data_5XI9 # _entry.id 5XI9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XI9 pdb_00005xi9 10.2210/pdb5xi9/pdb WWPDB D_1300003596 ? ? BMRB 36077 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5XIR unspecified BMRB . 36077 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5XI9 _pdbx_database_status.recvd_initial_deposition_date 2017-04-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hoshikawa, M.' 1 ? 'Tochio, N.' 2 ? 'Tate, S.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Molecules _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1420-3049 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Substrate Binding Switches the Conformation at the Lynchpin Site in the Substrate-Binding Domain of Human Hsp70 to Enable Allosteric Interdomain Communication. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/molecules23030528 _citation.pdbx_database_id_PubMed 29495458 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Umehara, K.' 1 ? primary 'Hoshikawa, M.' 2 ? primary 'Tochio, N.' 3 ? primary 'Tate, S.I.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Heat shock 70 kDa protein 1A' _entity.formula_weight 20323.885 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP RESIDUES 381-564' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Heat shock 70 kDa protein 1,HSP70.1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRF ELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAK NALESYAFNMKSAVEDEGLKGKISE ; _entity_poly.pdbx_seq_one_letter_code_can ;HMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRF ELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAK NALESYAFNMKSAVEDEGLKGKISE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 GLY n 1 4 ASP n 1 5 LYS n 1 6 SER n 1 7 GLU n 1 8 ASN n 1 9 VAL n 1 10 GLN n 1 11 ASP n 1 12 LEU n 1 13 LEU n 1 14 LEU n 1 15 LEU n 1 16 ASP n 1 17 VAL n 1 18 ALA n 1 19 PRO n 1 20 LEU n 1 21 SER n 1 22 LEU n 1 23 GLY n 1 24 LEU n 1 25 GLU n 1 26 THR n 1 27 ALA n 1 28 GLY n 1 29 GLY n 1 30 VAL n 1 31 MET n 1 32 THR n 1 33 ALA n 1 34 LEU n 1 35 ILE n 1 36 LYS n 1 37 ARG n 1 38 ASN n 1 39 SER n 1 40 THR n 1 41 ILE n 1 42 PRO n 1 43 THR n 1 44 LYS n 1 45 GLN n 1 46 THR n 1 47 GLN n 1 48 ILE n 1 49 PHE n 1 50 THR n 1 51 THR n 1 52 TYR n 1 53 SER n 1 54 ASP n 1 55 ASN n 1 56 GLN n 1 57 PRO n 1 58 GLY n 1 59 VAL n 1 60 LEU n 1 61 ILE n 1 62 GLN n 1 63 VAL n 1 64 TYR n 1 65 GLU n 1 66 GLY n 1 67 GLU n 1 68 ARG n 1 69 ALA n 1 70 MET n 1 71 THR n 1 72 LYS n 1 73 ASP n 1 74 ASN n 1 75 ASN n 1 76 LEU n 1 77 LEU n 1 78 GLY n 1 79 ARG n 1 80 PHE n 1 81 GLU n 1 82 LEU n 1 83 SER n 1 84 GLY n 1 85 ILE n 1 86 PRO n 1 87 PRO n 1 88 ALA n 1 89 PRO n 1 90 ARG n 1 91 GLY n 1 92 VAL n 1 93 PRO n 1 94 GLN n 1 95 ILE n 1 96 GLU n 1 97 VAL n 1 98 THR n 1 99 PHE n 1 100 ASP n 1 101 ILE n 1 102 ASP n 1 103 ALA n 1 104 ASN n 1 105 GLY n 1 106 ILE n 1 107 LEU n 1 108 ASN n 1 109 VAL n 1 110 THR n 1 111 ALA n 1 112 THR n 1 113 ASP n 1 114 LYS n 1 115 SER n 1 116 THR n 1 117 GLY n 1 118 LYS n 1 119 ALA n 1 120 ASN n 1 121 LYS n 1 122 ILE n 1 123 THR n 1 124 ILE n 1 125 THR n 1 126 ASN n 1 127 ASP n 1 128 LYS n 1 129 GLY n 1 130 ARG n 1 131 LEU n 1 132 SER n 1 133 LYS n 1 134 GLU n 1 135 GLU n 1 136 ILE n 1 137 GLU n 1 138 ARG n 1 139 MET n 1 140 VAL n 1 141 GLN n 1 142 GLU n 1 143 ALA n 1 144 GLU n 1 145 LYS n 1 146 TYR n 1 147 LYS n 1 148 ALA n 1 149 GLU n 1 150 ASP n 1 151 GLU n 1 152 VAL n 1 153 GLN n 1 154 ARG n 1 155 GLU n 1 156 ARG n 1 157 VAL n 1 158 SER n 1 159 ALA n 1 160 LYS n 1 161 ASN n 1 162 ALA n 1 163 LEU n 1 164 GLU n 1 165 SER n 1 166 TYR n 1 167 ALA n 1 168 PHE n 1 169 ASN n 1 170 MET n 1 171 LYS n 1 172 SER n 1 173 ALA n 1 174 VAL n 1 175 GLU n 1 176 ASP n 1 177 GLU n 1 178 GLY n 1 179 LEU n 1 180 LYS n 1 181 GLY n 1 182 LYS n 1 183 ILE n 1 184 SER n 1 185 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 185 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HSPA1A, HSP72, HSPA1, HSX70' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HS71A_HUMAN _struct_ref.pdbx_db_accession P0DMV8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFE LSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN ALESYAFNMKSAVEDEGLKGKISE ; _struct_ref.pdbx_align_begin 381 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XI9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 185 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0DMV8 _struct_ref_seq.db_align_beg 381 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 564 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 185 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5XI9 _struct_ref_seq_dif.mon_id HIS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P0DMV8 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCO' 1 isotropic 2 1 1 '3D HN(CA)CO' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D HN(CO)CA' 1 isotropic 5 1 1 '3D CBCA(CO)NH' 1 isotropic 6 1 1 '3D HNCACB' 1 isotropic 7 1 1 '3D C(CO)NH' 1 isotropic 8 1 1 '3D HBHA(CO)NH' 1 isotropic 9 1 1 '3D HCCH-TOCSY' 1 isotropic 10 1 1 '3D CCH-TOCSY' 1 isotropic 11 1 1 '3D HCCH-COSY' 1 isotropic 12 1 1 '3D 1H-15N NOESY' 1 isotropic 13 1 1 '3D 1H-13C NOESY' 1 isotropic 14 1 1 '2D 1H-15N HSQC' 1 isotropic 15 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50 mM potassium phosphate, 50 mM potassium chloride, 10 mM DTT, 94% H2O/6% D2O' _pdbx_nmr_sample_details.solvent_system '94% H2O/6% D2O' _pdbx_nmr_sample_details.label SBD _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE II' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5XI9 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # _pdbx_nmr_ensemble.entry_id 5XI9 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5XI9 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'data analysis' MAGRO ? 'Kobayashi, N.' 4 'data analysis' NMRView ? 'Johnson, One Moon Scientific' 5 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XI9 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5XI9 _struct.title 'Solution structure for human HSP70 substrate binding domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XI9 _struct_keywords.text 'heat shock protein 70 kDa, self-biting state, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 70 ? ASN A 74 ? MET A 70 ASN A 74 5 ? 5 HELX_P HELX_P2 AA2 SER A 132 ? GLU A 142 ? SER A 132 GLU A 142 1 ? 11 HELX_P HELX_P3 AA3 GLU A 142 ? VAL A 157 ? GLU A 142 VAL A 157 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 41 A . ? ILE 41 A PRO 42 A ? PRO 42 A 1 -0.17 2 ILE 41 A . ? ILE 41 A PRO 42 A ? PRO 42 A 2 0.81 3 ILE 41 A . ? ILE 41 A PRO 42 A ? PRO 42 A 3 1.48 4 ILE 41 A . ? ILE 41 A PRO 42 A ? PRO 42 A 4 -2.45 5 ILE 41 A . ? ILE 41 A PRO 42 A ? PRO 42 A 5 -0.09 6 ILE 41 A . ? ILE 41 A PRO 42 A ? PRO 42 A 6 0.33 7 ILE 41 A . ? ILE 41 A PRO 42 A ? PRO 42 A 7 0.18 8 ILE 41 A . ? ILE 41 A PRO 42 A ? PRO 42 A 8 0.36 9 ILE 41 A . ? ILE 41 A PRO 42 A ? PRO 42 A 9 0.46 10 ILE 41 A . ? ILE 41 A PRO 42 A ? PRO 42 A 10 0.00 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 30 ? ILE A 35 ? VAL A 30 ILE A 35 AA1 2 LEU A 22 ? THR A 26 ? LEU A 22 THR A 26 AA1 3 VAL A 59 ? GLU A 65 ? VAL A 59 GLU A 65 AA1 4 GLY A 78 ? LEU A 82 ? GLY A 78 LEU A 82 AA2 1 ALA A 119 ? THR A 125 ? ALA A 119 THR A 125 AA2 2 ILE A 106 ? ASP A 113 ? ILE A 106 ASP A 113 AA2 3 ILE A 95 ? ILE A 101 ? ILE A 95 ILE A 101 AA2 4 LYS A 44 ? TYR A 52 ? LYS A 44 TYR A 52 AA2 5 ALA A 162 ? GLU A 164 ? ALA A 162 GLU A 164 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 35 ? O ILE A 35 N LEU A 22 ? N LEU A 22 AA1 2 3 N GLY A 23 ? N GLY A 23 O TYR A 64 ? O TYR A 64 AA1 3 4 N VAL A 59 ? N VAL A 59 O LEU A 82 ? O LEU A 82 AA2 1 2 O ILE A 124 ? O ILE A 124 N LEU A 107 ? N LEU A 107 AA2 2 3 O THR A 112 ? O THR A 112 N GLU A 96 ? N GLU A 96 AA2 3 4 O PHE A 99 ? O PHE A 99 N GLN A 45 ? N GLN A 45 AA2 4 5 N TYR A 52 ? N TYR A 52 O LEU A 163 ? O LEU A 163 # _atom_sites.entry_id 5XI9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 1 HIS HIS A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 MET 139 139 139 MET MET A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 TYR 166 166 166 TYR TYR A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 MET 170 170 170 MET MET A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 GLU 185 185 185 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12340 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-16 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'potassium phosphate' 50 ? mM 'natural abundance' 1 'potassium chloride' 50 ? mM 'natural abundance' 1 DTT 10 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HZ2 A LYS 5 ? ? OE1 A GLU 7 ? ? 1.59 2 2 HZ2 A LYS 147 ? ? OD1 A ASP 150 ? ? 1.60 3 4 OE2 A GLU 67 ? ? HZ3 A LYS 147 ? ? 1.56 4 7 HZ1 A LYS 121 ? ? OD2 A ASP 176 ? ? 1.58 5 8 OE2 A GLU 142 ? ? HZ1 A LYS 145 ? ? 1.59 6 9 HZ2 A LYS 121 ? ? OE1 A GLU 175 ? ? 1.58 7 9 OE1 A GLU 67 ? ? HZ3 A LYS 147 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 27 ? ? -47.41 105.92 2 1 ASP A 54 ? ? -77.01 -71.86 3 1 ASP A 127 ? ? 67.96 -75.62 4 1 ASN A 161 ? ? -150.74 28.64 5 1 GLU A 177 ? ? -58.48 97.61 6 2 LEU A 13 ? ? 63.73 78.33 7 2 ASN A 38 ? ? 81.91 2.79 8 2 ASP A 54 ? ? -146.79 -39.53 9 2 GLU A 67 ? ? -73.63 46.56 10 2 VAL A 92 ? ? 68.97 104.10 11 2 LYS A 128 ? ? -148.93 -41.47 12 2 ASN A 161 ? ? -154.48 17.62 13 2 TYR A 166 ? ? -168.61 117.87 14 3 PRO A 87 ? ? -65.44 -177.40 15 3 ASP A 127 ? ? 59.93 -83.27 16 3 ASN A 161 ? ? -141.34 -14.15 17 3 TYR A 166 ? ? -166.36 118.12 18 4 ASN A 38 ? ? 70.46 39.74 19 4 ASN A 55 ? ? -140.91 -49.39 20 4 GLU A 67 ? ? -176.73 126.12 21 4 ARG A 68 ? ? -173.89 131.13 22 4 LEU A 77 ? ? -92.04 -68.50 23 4 PRO A 89 ? ? -71.08 44.79 24 4 LYS A 160 ? ? -90.78 -62.22 25 5 ASP A 54 ? ? -155.89 -74.03 26 5 ASN A 126 ? ? 51.75 87.89 27 5 ASP A 127 ? ? -128.32 -86.57 28 5 LYS A 128 ? ? 36.10 82.30 29 5 LYS A 160 ? ? -133.97 -47.69 30 5 SER A 165 ? ? -94.63 33.35 31 6 ASP A 4 ? ? -91.56 -89.39 32 6 ALA A 27 ? ? -49.41 106.98 33 6 LEU A 34 ? ? -103.56 -64.73 34 6 ASN A 55 ? ? 58.02 77.49 35 6 GLU A 67 ? ? 73.07 -43.19 36 6 ALA A 69 ? ? -69.71 2.80 37 6 PRO A 89 ? ? -67.11 79.38 38 6 SER A 158 ? ? 73.29 -37.74 39 7 ASP A 54 ? ? -143.22 -67.99 40 7 GLU A 67 ? ? 175.95 100.86 41 7 THR A 71 ? ? -54.43 -8.96 42 7 LEU A 77 ? ? -93.74 -70.79 43 7 LYS A 128 ? ? -171.88 -28.32 44 8 GLN A 10 ? ? 62.18 87.74 45 8 ALA A 27 ? ? -54.70 106.92 46 8 ARG A 37 ? ? -68.09 92.91 47 8 ASN A 38 ? ? -177.53 -34.36 48 8 ASP A 54 ? ? -141.27 -53.22 49 8 LEU A 77 ? ? -91.02 -67.43 50 8 ASN A 161 ? ? -167.33 56.41 51 8 ASN A 169 ? ? 55.05 84.27 52 9 ARG A 68 ? ? -168.96 118.28 53 9 MET A 70 ? ? -77.58 29.34 54 9 THR A 71 ? ? -54.42 -8.93 55 9 PRO A 87 ? ? -95.37 -158.69 56 9 ASN A 161 ? ? -141.30 24.20 57 10 ARG A 37 ? ? -75.47 21.33 58 10 GLN A 56 ? ? -170.03 117.04 59 10 PRO A 57 ? ? -76.94 29.15 60 10 GLU A 67 ? ? -152.20 28.38 61 10 THR A 71 ? ? -28.61 -40.95 62 10 PRO A 89 ? ? -55.62 101.46 63 10 ASN A 126 ? ? 60.65 79.84 64 10 ASN A 169 ? ? -160.04 95.42 65 10 GLU A 175 ? ? -115.72 74.27 # _pdbx_audit_support.funding_organization ? _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #