 ARG n 1 24 GLY n 1 25 GLY n 1 26 SER n 1 27 VAL n 1 28 THR n 1 29 TYR n 1 30 VAL n 1 31 CYS n 1 32 GLY n 1 33 GLY n 1 34 SER n 1 35 LEU n 1 36 ILE n 1 37 SER n 1 38 PRO n 1 39 CYS n 1 40 TRP n 1 41 VAL n 1 42 ILE n 1 43 SER n 1 44 ALA n 1 45 THR n 1 46 HIS n 1 47 CYS n 1 48 PHE n 1 49 ILE n 1 50 ASP n 1 51 TYR n 1 52 PRO n 1 53 LYS n 1 54 LYS n 1 55 GLU n 1 56 ASP n 1 57 TYR n 1 58 ILE n 1 59 VAL n 1 60 TYR n 1 61 LEU n 1 62 GLY n 1 63 ARG n 1 64 SER n 1 65 ARG n 1 66 LEU n 1 67 ASN n 1 68 SER n 1 69 ASN n 1 70 THR n 1 71 GLN n 1 72 GLY n 1 73 GLU n 1 74 MET n 1 75 LYS n 1 76 PHE n 1 77 GLU n 1 78 VAL n 1 79 GLU n 1 80 ASN n 1 81 LEU n 1 82 ILE n 1 83 LEU n 1 84 HIS n 1 85 LYS n 1 86 ASP n 1 87 TYR n 1 88 SER n 1 89 ALA n 1 90 ASP n 1 91 THR n 1 92 LEU n 1 93 ALA n 1 94 HIS n 1 95 HIS n 1 96 ASN n 1 97 ASP n 1 98 ILE n 1 99 ALA n 1 100 LEU n 1 101 LEU n 1 102 LYS n 1 103 ILE n 1 104 ARG n 1 105 SER n 1 106 LYS n 1 107 GLU n 1 108 GLY n 1 109 ARG n 1 110 CYS n 1 111 ALA n 1 112 GLN n 1 113 PRO n 1 114 SER n 1 115 ARG n 1 116 THR n 1 117 ILE n 1 118 GLN n 1 119 THR n 1 120 ILE n 1 121 ALA n 1 122 LEU n 1 123 PRO n 1 124 SER n 1 125 MET n 1 126 TYR n 1 127 ASN n 1 128 ASP n 1 129 PRO n 1 130 GLN n 1 131 PHE n 1 132 GLY n 1 133 THR n 1 134 SER n 1 135 CYS n 1 136 GLU n 1 137 ILE n 1 138 THR n 1 139 GLY n 1 140 PHE n 1 141 GLY n 1 142 LYS n 1 143 GLU n 1 144 GLN n 1 145 SER n 1 146 THR n 1 147 ASP n 1 148 TYR n 1 149 LEU n 1 150 TYR n 1 151 PRO n 1 152 GLU n 1 153 GLN n 1 154 LEU n 1 155 LYS n 1 156 MET n 1 157 THR n 1 158 VAL n 1 159 VAL n 1 160 LYS n 1 161 LEU n 1 162 ILE n 1 163 SER n 1 164 HIS n 1 165 ARG n 1 166 GLU n 1 167 CYS n 1 168 GLN n 1 169 GLN n 1 170 PRO n 1 171 HIS n 1 172 TYR n 1 173 TYR n 1 174 GLY n 1 175 SER n 1 176 GLU n 1 177 VAL n 1 178 THR n 1 179 THR n 1 180 LYS n 1 181 MET n 1 182 LEU n 1 183 CYS n 1 184 ALA n 1 185 ALA n 1 186 ASP n 1 187 PRO n 1 188 GLN n 1 189 TRP n 1 190 LYS n 1 191 THR n 1 192 ASP n 1 193 SER n 1 194 CYS n 1 195 GLN n 1 196 GLY n 1 197 ASP n 1 198 SER n 1 199 GLY n 1 200 GLY n 1 201 PRO n 1 202 LEU n 1 203 VAL n 1 204 CYS n 1 205 SER n 1 206 LEU n 1 207 GLN n 1 208 GLY n 1 209 ARG n 1 210 MET n 1 211 THR n 1 212 LEU n 1 213 THR n 1 214 GLY n 1 215 ILE n 1 216 VAL n 1 217 SER n 1 218 TRP n 1 219 GLY n 1 220 ARG n 1 221 GLY n 1 222 CYS n 1 223 ALA n 1 224 LEU n 1 225 LYS n 1 226 ASP n 1 227 LYS n 1 228 PRO n 1 229 GLY n 1 230 VAL n 1 231 TYR n 1 232 THR n 1 233 ARG n 1 234 VAL n 1 235 SER n 1 236 HIS n 1 237 PHE n 1 238 LEU n 1 239 PRO n 1 240 TRP n 1 241 ILE n 1 242 ARG n 1 243 SER n 1 244 HIS n 1 245 THR n 1 246 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 246 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PLAU _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UROK_HUMAN _struct_ref.pdbx_db_accession P00749 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVEN LILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVK LISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW IRSHTK ; _struct_ref.pdbx_align_begin 179 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XG4 _struct_ref_seq.pdbx_strand_id U _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 246 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00749 _struct_ref_seq.db_align_beg 179 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 424 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 243 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5XG4 ALA U 121 ? UNP P00749 CYS 299 conflict 122 1 1 5XG4 GLN U 144 ? UNP P00749 ASN 322 conflict 145 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PG6 non-polymer . '1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE' ? 'C12 H26 O6' 266.331 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QUE non-polymer . "3,5,7,3',4'-PENTAHYDROXYFLAVONE" QUERCETIN 'C15 H10 O7' 302.236 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XG4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '50mM sodium citrate at pH 4.6, 1.95M (NH4)2SO4, 0.03% NaN3, 5% PEG 400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-08-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NFPSS BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site NFPSS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5XG4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.000 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4317 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.100 _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 43.3000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.108 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.25000 _refine.aniso_B[1][2] -0.12000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][2] -0.25000 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 0.80000 _refine.B_iso_max ? _refine.B_iso_mean 54.74 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.934 _refine.correlation_coeff_Fo_to_Fc_free 0.866 _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS ; _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5XG4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.00 _refine.ls_d_res_low 50.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4100 _refine.ls_number_reflns_R_free 217 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.3 _refine.ls_percent_reflns_R_free 5.000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.175 _refine.ls_R_factor_R_free 0.258 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.170 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4DVA _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.558 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 20.809 _refine.overall_SU_ML 0.375 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1942 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 1991 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.019 2032 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1873 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.413 1.964 2754 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.927 3.000 4323 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.491 5.000 244 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.418 23.218 87 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.171 15.000 339 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.780 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.078 0.200 292 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 2258 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 474 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.540 5.285 982 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.537 5.283 981 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.304 7.922 1224 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.302 7.924 1225 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.616 5.790 1050 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.616 5.790 1050 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.347 8.526 1531 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.018 44.423 2286 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 8.016 44.438 2287 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.00 _refine_ls_shell.d_res_low 3.08 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 18 _refine_ls_shell.number_reflns_R_work 308 _refine_ls_shell.percent_reflns_obs 97.31 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3650 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.1870 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5XG4 _struct.title 'Crystal structure of uPA in complex with quercetin' _struct.pdbx_descriptor 'Urokinase-type plasminogen activator chain B (E.C.3.4.21.73)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XG4 _struct_keywords.text 'Serine proteases, uPA, pepetide inhibitors, HYDROLASE-HYDROLASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 8 ? GLN A 12 ? THR U 23 GLN U 27 5 ? 5 HELX_P HELX_P2 AA2 ALA A 44 ? PHE A 48 ? ALA U 55 PHE U 59 5 ? 5 HELX_P HELX_P3 AA3 LYS A 53 ? GLU A 55 A LYS U 61 GLU U 62 5 ? 3 HELX_P HELX_P4 AA4 SER A 163 ? GLN A 168 ? SER U 164 GLN U 169 1 ? 6 HELX_P HELX_P5 AA5 TYR A 173 ? VAL A 177 ? TYR U 172 VAL U 176 5 ? 5 HELX_P HELX_P6 AA6 PHE A 237 ? LYS A 246 ? PHE U 234 LYS U 243 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 47 SG ? ? U CYS 42 U CYS 58 1_555 ? ? ? ? ? ? ? 2.033 ? disulf2 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 110 SG ? ? U CYS 50 U CYS 111 1_555 ? ? ? ? ? ? ? 2.029 ? disulf3 disulf ? ? A CYS 135 SG ? ? ? 1_555 A CYS 204 SG ? ? U CYS 136 U CYS 201 1_555 ? ? ? ? ? ? ? 2.015 ? disulf4 disulf ? ? A CYS 167 SG ? ? ? 1_555 A CYS 183 SG ? ? U CYS 168 U CYS 182 1_555 ? ? ? ? ? ? ? 2.032 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 225 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 223 _struct_mon_prot_cis.auth_asym_id U _struct_mon_prot_cis.pdbx_label_comp_id_2 ASP _struct_mon_prot_cis.pdbx_label_seq_id_2 226 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 A _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASP _struct_mon_prot_cis.pdbx_auth_seq_id_2 223 _struct_mon_prot_cis.pdbx_auth_asym_id_2 U _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -11.16 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 7 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 5 ? PHE A 6 ? GLU U 20 PHE U 21 AA1 2 LYS A 155 ? ILE A 162 ? LYS U 156 ILE U 163 AA1 3 CYS A 183 ? ALA A 185 ? CYS U 182 ALA U 184 AA1 4 GLY A 229 ? ARG A 233 ? GLY U 226 ARG U 230 AA1 5 ARG A 209 ? TRP A 218 ? ARG U 206 TRP U 215 AA1 6 PRO A 201 ? LEU A 206 ? PRO U 198 LEU U 203 AA1 7 SER A 134 ? GLY A 139 ? SER U 135 GLY U 140 AA1 8 LYS A 155 ? ILE A 162 ? LYS U 156 ILE U 163 AA2 1 PHE A 15 ? ARG A 21 ? PHE U 30 ARG U 36 AA2 2 VAL A 27 ? SER A 37 ? VAL U 38 SER U 48 AA2 3 TRP A 40 ? SER A 43 ? TRP U 51 SER U 54 AA2 4 ALA A 99 ? ARG A 104 ? ALA U 104 ARG U 109 AA2 5 MET A 74 ? ILE A 82 ? MET U 81 ILE U 89 AA2 6 TYR A 57 ? LEU A 61 ? TYR U 64 LEU U 68 AA2 7 PHE A 15 ? ARG A 21 ? PHE U 30 ARG U 36 AA3 1 SER A 88 ? ALA A 89 ? SER U 95 ALA U 96 AA3 2 HIS A 94 ? HIS A 95 ? HIS U 99 HIS U 100 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 5 ? N GLU U 20 O MET A 156 ? O MET U 157 AA1 2 3 N ILE A 162 ? N ILE U 163 O CYS A 183 ? O CYS U 182 AA1 3 4 N ALA A 184 ? N ALA U 183 O GLY A 229 ? O GLY U 226 AA1 4 5 O THR A 232 ? O THR U 229 N ILE A 215 ? N ILE U 212 AA1 5 6 O ARG A 209 ? O ARG U 206 N LEU A 206 ? N LEU U 203 AA1 6 7 O VAL A 203 ? O VAL U 200 N GLU A 136 ? N GLU U 137 AA1 7 8 N GLY A 139 ? N GLY U 140 O LYS A 155 ? O LYS U 156 AA2 1 2 N ILE A 18 ? N ILE U 33 O VAL A 30 ? O VAL U 41 AA2 2 3 N SER A 34 ? N SER U 45 O ILE A 42 ? O ILE U 53 AA2 3 4 N VAL A 41 ? N VAL U 52 O LEU A 101 ? O LEU U 106 AA2 4 5 O LEU A 100 ? O LEU U 105 N ILE A 82 ? N ILE U 89 AA2 5 6 O PHE A 76 ? O PHE U 83 N VAL A 59 ? N VAL U 66 AA2 6 7 O ILE A 58 ? O ILE U 65 N TYR A 19 ? N TYR U 34 AA3 1 2 N SER A 88 ? N SER U 95 O HIS A 95 ? O HIS U 100 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software U QUE 301 ? 12 'binding site for residue QUE U 301' AC2 Software U PG6 302 ? 7 'binding site for residue PG6 U 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 HIS A 46 ? HIS U 57 . ? 1_555 ? 2 AC1 12 HIS A 94 ? HIS U 99 . ? 1_555 ? 3 AC1 12 ASP A 192 ? ASP U 189 . ? 1_555 ? 4 AC1 12 SER A 193 ? SER U 190 . ? 1_555 ? 5 AC1 12 GLN A 195 ? GLN U 192 . ? 1_555 ? 6 AC1 12 SER A 198 ? SER U 195 . ? 1_555 ? 7 AC1 12 VAL A 216 ? VAL U 213 . ? 1_555 ? 8 AC1 12 SER A 217 ? SER U 214 . ? 1_555 ? 9 AC1 12 TRP A 218 ? TRP U 215 . ? 1_555 ? 10 AC1 12 GLY A 219 ? GLY U 216 . ? 1_555 ? 11 AC1 12 GLY A 221 ? GLY U 219 . ? 1_555 ? 12 AC1 12 PG6 C . ? PG6 U 302 . ? 1_555 ? 13 AC2 7 ARG A 20 ? ARG U 35 . ? 1_555 ? 14 AC2 7 HIS A 46 ? HIS U 57 . ? 1_555 ? 15 AC2 7 GLN A 195 ? GLN U 192 . ? 1_555 ? 16 AC2 7 GLY A 196 ? GLY U 193 . ? 1_555 ? 17 AC2 7 ASP A 197 ? ASP U 194 . ? 1_555 ? 18 AC2 7 SER A 198 ? SER U 195 . ? 1_555 ? 19 AC2 7 QUE B . ? QUE U 301 . ? 1_555 ? # _atom_sites.entry_id 5XG4 _atom_sites.fract_transf_matrix[1][1] 0.008335 _atom_sites.fract_transf_matrix[1][2] 0.004812 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009625 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023935 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE U . n A 1 2 ILE 2 17 17 ILE ILE U . n A 1 3 GLY 3 18 18 GLY GLY U . n A 1 4 GLY 4 19 19 GLY GLY U . n A 1 5 GLU 5 20 20 GLU GLU U . n A 1 6 PHE 6 21 21 PHE PHE U . n A 1 7 THR 7 22 22 THR THR U . n A 1 8 THR 8 23 23 THR THR U . n A 1 9 ILE 9 24 24 ILE ILE U . n A 1 10 GLU 10 25 25 GLU GLU U . n A 1 11 ASN 11 26 26 ASN ASN U . n A 1 12 GLN 12 27 27 GLN GLN U . n A 1 13 PRO 13 28 28 PRO PRO U . n A 1 14 TRP 14 29 29 TRP TRP U . n A 1 15 PHE 15 30 30 PHE PHE U . n A 1 16 ALA 16 31 31 ALA ALA U . n A 1 17 ALA 17 32 32 ALA ALA U . n A 1 18 ILE 18 33 33 ILE ILE U . n A 1 19 TYR 19 34 34 TYR TYR U . n A 1 20 ARG 20 35 35 ARG ARG U . n A 1 21 ARG 21 36 36 ARG ARG U . n A 1 22 HIS 22 37 37 HIS HIS U . n A 1 23 ARG 23 37 37 ARG ARG U A n A 1 24 GLY 24 37 37 GLY GLY U B n A 1 25 GLY 25 37 37 GLY GLY U C n A 1 26 SER 26 37 37 SER SER U D n A 1 27 VAL 27 38 38 VAL VAL U . n A 1 28 THR 28 39 39 THR THR U . n A 1 29 TYR 29 40 40 TYR TYR U . n A 1 30 VAL 30 41 41 VAL VAL U . n A 1 31 CYS 31 42 42 CYS CYS U . n A 1 32 GLY 32 43 43 GLY GLY U . n A 1 33 GLY 33 44 44 GLY GLY U . n A 1 34 SER 34 45 45 SER SER U . n A 1 35 LEU 35 46 46 LEU LEU U . n A 1 36 ILE 36 47 47 ILE ILE U . n A 1 37 SER 37 48 48 SER SER U . n A 1 38 PRO 38 49 49 PRO PRO U . n A 1 39 CYS 39 50 50 CYS CYS U . n A 1 40 TRP 40 51 51 TRP TRP U . n A 1 41 VAL 41 52 52 VAL VAL U . n A 1 42 ILE 42 53 53 ILE ILE U . n A 1 43 SER 43 54 54 SER SER U . n A 1 44 ALA 44 55 55 ALA ALA U . n A 1 45 THR 45 56 56 THR THR U . n A 1 46 HIS 46 57 57 HIS HIS U . n A 1 47 CYS 47 58 58 CYS CYS U . n A 1 48 PHE 48 59 59 PHE PHE U . n A 1 49 ILE 49 60 60 ILE ILE U . n A 1 50 ASP 50 60 60 ASP ASP U A n A 1 51 TYR 51 60 60 TYR TYR U B n A 1 52 PRO 52 60 60 PRO PRO U C n A 1 53 LYS 53 61 61 LYS LYS U . n A 1 54 LYS 54 62 62 LYS LYS U . n A 1 55 GLU 55 62 62 GLU GLU U A n A 1 56 ASP 56 63 63 ASP ASP U . n A 1 57 TYR 57 64 64 TYR TYR U . n A 1 58 ILE 58 65 65 ILE ILE U . n A 1 59 VAL 59 66 66 VAL VAL U . n A 1 60 TYR 60 67 67 TYR TYR U . n A 1 61 LEU 61 68 68 LEU LEU U . n A 1 62 GLY 62 69 69 GLY GLY U . n A 1 63 ARG 63 70 70 ARG ARG U . n A 1 64 SER 64 71 71 SER SER U . n A 1 65 ARG 65 72 72 ARG ARG U . n A 1 66 LEU 66 73 73 LEU LEU U . n A 1 67 ASN 67 74 74 ASN ASN U . n A 1 68 SER 68 75 75 SER SER U . n A 1 69 ASN 69 76 76 ASN ASN U . n A 1 70 THR 70 77 77 THR THR U . n A 1 71 GLN 71 78 78 GLN GLN U . n A 1 72 GLY 72 79 79 GLY GLY U . n A 1 73 GLU 73 80 80 GLU GLU U . n A 1 74 MET 74 81 81 MET MET U . n A 1 75 LYS 75 82 82 LYS LYS U . n A 1 76 PHE 76 83 83 PHE PHE U . n A 1 77 GLU 77 84 84 GLU GLU U . n A 1 78 VAL 78 85 85 VAL VAL U . n A 1 79 GLU 79 86 86 GLU GLU U . n A 1 80 ASN 80 87 87 ASN ASN U . n A 1 81 LEU 81 88 88 LEU LEU U . n A 1 82 ILE 82 89 89 ILE ILE U . n A 1 83 LEU 83 90 90 LEU LEU U . n A 1 84 HIS 84 91 91 HIS HIS U . n A 1 85 LYS 85 92 92 LYS LYS U . n A 1 86 ASP 86 93 93 ASP ASP U . n A 1 87 TYR 87 94 94 TYR TYR U . n A 1 88 SER 88 95 95 SER SER U . n A 1 89 ALA 89 96 96 ALA ALA U . n A 1 90 ASP 90 97 97 ASP ASP U . n A 1 91 THR 91 97 97 THR THR U A n A 1 92 LEU 92 97 97 LEU LEU U B n A 1 93 ALA 93 98 98 ALA ALA U . n A 1 94 HIS 94 99 99 HIS HIS U . n A 1 95 HIS 95 100 100 HIS HIS U . n A 1 96 ASN 96 101 101 ASN ASN U . n A 1 97 ASP 97 102 102 ASP ASP U . n A 1 98 ILE 98 103 103 ILE ILE U . n A 1 99 ALA 99 104 104 ALA ALA U . n A 1 100 LEU 100 105 105 LEU LEU U . n A 1 101 LEU 101 106 106 LEU LEU U . n A 1 102 LYS 102 107 107 LYS LYS U . n A 1 103 ILE 103 108 108 ILE ILE U . n A 1 104 ARG 104 109 109 ARG ARG U . n A 1 105 SER 105 110 110 SER SER U . n A 1 106 LYS 106 110 110 LYS LYS U A n A 1 107 GLU 107 110 110 GLU GLU U B n A 1 108 GLY 108 110 110 GLY GLY U C n A 1 109 ARG 109 110 110 ARG ARG U D n A 1 110 CYS 110 111 111 CYS CYS U . n A 1 111 ALA 111 112 112 ALA ALA U . n A 1 112 GLN 112 113 113 GLN GLN U . n A 1 113 PRO 113 114 114 PRO PRO U . n A 1 114 SER 114 115 115 SER SER U . n A 1 115 ARG 115 116 116 ARG ARG U . n A 1 116 THR 116 117 117 THR THR U . n A 1 117 ILE 117 118 118 ILE ILE U . n A 1 118 GLN 118 119 119 GLN GLN U . n A 1 119 THR 119 120 120 THR THR U . n A 1 120 ILE 120 121 121 ILE ILE U . n A 1 121 ALA 121 122 122 ALA ALA U . n A 1 122 LEU 122 123 123 LEU LEU U . n A 1 123 PRO 123 124 124 PRO PRO U . n A 1 124 SER 124 125 125 SER SER U . n A 1 125 MET 125 126 126 MET MET U . n A 1 126 TYR 126 127 127 TYR TYR U . n A 1 127 ASN 127 128 128 ASN ASN U . n A 1 128 ASP 128 129 129 ASP ASP U . n A 1 129 PRO 129 130 130 PRO PRO U . n A 1 130 GLN 130 131 131 GLN GLN U . n A 1 131 PHE 131 132 132 PHE PHE U . n A 1 132 GLY 132 133 133 GLY GLY U . n A 1 133 THR 133 134 134 THR THR U . n A 1 134 SER 134 135 135 SER SER U . n A 1 135 CYS 135 136 136 CYS CYS U . n A 1 136 GLU 136 137 137 GLU GLU U . n A 1 137 ILE 137 138 138 ILE ILE U . n A 1 138 THR 138 139 139 THR THR U . n A 1 139 GLY 139 140 140 GLY GLY U . n A 1 140 PHE 140 141 141 PHE PHE U . n A 1 141 GLY 141 142 142 GLY GLY U . n A 1 142 LYS 142 143 143 LYS LYS U . n A 1 143 GLU 143 144 144 GLU GLU U . n A 1 144 GLN 144 145 145 GLN GLN U . n A 1 145 SER 145 146 146 SER SER U . n A 1 146 THR 146 147 147 THR THR U . n A 1 147 ASP 147 148 148 ASP ASP U . n A 1 148 TYR 148 149 149 TYR TYR U . n A 1 149 LEU 149 150 150 LEU LEU U . n A 1 150 TYR 150 151 151 TYR TYR U . n A 1 151 PRO 151 152 152 PRO PRO U . n A 1 152 GLU 152 153 153 GLU GLU U . n A 1 153 GLN 153 154 154 GLN GLN U . n A 1 154 LEU 154 155 155 LEU LEU U . n A 1 155 LYS 155 156 156 LYS LYS U . n A 1 156 MET 156 157 157 MET MET U . n A 1 157 THR 157 158 158 THR THR U . n A 1 158 VAL 158 159 159 VAL VAL U . n A 1 159 VAL 159 160 160 VAL VAL U . n A 1 160 LYS 160 161 161 LYS LYS U . n A 1 161 LEU 161 162 162 LEU LEU U . n A 1 162 ILE 162 163 163 ILE ILE U . n A 1 163 SER 163 164 164 SER SER U . n A 1 164 HIS 164 165 165 HIS HIS U . n A 1 165 ARG 165 166 166 ARG ARG U . n A 1 166 GLU 166 167 167 GLU GLU U . n A 1 167 CYS 167 168 168 CYS CYS U . n A 1 168 GLN 168 169 169 GLN GLN U . n A 1 169 GLN 169 170 170 GLN GLN U . n A 1 170 PRO 170 170 170 PRO PRO U A n A 1 171 HIS 171 170 170 HIS HIS U B n A 1 172 TYR 172 171 171 TYR TYR U . n A 1 173 TYR 173 172 172 TYR TYR U . n A 1 174 GLY 174 173 173 GLY GLY U . n A 1 175 SER 175 174 174 SER SER U . n A 1 176 GLU 176 175 175 GLU GLU U . n A 1 177 VAL 177 176 176 VAL VAL U . n A 1 178 THR 178 177 177 THR THR U . n A 1 179 THR 179 178 178 THR THR U . n A 1 180 LYS 180 179 179 LYS LYS U . n A 1 181 MET 181 180 180 MET MET U . n A 1 182 LEU 182 181 181 LEU LEU U . n A 1 183 CYS 183 182 182 CYS CYS U . n A 1 184 ALA 184 183 183 ALA ALA U . n A 1 185 ALA 185 184 184 ALA ALA U . n A 1 186 ASP 186 185 185 ASP ASP U . n A 1 187 PRO 187 185 185 PRO PRO U A n A 1 188 GLN 188 185 185 GLN GLN U B n A 1 189 TRP 189 186 186 TRP TRP U . n A 1 190 LYS 190 187 187 LYS LYS U . n A 1 191 THR 191 188 188 THR THR U . n A 1 192 ASP 192 189 189 ASP ASP U . n A 1 193 SER 193 190 190 SER SER U . n A 1 194 CYS 194 191 191 CYS CYS U . n A 1 195 GLN 195 192 192 GLN GLN U . n A 1 196 GLY 196 193 193 GLY GLY U . n A 1 197 ASP 197 194 194 ASP ASP U . n A 1 198 SER 198 195 195 SER SER U . n A 1 199 GLY 199 196 196 GLY GLY U . n A 1 200 GLY 200 197 197 GLY GLY U . n A 1 201 PRO 201 198 198 PRO PRO U . n A 1 202 LEU 202 199 199 LEU LEU U . n A 1 203 VAL 203 200 200 VAL VAL U . n A 1 204 CYS 204 201 201 CYS CYS U . n A 1 205 SER 205 202 202 SER SER U . n A 1 206 LEU 206 203 203 LEU LEU U . n A 1 207 GLN 207 204 204 GLN GLN U . n A 1 208 GLY 208 205 205 GLY GLY U . n A 1 209 ARG 209 206 206 ARG ARG U . n A 1 210 MET 210 207 207 MET MET U . n A 1 211 THR 211 208 208 THR THR U . n A 1 212 LEU 212 209 209 LEU LEU U . n A 1 213 THR 213 210 210 THR THR U . n A 1 214 GLY 214 211 211 GLY GLY U . n A 1 215 ILE 215 212 212 ILE ILE U . n A 1 216 VAL 216 213 213 VAL VAL U . n A 1 217 SER 217 214 214 SER SER U . n A 1 218 TRP 218 215 215 TRP TRP U . n A 1 219 GLY 219 216 216 GLY GLY U . n A 1 220 ARG 220 217 217 ARG ARG U . n A 1 221 GLY 221 219 219 GLY GLY U . n A 1 222 CYS 222 220 220 CYS CYS U . n A 1 223 ALA 223 221 221 ALA ALA U . n A 1 224 LEU 224 222 222 LEU LEU U . n A 1 225 LYS 225 223 223 LYS LYS U . n A 1 226 ASP 226 223 223 ASP ASP U A n A 1 227 LYS 227 224 224 LYS LYS U . n A 1 228 PRO 228 225 225 PRO PRO U . n A 1 229 GLY 229 226 226 GLY GLY U . n A 1 230 VAL 230 227 227 VAL VAL U . n A 1 231 TYR 231 228 228 TYR TYR U . n A 1 232 THR 232 229 229 THR THR U . n A 1 233 ARG 233 230 230 ARG ARG U . n A 1 234 VAL 234 231 231 VAL VAL U . n A 1 235 SER 235 232 232 SER SER U . n A 1 236 HIS 236 233 233 HIS HIS U . n A 1 237 PHE 237 234 234 PHE PHE U . n A 1 238 LEU 238 235 235 LEU LEU U . n A 1 239 PRO 239 236 236 PRO PRO U . n A 1 240 TRP 240 237 237 TRP TRP U . n A 1 241 ILE 241 238 238 ILE ILE U . n A 1 242 ARG 242 239 239 ARG ARG U . n A 1 243 SER 243 240 240 SER SER U . n A 1 244 HIS 244 241 241 HIS HIS U . n A 1 245 THR 245 242 242 THR THR U . n A 1 246 LYS 246 243 243 LYS LYS U . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 QUE 1 301 301 QUE QUE U . C 3 PG6 1 302 302 PG6 PG6 U . D 4 HOH 1 401 401 HOH HOH U . D 4 HOH 2 402 402 HOH HOH U . D 4 HOH 3 403 403 HOH HOH U . D 4 HOH 4 404 404 HOH HOH U . D 4 HOH 5 405 405 HOH HOH U . D 4 HOH 6 406 406 HOH HOH U . D 4 HOH 7 407 407 HOH HOH U . D 4 HOH 8 408 408 HOH HOH U . D 4 HOH 9 409 409 HOH HOH U . D 4 HOH 10 410 410 HOH HOH U . D 4 HOH 11 411 411 HOH HOH U . D 4 HOH 12 412 412 HOH HOH U . D 4 HOH 13 413 413 HOH HOH U . D 4 HOH 14 414 414 HOH HOH U . D 4 HOH 15 415 415 HOH HOH U . D 4 HOH 16 416 416 HOH HOH U . D 4 HOH 17 417 417 HOH HOH U . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 510 ? 1 MORE -6 ? 1 'SSA (A^2)' 11150 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-26 2 'Structure model' 1 1 2017-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG U CYS 191 ? ? SG U CYS 220 ? ? 1.48 2 1 O U SER 214 ? ? O27 U QUE 301 ? ? 1.98 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE U ARG 35 ? ? CZ U ARG 35 ? ? NH2 U ARG 35 ? ? 123.52 120.30 3.22 0.50 N 2 1 CA U CYS 191 ? ? CB U CYS 191 ? ? SG U CYS 191 ? ? 137.91 114.20 23.71 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN U 27 ? ? -143.95 51.35 2 1 SER U 54 ? ? -128.71 -160.21 3 1 ASP U 93 ? ? -83.30 35.26 4 1 ASP U 97 ? ? -110.99 -140.70 5 1 LEU U 97 B ? -125.81 -55.47 6 1 TYR U 171 ? ? -96.16 -109.79 7 1 SER U 214 ? ? -124.05 -62.79 8 1 ASP U 223 A ? -118.78 70.59 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 U PG6 302 ? C1 ? C PG6 1 C1 2 1 N 1 U PG6 302 ? C8 ? C PG6 1 C8 3 1 N 1 U PG6 302 ? C9 ? C PG6 1 C9 4 1 N 1 U PG6 302 ? O5 ? C PG6 1 O5 5 1 N 1 U PG6 302 ? C10 ? C PG6 1 C10 6 1 N 1 U PG6 302 ? C11 ? C PG6 1 C11 7 1 N 1 U PG6 302 ? O6 ? C PG6 1 O6 8 1 N 1 U PG6 302 ? C12 ? C PG6 1 C12 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "3,5,7,3',4'-PENTAHYDROXYFLAVONE" QUE 3 '1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE' PG6 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #