data_5XHN # _entry.id 5XHN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XHN pdb_00005xhn 10.2210/pdb5xhn/pdb WWPDB D_1300003562 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Mutants from the same work' 5XHI unspecified PDB 'Mutants from the same work' 5XHM unspecified PDB . 5XHO unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5XHN _pdbx_database_status.recvd_initial_deposition_date 2017-04-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jagdev, M.K.' 1 ? 'Vasudevan, D.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochim. Biophys. Acta' _citation.journal_id_ASTM BBACAQ _citation.journal_id_CSD 0113 _citation.journal_id_ISSN 0006-3002 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 1865 _citation.language ? _citation.page_first 1267 _citation.page_last 1273 _citation.title 'Surface charge dependent separation of modified and hybrid ferritin in native PAGE: Impact of lysine 104' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbapap.2017.07.012 _citation.pdbx_database_id_PubMed 28739445 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Subhadarshanee, B.' 1 ? primary 'Mohanty, A.' 2 ? primary 'Jagdev, M.K.' 3 ? primary 'Vasudevan, D.' 4 ? primary 'Behera, R.K.' 5 ? # _cell.entry_id 5XHN _cell.length_a 184.210 _cell.length_b 184.210 _cell.length_c 184.210 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 96 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5XHN _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin, middle subunit' 20404.842 1 1.16.3.1 K104E ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 12 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 11 ? ? ? ? 4 water nat water 18.015 274 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Ferritin M,Ferritin H',Ferritin X ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEETVNQALLDLHKLATDKVDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSVKES ; _entity_poly.pdbx_seq_one_letter_code_can ;VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEETVNQALLDLHKLATDKVDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSVKES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 SER n 1 3 GLN n 1 4 VAL n 1 5 ARG n 1 6 GLN n 1 7 ASN n 1 8 TYR n 1 9 HIS n 1 10 SER n 1 11 ASP n 1 12 CYS n 1 13 GLU n 1 14 ALA n 1 15 ALA n 1 16 VAL n 1 17 ASN n 1 18 ARG n 1 19 MET n 1 20 LEU n 1 21 ASN n 1 22 LEU n 1 23 GLU n 1 24 LEU n 1 25 TYR n 1 26 ALA n 1 27 SER n 1 28 TYR n 1 29 THR n 1 30 TYR n 1 31 SER n 1 32 SER n 1 33 MET n 1 34 TYR n 1 35 ALA n 1 36 PHE n 1 37 PHE n 1 38 ASP n 1 39 ARG n 1 40 ASP n 1 41 ASP n 1 42 VAL n 1 43 ALA n 1 44 LEU n 1 45 HIS n 1 46 ASN n 1 47 VAL n 1 48 ALA n 1 49 GLU n 1 50 PHE n 1 51 PHE n 1 52 LYS n 1 53 GLU n 1 54 HIS n 1 55 SER n 1 56 HIS n 1 57 GLU n 1 58 GLU n 1 59 ARG n 1 60 GLU n 1 61 HIS n 1 62 ALA n 1 63 GLU n 1 64 LYS n 1 65 PHE n 1 66 MET n 1 67 LYS n 1 68 TYR n 1 69 GLN n 1 70 ASN n 1 71 LYS n 1 72 ARG n 1 73 GLY n 1 74 GLY n 1 75 ARG n 1 76 VAL n 1 77 VAL n 1 78 LEU n 1 79 GLN n 1 80 ASP n 1 81 ILE n 1 82 LYS n 1 83 LYS n 1 84 PRO n 1 85 GLU n 1 86 ARG n 1 87 ASP n 1 88 GLU n 1 89 TRP n 1 90 GLY n 1 91 ASN n 1 92 THR n 1 93 LEU n 1 94 GLU n 1 95 ALA n 1 96 MET n 1 97 GLN n 1 98 ALA n 1 99 ALA n 1 100 LEU n 1 101 GLN n 1 102 LEU n 1 103 GLU n 1 104 GLU n 1 105 THR n 1 106 VAL n 1 107 ASN n 1 108 GLN n 1 109 ALA n 1 110 LEU n 1 111 LEU n 1 112 ASP n 1 113 LEU n 1 114 HIS n 1 115 LYS n 1 116 LEU n 1 117 ALA n 1 118 THR n 1 119 ASP n 1 120 LYS n 1 121 VAL n 1 122 ASP n 1 123 PRO n 1 124 HIS n 1 125 LEU n 1 126 CYS n 1 127 ASP n 1 128 PHE n 1 129 LEU n 1 130 GLU n 1 131 SER n 1 132 GLU n 1 133 TYR n 1 134 LEU n 1 135 GLU n 1 136 GLU n 1 137 GLN n 1 138 VAL n 1 139 LYS n 1 140 ASP n 1 141 ILE n 1 142 LYS n 1 143 ARG n 1 144 ILE n 1 145 GLY n 1 146 ASP n 1 147 PHE n 1 148 ILE n 1 149 THR n 1 150 ASN n 1 151 LEU n 1 152 LYS n 1 153 ARG n 1 154 LEU n 1 155 GLY n 1 156 LEU n 1 157 PRO n 1 158 GLU n 1 159 ASN n 1 160 GLY n 1 161 MET n 1 162 GLY n 1 163 GLU n 1 164 TYR n 1 165 LEU n 1 166 PHE n 1 167 ASP n 1 168 LYS n 1 169 HIS n 1 170 SER n 1 171 VAL n 1 172 LYS n 1 173 GLU n 1 174 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 174 _entity_src_gen.gene_src_common_name 'American bullfrog' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lithobates catesbeiana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8400 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRI2_LITCT _struct_ref.pdbx_db_accession P07798 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSVKES ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XHN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 174 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07798 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 175 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 174 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5XHN _struct_ref_seq_dif.mon_id GLU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 104 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P07798 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 105 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 104 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XHN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.0 M MgCl2 and 100 mM Bicine (pH 9.0)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 103 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-01-11 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type RIGAKU _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 5XHN _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 21.270 _reflns.d_resolution_high 1.630 _reflns.number_obs 33970 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 33.8000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 12.40 _reflns.pdbx_CC_half ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.63 _reflns_shell.d_res_low 1.66 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.700 _reflns_shell.pdbx_redundancy 11.80 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5XHN _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 32170 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 21.27 _refine.ls_d_res_high 1.63 _refine.ls_percent_reflns_obs 99.84 _refine.ls_R_factor_obs 0.16446 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.16303 _refine.ls_R_factor_R_free 0.19158 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1719 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.964 _refine.correlation_coeff_Fo_to_Fc_free 0.950 _refine.B_iso_mean 15.766 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 3KA3 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.073 _refine.pdbx_overall_ESU_R_Free 0.075 _refine.overall_SU_ML 0.042 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.188 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1430 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 274 _refine_hist.number_atoms_total 1727 _refine_hist.d_res_high 1.63 _refine_hist.d_res_low 21.27 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.019 0.019 ? 1594 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 1460 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.283 1.947 ? 2109 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.838 3.000 ? 3338 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.991 5.000 ? 202 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 38.842 24.889 ? 90 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.083 15.000 ? 302 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.904 15.000 ? 10 'X-RAY DIFFRACTION' ? r_chiral_restr 0.074 0.200 ? 221 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.013 0.020 ? 1765 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 321 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.174 1.281 ? 725 'X-RAY DIFFRACTION' ? r_mcbond_other 1.162 1.277 ? 724 'X-RAY DIFFRACTION' ? r_mcangle_it 1.539 1.913 ? 912 'X-RAY DIFFRACTION' ? r_mcangle_other 1.539 1.918 ? 913 'X-RAY DIFFRACTION' ? r_scbond_it 3.339 1.640 ? 859 'X-RAY DIFFRACTION' ? r_scbond_other 3.337 1.641 ? 860 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other 4.744 2.303 ? 1183 'X-RAY DIFFRACTION' ? r_long_range_B_refined 6.048 17.539 ? 1961 'X-RAY DIFFRACTION' ? r_long_range_B_other 5.940 17.154 ? 1935 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.630 _refine_ls_shell.d_res_low 1.672 _refine_ls_shell.number_reflns_R_work 2310 _refine_ls_shell.R_factor_R_work 0.270 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.277 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 128 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 5XHN _struct.title 'Crystal structure of Frog M-ferritin K104E mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XHN _struct_keywords.text 'Ferritin, M-ferritin, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 2 ? L N N 2 ? M N N 2 ? N N N 3 ? O N N 3 ? P N N 3 ? Q N N 3 ? R N N 3 ? S N N 3 ? T N N 3 ? U N N 3 ? V N N 3 ? W N N 3 ? X N N 3 ? Y N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 9 ? ASP A 38 ? HIS A 9 ASP A 38 1 ? 30 HELX_P HELX_P2 AA2 LEU A 44 ? GLY A 73 ? LEU A 44 GLY A 73 1 ? 30 HELX_P HELX_P3 AA3 ASN A 91 ? LYS A 120 ? ASN A 91 LYS A 120 1 ? 30 HELX_P HELX_P4 AA4 ASP A 122 ? TYR A 133 ? ASP A 122 TYR A 133 1 ? 12 HELX_P HELX_P5 AA5 TYR A 133 ? LEU A 154 ? TYR A 133 LEU A 154 1 ? 22 HELX_P HELX_P6 AA6 ASN A 159 ? SER A 170 ? ASN A 159 SER A 170 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 10 OG ? ? ? 1_555 C MG . MG ? ? A SER 10 A MG 202 1_555 ? ? ? ? ? ? ? 2.141 ? ? metalc2 metalc ? ? A GLU 57 OE2 ? ? ? 1_555 B MG . MG ? ? A GLU 57 A MG 201 1_555 ? ? ? ? ? ? ? 2.114 ? ? metalc3 metalc ? ? A GLU 103 OE1 ? ? ? 1_555 F MG . MG ? ? A GLU 103 A MG 205 1_555 ? ? ? ? ? ? ? 2.515 ? ? metalc4 metalc ? ? A GLU 136 OE2 ? ? ? 1_555 B MG . MG ? ? A GLU 136 A MG 201 1_555 ? ? ? ? ? ? ? 2.155 ? ? metalc5 metalc ? ? A GLU 136 OE1 ? ? ? 1_555 H MG . MG ? ? A GLU 136 A MG 207 1_555 ? ? ? ? ? ? ? 2.115 ? ? metalc6 metalc ? ? A GLN 137 OE1 ? ? ? 1_555 F MG . MG ? ? A GLN 137 A MG 205 1_555 ? ? ? ? ? ? ? 2.523 ? ? metalc7 metalc ? ? A GLN 137 OE1 ? ? ? 1_555 H MG . MG ? ? A GLN 137 A MG 207 1_555 ? ? ? ? ? ? ? 2.020 ? ? metalc8 metalc ? ? A ASP 140 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 140 A MG 201 1_555 ? ? ? ? ? ? ? 2.249 ? ? metalc9 metalc ? ? A ASP 140 OD2 ? ? ? 1_555 F MG . MG ? ? A ASP 140 A MG 205 1_555 ? ? ? ? ? ? ? 2.238 ? ? metalc10 metalc ? ? B MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 201 A HOH 321 1_555 ? ? ? ? ? ? ? 2.144 ? ? metalc11 metalc ? ? B MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 201 A HOH 451 1_555 ? ? ? ? ? ? ? 2.116 ? ? metalc12 metalc ? ? B MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 201 A HOH 462 1_555 ? ? ? ? ? ? ? 2.169 ? ? metalc13 metalc ? ? C MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 202 A HOH 391 1_555 ? ? ? ? ? ? ? 2.109 ? ? metalc14 metalc ? ? C MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 202 A HOH 393 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc15 metalc ? ? C MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 202 A HOH 442 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc16 metalc ? ? C MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 202 A HOH 457 1_555 ? ? ? ? ? ? ? 2.128 ? ? metalc17 metalc ? ? C MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 202 A HOH 541 1_555 ? ? ? ? ? ? ? 2.138 ? ? metalc18 metalc ? ? D MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 203 A HOH 327 9_555 ? ? ? ? ? ? ? 2.125 ? ? metalc19 metalc ? ? D MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 203 A HOH 329 1_555 ? ? ? ? ? ? ? 2.125 ? ? metalc20 metalc ? ? D MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 203 A HOH 369 1_555 ? ? ? ? ? ? ? 2.147 ? ? metalc21 metalc ? ? D MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 203 A HOH 425 9_555 ? ? ? ? ? ? ? 2.156 ? ? metalc22 metalc ? ? D MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 203 A HOH 529 1_555 ? ? ? ? ? ? ? 2.119 ? ? metalc23 metalc ? ? D MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 203 A HOH 559 9_555 ? ? ? ? ? ? ? 2.123 ? ? metalc24 metalc ? ? E MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 204 A HOH 359 1_555 ? ? ? ? ? ? ? 2.156 ? ? metalc25 metalc ? ? E MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 204 A HOH 359 9_555 ? ? ? ? ? ? ? 1.949 ? ? metalc26 metalc ? ? E MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 204 A HOH 491 1_555 ? ? ? ? ? ? ? 2.172 ? ? metalc27 metalc ? ? E MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 204 A HOH 491 5_555 ? ? ? ? ? ? ? 1.966 ? ? metalc28 metalc ? ? F MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 205 A HOH 311 1_555 ? ? ? ? ? ? ? 2.623 ? ? metalc29 metalc ? ? F MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 205 A HOH 326 1_555 ? ? ? ? ? ? ? 2.721 ? ? metalc30 metalc ? ? G MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 206 A HOH 558 1_555 ? ? ? ? ? ? ? 2.204 ? ? metalc31 metalc ? ? G MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 206 A HOH 558 9_555 ? ? ? ? ? ? ? 2.963 ? ? metalc32 metalc ? ? H MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 207 A HOH 311 1_555 ? ? ? ? ? ? ? 2.039 ? ? metalc33 metalc ? ? H MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 207 A HOH 326 1_555 ? ? ? ? ? ? ? 2.150 ? ? metalc34 metalc ? ? H MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 207 A HOH 370 1_555 ? ? ? ? ? ? ? 2.063 ? ? metalc35 metalc ? ? I MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 208 A HOH 340 1_555 ? ? ? ? ? ? ? 2.174 ? ? metalc36 metalc ? ? I MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 208 A HOH 340 9_555 ? ? ? ? ? ? ? 1.809 ? ? metalc37 metalc ? ? J MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 209 A HOH 338 18_555 ? ? ? ? ? ? ? 1.978 ? ? metalc38 metalc ? ? J MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 209 A HOH 498 1_555 ? ? ? ? ? ? ? 2.157 ? ? metalc39 metalc ? ? J MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 209 A HOH 498 43_544 ? ? ? ? ? ? ? 1.881 ? ? metalc40 metalc ? ? K MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 210 A HOH 420 1_555 ? ? ? ? ? ? ? 2.141 ? ? metalc41 metalc ? ? K MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 210 A HOH 503 9_555 ? ? ? ? ? ? ? 2.103 ? ? metalc42 metalc ? ? K MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 210 A HOH 513 1_555 ? ? ? ? ? ? ? 2.153 ? ? metalc43 metalc ? ? K MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 210 A HOH 519 1_555 ? ? ? ? ? ? ? 2.137 ? ? metalc44 metalc ? ? K MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 210 A HOH 563 1_555 ? ? ? ? ? ? ? 2.154 ? ? metalc45 metalc ? ? K MG . MG ? ? ? 1_555 Y HOH . O ? ? A MG 210 A HOH 566 9_555 ? ? ? ? ? ? ? 2.165 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 156 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 156 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 157 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 157 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.33 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 201 ? 6 'binding site for residue MG A 201' AC2 Software A MG 202 ? 6 'binding site for residue MG A 202' AC3 Software A MG 203 ? 6 'binding site for residue MG A 203' AC4 Software A MG 204 ? 6 'binding site for residue MG A 204' AC5 Software A MG 205 ? 7 'binding site for residue MG A 205' AC6 Software A MG 206 ? 3 'binding site for residue MG A 206' AC7 Software A MG 207 ? 6 'binding site for residue MG A 207' AC8 Software A MG 208 ? 4 'binding site for residue MG A 208' AC9 Software A MG 209 ? 4 'binding site for residue MG A 209' AD1 Software A MG 210 ? 6 'binding site for residue MG A 210' AD2 Software A MG 211 ? 4 'binding site for residue MG A 211' AD3 Software A MG 212 ? 4 'binding site for residue MG A 212' AD4 Software A CL 213 ? 2 'binding site for residue CL A 213' AD5 Software A CL 214 ? 3 'binding site for residue CL A 214' AD6 Software A CL 215 ? 4 'binding site for residue CL A 215' AD7 Software A CL 216 ? 6 'binding site for residue CL A 216' AD8 Software A CL 217 ? 3 'binding site for residue CL A 217' AD9 Software A CL 218 ? 2 'binding site for residue CL A 218' AE1 Software A CL 219 ? 4 'binding site for residue CL A 219' AE2 Software A CL 220 ? 4 'binding site for residue CL A 220' AE3 Software A CL 221 ? 3 'binding site for residue CL A 221' AE4 Software A CL 222 ? 3 'binding site for residue CL A 222' AE5 Software A CL 223 ? 3 'binding site for residue CL A 223' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 57 ? GLU A 57 . ? 1_555 ? 2 AC1 6 GLU A 136 ? GLU A 136 . ? 1_555 ? 3 AC1 6 ASP A 140 ? ASP A 140 . ? 1_555 ? 4 AC1 6 HOH Y . ? HOH A 321 . ? 1_555 ? 5 AC1 6 HOH Y . ? HOH A 451 . ? 1_555 ? 6 AC1 6 HOH Y . ? HOH A 462 . ? 1_555 ? 7 AC2 6 SER A 10 ? SER A 10 . ? 1_555 ? 8 AC2 6 HOH Y . ? HOH A 391 . ? 1_555 ? 9 AC2 6 HOH Y . ? HOH A 393 . ? 1_555 ? 10 AC2 6 HOH Y . ? HOH A 442 . ? 1_555 ? 11 AC2 6 HOH Y . ? HOH A 457 . ? 1_555 ? 12 AC2 6 HOH Y . ? HOH A 541 . ? 1_555 ? 13 AC3 6 HOH Y . ? HOH A 327 . ? 9_555 ? 14 AC3 6 HOH Y . ? HOH A 329 . ? 1_555 ? 15 AC3 6 HOH Y . ? HOH A 369 . ? 1_555 ? 16 AC3 6 HOH Y . ? HOH A 425 . ? 9_555 ? 17 AC3 6 HOH Y . ? HOH A 529 . ? 1_555 ? 18 AC3 6 HOH Y . ? HOH A 559 . ? 9_555 ? 19 AC4 6 HOH Y . ? HOH A 359 . ? 1_555 ? 20 AC4 6 HOH Y . ? HOH A 359 . ? 5_555 ? 21 AC4 6 HOH Y . ? HOH A 359 . ? 9_555 ? 22 AC4 6 HOH Y . ? HOH A 491 . ? 9_555 ? 23 AC4 6 HOH Y . ? HOH A 491 . ? 1_555 ? 24 AC4 6 HOH Y . ? HOH A 491 . ? 5_555 ? 25 AC5 7 GLU A 103 ? GLU A 103 . ? 1_555 ? 26 AC5 7 GLU A 136 ? GLU A 136 . ? 1_555 ? 27 AC5 7 GLN A 137 ? GLN A 137 . ? 1_555 ? 28 AC5 7 ASP A 140 ? ASP A 140 . ? 1_555 ? 29 AC5 7 MG H . ? MG A 207 . ? 1_555 ? 30 AC5 7 HOH Y . ? HOH A 311 . ? 1_555 ? 31 AC5 7 HOH Y . ? HOH A 326 . ? 1_555 ? 32 AC6 3 HOH Y . ? HOH A 558 . ? 5_555 ? 33 AC6 3 HOH Y . ? HOH A 558 . ? 1_555 ? 34 AC6 3 HOH Y . ? HOH A 558 . ? 9_555 ? 35 AC7 6 GLU A 136 ? GLU A 136 . ? 1_555 ? 36 AC7 6 GLN A 137 ? GLN A 137 . ? 1_555 ? 37 AC7 6 MG F . ? MG A 205 . ? 1_555 ? 38 AC7 6 HOH Y . ? HOH A 311 . ? 1_555 ? 39 AC7 6 HOH Y . ? HOH A 326 . ? 1_555 ? 40 AC7 6 HOH Y . ? HOH A 370 . ? 1_555 ? 41 AC8 4 ASP A 127 ? ASP A 127 . ? 9_555 ? 42 AC8 4 HOH Y . ? HOH A 340 . ? 9_555 ? 43 AC8 4 HOH Y . ? HOH A 340 . ? 1_555 ? 44 AC8 4 HOH Y . ? HOH A 340 . ? 5_555 ? 45 AC9 4 HOH Y . ? HOH A 338 . ? 28_544 ? 46 AC9 4 HOH Y . ? HOH A 338 . ? 18_555 ? 47 AC9 4 HOH Y . ? HOH A 498 . ? 43_544 ? 48 AC9 4 HOH Y . ? HOH A 498 . ? 1_555 ? 49 AD1 6 HOH Y . ? HOH A 420 . ? 1_555 ? 50 AD1 6 HOH Y . ? HOH A 503 . ? 9_555 ? 51 AD1 6 HOH Y . ? HOH A 513 . ? 1_555 ? 52 AD1 6 HOH Y . ? HOH A 519 . ? 1_555 ? 53 AD1 6 HOH Y . ? HOH A 563 . ? 1_555 ? 54 AD1 6 HOH Y . ? HOH A 566 . ? 9_555 ? 55 AD2 4 HIS A 169 ? HIS A 169 . ? 1_555 ? 56 AD2 4 HIS A 169 ? HIS A 169 . ? 16_555 ? 57 AD2 4 HIS A 169 ? HIS A 169 . ? 2_555 ? 58 AD2 4 HIS A 169 ? HIS A 169 . ? 15_555 ? 59 AD3 4 HIS A 169 ? HIS A 169 . ? 1_555 ? 60 AD3 4 HIS A 169 ? HIS A 169 . ? 16_555 ? 61 AD3 4 HIS A 169 ? HIS A 169 . ? 2_555 ? 62 AD3 4 HIS A 169 ? HIS A 169 . ? 15_555 ? 63 AD4 2 SER A 10 ? SER A 10 . ? 1_555 ? 64 AD4 2 HOH Y . ? HOH A 523 . ? 1_555 ? 65 AD5 3 ARG A 5 ? ARG A 5 . ? 1_555 ? 66 AD5 3 ASN A 7 ? ASN A 7 . ? 1_555 ? 67 AD5 3 TYR A 8 ? TYR A 8 . ? 1_555 ? 68 AD6 4 ASP A 87 ? ASP A 87 . ? 1_555 ? 69 AD6 4 GLU A 88 ? GLU A 88 . ? 1_555 ? 70 AD6 4 HOH Y . ? HOH A 322 . ? 1_555 ? 71 AD6 4 HOH Y . ? HOH A 564 . ? 1_555 ? 72 AD7 6 SER A 131 ? SER A 131 . ? 1_555 ? 73 AD7 6 GLU A 132 ? GLU A 132 . ? 1_555 ? 74 AD7 6 TYR A 133 ? TYR A 133 . ? 1_555 ? 75 AD7 6 GLU A 135 ? GLU A 135 . ? 1_555 ? 76 AD7 6 GLU A 136 ? GLU A 136 . ? 1_555 ? 77 AD7 6 HOH Y . ? HOH A 524 . ? 1_555 ? 78 AD8 3 ASP A 146 ? ASP A 146 . ? 1_555 ? 79 AD8 3 ASN A 150 ? ASN A 150 . ? 1_555 ? 80 AD8 3 CL U . ? CL A 220 . ? 1_555 ? 81 AD9 2 ASN A 159 ? ASN A 159 . ? 1_555 ? 82 AD9 2 HOH Y . ? HOH A 372 . ? 1_555 ? 83 AE1 4 ASN A 7 ? ASN A 7 . ? 5_555 ? 84 AE1 4 GLN A 108 ? GLN A 108 . ? 1_555 ? 85 AE1 4 HOH Y . ? HOH A 367 . ? 1_555 ? 86 AE1 4 HOH Y . ? HOH A 448 . ? 5_555 ? 87 AE2 4 ASN A 150 ? ASN A 150 . ? 1_555 ? 88 AE2 4 SER A 170 ? SER A 170 . ? 1_555 ? 89 AE2 4 CL R . ? CL A 217 . ? 1_555 ? 90 AE2 4 HOH Y . ? HOH A 365 . ? 15_555 ? 91 AE3 3 ASN A 21 ? ASN A 21 . ? 1_555 ? 92 AE3 3 HOH Y . ? HOH A 549 . ? 1_555 ? 93 AE3 3 HOH Y . ? HOH A 550 . ? 1_555 ? 94 AE4 3 ARG A 153 ? ARG A 153 . ? 16_555 ? 95 AE4 3 GLU A 163 ? GLU A 163 . ? 1_555 ? 96 AE4 3 HOH Y . ? HOH A 435 . ? 1_555 ? 97 AE5 3 LYS A 82 ? LYS A 82 . ? 1_555 ? 98 AE5 3 HOH Y . ? HOH A 383 . ? 28_544 ? 99 AE5 3 HOH Y . ? HOH A 443 . ? 28_544 ? # _atom_sites.entry_id 5XHN _atom_sites.fract_transf_matrix[1][1] 0.005429 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005429 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005429 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 MET 161 161 161 MET MET A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 HIS 169 169 169 HIS HIS A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 SER 174 174 174 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 201 MG MG A . C 2 MG 1 202 202 MG MG A . D 2 MG 1 203 203 MG MG A . E 2 MG 1 204 204 MG MG A . F 2 MG 1 205 205 MG MG A . G 2 MG 1 206 206 MG MG A . H 2 MG 1 207 207 MG MG A . I 2 MG 1 208 208 MG MG A . J 2 MG 1 209 209 MG MG A . K 2 MG 1 210 210 MG MG A . L 2 MG 1 211 211 MG MG A . M 2 MG 1 212 212 MG MG A . N 3 CL 1 213 213 CL CL A . O 3 CL 1 214 214 CL CL A . P 3 CL 1 215 215 CL CL A . Q 3 CL 1 216 216 CL CL A . R 3 CL 1 217 217 CL CL A . S 3 CL 1 218 218 CL CL A . T 3 CL 1 219 219 CL CL A . U 3 CL 1 220 220 CL CL A . V 3 CL 1 221 221 CL CL A . W 3 CL 1 222 222 CL CL A . X 3 CL 1 223 223 CL CL A . Y 4 HOH 1 301 301 HOH HOH A . Y 4 HOH 2 302 302 HOH HOH A . Y 4 HOH 3 303 304 HOH HOH A . Y 4 HOH 4 304 303 HOH HOH A . Y 4 HOH 5 305 305 HOH HOH A . Y 4 HOH 6 306 306 HOH HOH A . Y 4 HOH 7 307 307 HOH HOH A . Y 4 HOH 8 308 309 HOH HOH A . Y 4 HOH 9 309 308 HOH HOH A . Y 4 HOH 10 310 310 HOH HOH A . Y 4 HOH 11 311 317 HOH HOH A . Y 4 HOH 12 312 311 HOH HOH A . Y 4 HOH 13 313 312 HOH HOH A . Y 4 HOH 14 314 313 HOH HOH A . Y 4 HOH 15 315 316 HOH HOH A . Y 4 HOH 16 316 314 HOH HOH A . Y 4 HOH 17 317 315 HOH HOH A . Y 4 HOH 18 318 319 HOH HOH A . Y 4 HOH 19 319 320 HOH HOH A . Y 4 HOH 20 320 321 HOH HOH A . Y 4 HOH 21 321 331 HOH HOH A . Y 4 HOH 22 322 326 HOH HOH A . Y 4 HOH 23 323 323 HOH HOH A . Y 4 HOH 24 324 322 HOH HOH A . Y 4 HOH 25 325 325 HOH HOH A . Y 4 HOH 26 326 351 HOH HOH A . Y 4 HOH 27 327 338 HOH HOH A . Y 4 HOH 28 328 324 HOH HOH A . Y 4 HOH 29 329 346 HOH HOH A . Y 4 HOH 30 330 327 HOH HOH A . Y 4 HOH 31 331 329 HOH HOH A . Y 4 HOH 32 332 332 HOH HOH A . Y 4 HOH 33 333 330 HOH HOH A . Y 4 HOH 34 334 335 HOH HOH A . Y 4 HOH 35 335 328 HOH HOH A . Y 4 HOH 36 336 336 HOH HOH A . Y 4 HOH 37 337 334 HOH HOH A . Y 4 HOH 38 338 365 HOH HOH A . Y 4 HOH 39 339 337 HOH HOH A . Y 4 HOH 40 340 342 HOH HOH A . Y 4 HOH 41 341 362 HOH HOH A . Y 4 HOH 42 342 339 HOH HOH A . Y 4 HOH 43 343 340 HOH HOH A . Y 4 HOH 44 344 341 HOH HOH A . Y 4 HOH 45 345 343 HOH HOH A . Y 4 HOH 46 346 345 HOH HOH A . Y 4 HOH 47 347 354 HOH HOH A . Y 4 HOH 48 348 333 HOH HOH A . Y 4 HOH 49 349 344 HOH HOH A . Y 4 HOH 50 350 355 HOH HOH A . Y 4 HOH 51 351 358 HOH HOH A . Y 4 HOH 52 352 360 HOH HOH A . Y 4 HOH 53 353 347 HOH HOH A . Y 4 HOH 54 354 353 HOH HOH A . Y 4 HOH 55 355 349 HOH HOH A . Y 4 HOH 56 356 364 HOH HOH A . Y 4 HOH 57 357 356 HOH HOH A . Y 4 HOH 58 358 371 HOH HOH A . Y 4 HOH 59 359 352 HOH HOH A . Y 4 HOH 60 360 348 HOH HOH A . Y 4 HOH 61 361 357 HOH HOH A . Y 4 HOH 62 362 363 HOH HOH A . Y 4 HOH 63 363 361 HOH HOH A . Y 4 HOH 64 364 350 HOH HOH A . Y 4 HOH 65 365 372 HOH HOH A . Y 4 HOH 66 366 367 HOH HOH A . Y 4 HOH 67 367 359 HOH HOH A . Y 4 HOH 68 368 370 HOH HOH A . Y 4 HOH 69 369 369 HOH HOH A . Y 4 HOH 70 370 402 HOH HOH A . Y 4 HOH 71 371 366 HOH HOH A . Y 4 HOH 72 372 375 HOH HOH A . Y 4 HOH 73 373 368 HOH HOH A . Y 4 HOH 74 374 379 HOH HOH A . Y 4 HOH 75 375 378 HOH HOH A . Y 4 HOH 76 376 374 HOH HOH A . Y 4 HOH 77 377 377 HOH HOH A . Y 4 HOH 78 378 381 HOH HOH A . Y 4 HOH 79 379 373 HOH HOH A . Y 4 HOH 80 380 382 HOH HOH A . Y 4 HOH 81 381 380 HOH HOH A . Y 4 HOH 82 382 385 HOH HOH A . Y 4 HOH 83 383 388 HOH HOH A . Y 4 HOH 84 384 376 HOH HOH A . Y 4 HOH 85 385 392 HOH HOH A . Y 4 HOH 86 386 424 HOH HOH A . Y 4 HOH 87 387 384 HOH HOH A . Y 4 HOH 88 388 390 HOH HOH A . Y 4 HOH 89 389 389 HOH HOH A . Y 4 HOH 90 390 393 HOH HOH A . Y 4 HOH 91 391 391 HOH HOH A . Y 4 HOH 92 392 399 HOH HOH A . Y 4 HOH 93 393 406 HOH HOH A . Y 4 HOH 94 394 395 HOH HOH A . Y 4 HOH 95 395 398 HOH HOH A . Y 4 HOH 96 396 387 HOH HOH A . Y 4 HOH 97 397 386 HOH HOH A . Y 4 HOH 98 398 394 HOH HOH A . Y 4 HOH 99 399 396 HOH HOH A . Y 4 HOH 100 400 397 HOH HOH A . Y 4 HOH 101 401 383 HOH HOH A . Y 4 HOH 102 402 401 HOH HOH A . Y 4 HOH 103 403 400 HOH HOH A . Y 4 HOH 104 404 404 HOH HOH A . Y 4 HOH 105 405 403 HOH HOH A . Y 4 HOH 106 406 412 HOH HOH A . Y 4 HOH 107 407 414 HOH HOH A . Y 4 HOH 108 408 409 HOH HOH A . Y 4 HOH 109 409 425 HOH HOH A . Y 4 HOH 110 410 419 HOH HOH A . Y 4 HOH 111 411 410 HOH HOH A . Y 4 HOH 112 412 405 HOH HOH A . Y 4 HOH 113 413 408 HOH HOH A . Y 4 HOH 114 414 415 HOH HOH A . Y 4 HOH 115 415 422 HOH HOH A . Y 4 HOH 116 416 411 HOH HOH A . Y 4 HOH 117 417 421 HOH HOH A . Y 4 HOH 118 418 426 HOH HOH A . Y 4 HOH 119 419 407 HOH HOH A . Y 4 HOH 120 420 418 HOH HOH A . Y 4 HOH 121 421 417 HOH HOH A . Y 4 HOH 122 422 413 HOH HOH A . Y 4 HOH 123 423 428 HOH HOH A . Y 4 HOH 124 424 420 HOH HOH A . Y 4 HOH 125 425 437 HOH HOH A . Y 4 HOH 126 426 423 HOH HOH A . Y 4 HOH 127 427 416 HOH HOH A . Y 4 HOH 128 428 430 HOH HOH A . Y 4 HOH 129 429 432 HOH HOH A . Y 4 HOH 130 430 433 HOH HOH A . Y 4 HOH 131 431 427 HOH HOH A . Y 4 HOH 132 432 443 HOH HOH A . Y 4 HOH 133 433 439 HOH HOH A . Y 4 HOH 134 434 436 HOH HOH A . Y 4 HOH 135 435 441 HOH HOH A . Y 4 HOH 136 436 440 HOH HOH A . Y 4 HOH 137 437 435 HOH HOH A . Y 4 HOH 138 438 442 HOH HOH A . Y 4 HOH 139 439 431 HOH HOH A . Y 4 HOH 140 440 455 HOH HOH A . Y 4 HOH 141 441 438 HOH HOH A . Y 4 HOH 142 442 429 HOH HOH A . Y 4 HOH 143 443 445 HOH HOH A . Y 4 HOH 144 444 446 HOH HOH A . Y 4 HOH 145 445 452 HOH HOH A . Y 4 HOH 146 446 444 HOH HOH A . Y 4 HOH 147 447 449 HOH HOH A . Y 4 HOH 148 448 450 HOH HOH A . Y 4 HOH 149 449 451 HOH HOH A . Y 4 HOH 150 450 448 HOH HOH A . Y 4 HOH 151 451 456 HOH HOH A . Y 4 HOH 152 452 453 HOH HOH A . Y 4 HOH 153 453 454 HOH HOH A . Y 4 HOH 154 454 434 HOH HOH A . Y 4 HOH 155 455 458 HOH HOH A . Y 4 HOH 156 456 457 HOH HOH A . Y 4 HOH 157 457 459 HOH HOH A . Y 4 HOH 158 458 460 HOH HOH A . Y 4 HOH 159 459 461 HOH HOH A . Y 4 HOH 160 460 462 HOH HOH A . Y 4 HOH 161 461 463 HOH HOH A . Y 4 HOH 162 462 447 HOH HOH A . Y 4 HOH 163 463 464 HOH HOH A . Y 4 HOH 164 464 466 HOH HOH A . Y 4 HOH 165 465 467 HOH HOH A . Y 4 HOH 166 466 465 HOH HOH A . Y 4 HOH 167 467 468 HOH HOH A . Y 4 HOH 168 468 470 HOH HOH A . Y 4 HOH 169 469 469 HOH HOH A . Y 4 HOH 170 470 472 HOH HOH A . Y 4 HOH 171 471 473 HOH HOH A . Y 4 HOH 172 472 471 HOH HOH A . Y 4 HOH 173 473 474 HOH HOH A . Y 4 HOH 174 474 475 HOH HOH A . Y 4 HOH 175 475 483 HOH HOH A . Y 4 HOH 176 476 476 HOH HOH A . Y 4 HOH 177 477 477 HOH HOH A . Y 4 HOH 178 478 478 HOH HOH A . Y 4 HOH 179 479 480 HOH HOH A . Y 4 HOH 180 480 479 HOH HOH A . Y 4 HOH 181 481 482 HOH HOH A . Y 4 HOH 182 482 484 HOH HOH A . Y 4 HOH 183 483 485 HOH HOH A . Y 4 HOH 184 484 486 HOH HOH A . Y 4 HOH 185 485 481 HOH HOH A . Y 4 HOH 186 486 487 HOH HOH A . Y 4 HOH 187 487 488 HOH HOH A . Y 4 HOH 188 488 489 HOH HOH A . Y 4 HOH 189 489 491 HOH HOH A . Y 4 HOH 190 490 492 HOH HOH A . Y 4 HOH 191 491 490 HOH HOH A . Y 4 HOH 192 492 493 HOH HOH A . Y 4 HOH 193 493 494 HOH HOH A . Y 4 HOH 194 494 496 HOH HOH A . Y 4 HOH 195 495 497 HOH HOH A . Y 4 HOH 196 496 498 HOH HOH A . Y 4 HOH 197 497 499 HOH HOH A . Y 4 HOH 198 498 502 HOH HOH A . Y 4 HOH 199 499 500 HOH HOH A . Y 4 HOH 200 500 501 HOH HOH A . Y 4 HOH 201 501 503 HOH HOH A . Y 4 HOH 202 502 504 HOH HOH A . Y 4 HOH 203 503 514 HOH HOH A . Y 4 HOH 204 504 505 HOH HOH A . Y 4 HOH 205 505 508 HOH HOH A . Y 4 HOH 206 506 507 HOH HOH A . Y 4 HOH 207 507 506 HOH HOH A . Y 4 HOH 208 508 509 HOH HOH A . Y 4 HOH 209 509 510 HOH HOH A . Y 4 HOH 210 510 511 HOH HOH A . Y 4 HOH 211 511 512 HOH HOH A . Y 4 HOH 212 512 513 HOH HOH A . Y 4 HOH 213 513 519 HOH HOH A . Y 4 HOH 214 514 515 HOH HOH A . Y 4 HOH 215 515 516 HOH HOH A . Y 4 HOH 216 516 517 HOH HOH A . Y 4 HOH 217 517 518 HOH HOH A . Y 4 HOH 218 518 520 HOH HOH A . Y 4 HOH 219 519 521 HOH HOH A . Y 4 HOH 220 520 522 HOH HOH A . Y 4 HOH 221 521 524 HOH HOH A . Y 4 HOH 222 522 523 HOH HOH A . Y 4 HOH 223 523 525 HOH HOH A . Y 4 HOH 224 524 527 HOH HOH A . Y 4 HOH 225 525 537 HOH HOH A . Y 4 HOH 226 526 528 HOH HOH A . Y 4 HOH 227 527 535 HOH HOH A . Y 4 HOH 228 528 532 HOH HOH A . Y 4 HOH 229 529 540 HOH HOH A . Y 4 HOH 230 530 530 HOH HOH A . Y 4 HOH 231 531 529 HOH HOH A . Y 4 HOH 232 532 534 HOH HOH A . Y 4 HOH 233 533 533 HOH HOH A . Y 4 HOH 234 534 539 HOH HOH A . Y 4 HOH 235 535 531 HOH HOH A . Y 4 HOH 236 536 536 HOH HOH A . Y 4 HOH 237 537 538 HOH HOH A . Y 4 HOH 238 538 542 HOH HOH A . Y 4 HOH 239 539 541 HOH HOH A . Y 4 HOH 240 540 543 HOH HOH A . Y 4 HOH 241 541 526 HOH HOH A . Y 4 HOH 242 542 544 HOH HOH A . Y 4 HOH 243 543 545 HOH HOH A . Y 4 HOH 244 544 546 HOH HOH A . Y 4 HOH 245 545 547 HOH HOH A . Y 4 HOH 246 546 548 HOH HOH A . Y 4 HOH 247 547 549 HOH HOH A . Y 4 HOH 248 548 552 HOH HOH A . Y 4 HOH 249 549 551 HOH HOH A . Y 4 HOH 250 550 550 HOH HOH A . Y 4 HOH 251 551 555 HOH HOH A . Y 4 HOH 252 552 554 HOH HOH A . Y 4 HOH 253 553 557 HOH HOH A . Y 4 HOH 254 554 556 HOH HOH A . Y 4 HOH 255 555 558 HOH HOH A . Y 4 HOH 256 556 561 HOH HOH A . Y 4 HOH 257 557 560 HOH HOH A . Y 4 HOH 258 558 559 HOH HOH A . Y 4 HOH 259 559 565 HOH HOH A . Y 4 HOH 260 560 562 HOH HOH A . Y 4 HOH 261 561 564 HOH HOH A . Y 4 HOH 262 562 563 HOH HOH A . Y 4 HOH 263 563 567 HOH HOH A . Y 4 HOH 264 564 566 HOH HOH A . Y 4 HOH 265 565 568 HOH HOH A . Y 4 HOH 266 566 571 HOH HOH A . Y 4 HOH 267 567 570 HOH HOH A . Y 4 HOH 268 568 569 HOH HOH A . Y 4 HOH 269 569 572 HOH HOH A . Y 4 HOH 270 570 573 HOH HOH A . Y 4 HOH 271 571 574 HOH HOH A . Y 4 HOH 272 572 575 HOH HOH A . Y 4 HOH 273 573 576 HOH HOH A . Y 4 HOH 274 574 577 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 92760 ? 1 MORE -357 ? 1 'SSA (A^2)' 140100 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MG 204 ? E MG . 2 1 A MG 208 ? I MG . 3 1 A MG 209 ? J MG . 4 1 A MG 211 ? L MG . 5 1 A MG 212 ? M MG . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG ? A SER 10 ? A SER 10 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 391 ? 1_555 92.3 ? 2 OG ? A SER 10 ? A SER 10 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 393 ? 1_555 83.6 ? 3 O ? Y HOH . ? A HOH 391 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 393 ? 1_555 92.3 ? 4 OG ? A SER 10 ? A SER 10 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 442 ? 1_555 83.3 ? 5 O ? Y HOH . ? A HOH 391 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 442 ? 1_555 175.3 ? 6 O ? Y HOH . ? A HOH 393 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 442 ? 1_555 88.8 ? 7 OG ? A SER 10 ? A SER 10 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 457 ? 1_555 86.2 ? 8 O ? Y HOH . ? A HOH 391 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 457 ? 1_555 88.4 ? 9 O ? Y HOH . ? A HOH 393 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 457 ? 1_555 169.8 ? 10 O ? Y HOH . ? A HOH 442 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 457 ? 1_555 89.7 ? 11 OG ? A SER 10 ? A SER 10 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 541 ? 1_555 178.3 ? 12 O ? Y HOH . ? A HOH 391 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 541 ? 1_555 86.2 ? 13 O ? Y HOH . ? A HOH 393 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 541 ? 1_555 95.8 ? 14 O ? Y HOH . ? A HOH 442 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 541 ? 1_555 98.3 ? 15 O ? Y HOH . ? A HOH 457 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? Y HOH . ? A HOH 541 ? 1_555 94.4 ? 16 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OE2 ? A GLU 136 ? A GLU 136 ? 1_555 84.1 ? 17 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 89.9 ? 18 OE2 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 74.8 ? 19 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 321 ? 1_555 90.5 ? 20 OE2 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 321 ? 1_555 172.7 ? 21 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 321 ? 1_555 100.4 ? 22 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 451 ? 1_555 173.9 ? 23 OE2 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 451 ? 1_555 100.1 ? 24 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 451 ? 1_555 95.4 ? 25 O ? Y HOH . ? A HOH 321 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 451 ? 1_555 85.6 ? 26 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 462 ? 1_555 87.9 ? 27 OE2 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 462 ? 1_555 92.4 ? 28 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 462 ? 1_555 167.1 ? 29 O ? Y HOH . ? A HOH 321 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 462 ? 1_555 92.3 ? 30 O ? Y HOH . ? A HOH 451 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? Y HOH . ? A HOH 462 ? 1_555 87.5 ? 31 OE1 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 90.9 ? 32 OE1 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 116.2 ? 33 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 152.1 ? 34 OE1 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? Y HOH . ? A HOH 311 ? 1_555 105.5 ? 35 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? Y HOH . ? A HOH 311 ? 1_555 98.1 ? 36 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? Y HOH . ? A HOH 311 ? 1_555 81.5 ? 37 OE1 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? Y HOH . ? A HOH 326 ? 1_555 59.1 ? 38 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? Y HOH . ? A HOH 326 ? 1_555 61.9 ? 39 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? Y HOH . ? A HOH 326 ? 1_555 136.7 ? 40 O ? Y HOH . ? A HOH 311 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? Y HOH . ? A HOH 326 ? 1_555 61.9 ? 41 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 93.2 ? 42 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? Y HOH . ? A HOH 311 ? 1_555 103.8 ? 43 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? Y HOH . ? A HOH 311 ? 1_555 146.5 ? 44 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? Y HOH . ? A HOH 326 ? 1_555 173.8 ? 45 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? Y HOH . ? A HOH 326 ? 1_555 80.7 ? 46 O ? Y HOH . ? A HOH 311 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? Y HOH . ? A HOH 326 ? 1_555 82.0 ? 47 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? Y HOH . ? A HOH 370 ? 1_555 89.9 ? 48 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? Y HOH . ? A HOH 370 ? 1_555 102.5 ? 49 O ? Y HOH . ? A HOH 311 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? Y HOH . ? A HOH 370 ? 1_555 106.1 ? 50 O ? Y HOH . ? A HOH 326 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? Y HOH . ? A HOH 370 ? 1_555 90.3 ? 51 O ? Y HOH . ? A HOH 327 ? 9_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 329 ? 1_555 90.7 ? 52 O ? Y HOH . ? A HOH 327 ? 9_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 369 ? 1_555 85.5 ? 53 O ? Y HOH . ? A HOH 329 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 369 ? 1_555 86.5 ? 54 O ? Y HOH . ? A HOH 327 ? 9_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 425 ? 9_555 89.4 ? 55 O ? Y HOH . ? A HOH 329 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 425 ? 9_555 173.2 ? 56 O ? Y HOH . ? A HOH 369 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 425 ? 9_555 86.8 ? 57 O ? Y HOH . ? A HOH 327 ? 9_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 529 ? 1_555 177.1 ? 58 O ? Y HOH . ? A HOH 329 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 529 ? 1_555 89.8 ? 59 O ? Y HOH . ? A HOH 369 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 529 ? 1_555 91.6 ? 60 O ? Y HOH . ? A HOH 425 ? 9_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 529 ? 1_555 89.8 ? 61 O ? Y HOH . ? A HOH 327 ? 9_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 559 ? 9_555 94.3 ? 62 O ? Y HOH . ? A HOH 329 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 559 ? 9_555 93.0 ? 63 O ? Y HOH . ? A HOH 369 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 559 ? 9_555 179.4 ? 64 O ? Y HOH . ? A HOH 425 ? 9_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 559 ? 9_555 93.8 ? 65 O ? Y HOH . ? A HOH 529 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? Y HOH . ? A HOH 559 ? 9_555 88.6 ? 66 O ? Y HOH . ? A HOH 359 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? Y HOH . ? A HOH 359 ? 9_555 91.6 ? 67 O ? Y HOH . ? A HOH 359 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? Y HOH . ? A HOH 491 ? 1_555 83.8 ? 68 O ? Y HOH . ? A HOH 359 ? 9_555 MG ? E MG . ? A MG 204 ? 1_555 O ? Y HOH . ? A HOH 491 ? 1_555 175.5 ? 69 O ? Y HOH . ? A HOH 359 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? Y HOH . ? A HOH 491 ? 5_555 174.6 ? 70 O ? Y HOH . ? A HOH 359 ? 9_555 MG ? E MG . ? A MG 204 ? 1_555 O ? Y HOH . ? A HOH 491 ? 5_555 93.4 ? 71 O ? Y HOH . ? A HOH 491 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? Y HOH . ? A HOH 491 ? 5_555 91.2 ? 72 O ? Y HOH . ? A HOH 558 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? Y HOH . ? A HOH 558 ? 9_555 93.7 ? 73 O ? Y HOH . ? A HOH 340 ? 1_555 MG ? I MG . ? A MG 208 ? 1_555 O ? Y HOH . ? A HOH 340 ? 9_555 93.7 ? 74 O ? Y HOH . ? A HOH 338 ? 18_555 MG ? J MG . ? A MG 209 ? 1_555 O ? Y HOH . ? A HOH 498 ? 1_555 88.2 ? 75 O ? Y HOH . ? A HOH 338 ? 18_555 MG ? J MG . ? A MG 209 ? 1_555 O ? Y HOH . ? A HOH 498 ? 43_544 96.2 ? 76 O ? Y HOH . ? A HOH 498 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? Y HOH . ? A HOH 498 ? 43_544 174.4 ? 77 O ? Y HOH . ? A HOH 420 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 503 ? 9_555 86.8 ? 78 O ? Y HOH . ? A HOH 420 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 513 ? 1_555 86.7 ? 79 O ? Y HOH . ? A HOH 503 ? 9_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 513 ? 1_555 173.5 ? 80 O ? Y HOH . ? A HOH 420 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 519 ? 1_555 95.7 ? 81 O ? Y HOH . ? A HOH 503 ? 9_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 519 ? 1_555 87.5 ? 82 O ? Y HOH . ? A HOH 513 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 519 ? 1_555 93.4 ? 83 O ? Y HOH . ? A HOH 420 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 563 ? 1_555 87.3 ? 84 O ? Y HOH . ? A HOH 503 ? 9_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 563 ? 1_555 89.9 ? 85 O ? Y HOH . ? A HOH 513 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 563 ? 1_555 89.5 ? 86 O ? Y HOH . ? A HOH 519 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 563 ? 1_555 175.9 ? 87 O ? Y HOH . ? A HOH 420 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 566 ? 9_555 175.5 ? 88 O ? Y HOH . ? A HOH 503 ? 9_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 566 ? 9_555 90.8 ? 89 O ? Y HOH . ? A HOH 513 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 566 ? 9_555 95.7 ? 90 O ? Y HOH . ? A HOH 519 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 566 ? 9_555 88.0 ? 91 O ? Y HOH . ? A HOH 563 ? 1_555 MG ? K MG . ? A MG 210 ? 1_555 O ? Y HOH . ? A HOH 566 ? 9_555 88.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-09 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' pdbx_struct_special_symmetry 7 2 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 7 2 'Structure model' '_pdbx_struct_conn_angle.value' 8 2 'Structure model' '_struct_conn.pdbx_dist_value' 9 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 10 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 11 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 12 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 2 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 88 ? ? O A HOH 301 ? ? 1.60 2 1 NE2 A GLN 97 ? B O A HOH 302 ? ? 1.79 3 1 OE1 A GLN 97 ? A O A HOH 303 ? ? 1.80 4 1 NE2 A GLN 97 ? A O A HOH 304 ? ? 1.82 5 1 O A HOH 490 ? ? O A HOH 510 ? ? 1.83 6 1 OD1 A ASP 119 ? A O A HOH 305 ? ? 1.93 7 1 OD2 A ASP 119 ? B O A HOH 306 ? ? 2.06 8 1 NH1 A ARG 143 ? B O A HOH 307 ? ? 2.09 9 1 O A HOH 495 ? ? O A HOH 567 ? ? 2.14 10 1 O A HOH 543 ? ? O A HOH 568 ? ? 2.17 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 308 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 415 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 18_555 _pdbx_validate_symm_contact.dist 2.10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 42 ? ? -120.70 -63.26 2 1 TYR A 133 ? ? -125.26 -54.07 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 573 ? 6.52 . 2 1 O ? A HOH 574 ? 7.01 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 115 ? CD ? A LYS 115 CD 2 1 Y 1 A LYS 115 ? CE ? A LYS 115 CE 3 1 Y 1 A LYS 115 ? NZ ? A LYS 115 NZ # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 MG MG MG N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'CHLORIDE ION' CL 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3KA3 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details 'ferritin is a 24-mer' #