data_5XNT # _entry.id 5XNT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.291 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5XNT WWPDB D_1300003853 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5XNT _pdbx_database_status.recvd_initial_deposition_date 2017-05-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lee, C.W.' 1 ? 'Kim, K.-H.' 2 ? 'Bikash, D.' 3 ? 'Park, S.-H.' 4 ? 'Park, H.' 5 ? 'Oh, T.-J.' 6 ? 'Lee, J.H.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country KR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Microbiol. Biotechnol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1738-8872 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 1472 _citation.page_last 1482 _citation.title 'Crystal Structure and Functional Characterization of a Cytochrome P450 (BaCYP106A2) fromBacillussp. PAMC 23377.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.4014/jmb.1706.06013 _citation.pdbx_database_id_PubMed 28633515 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kim, K.H.' 1 primary 'Lee, C.W.' 2 primary 'Dangi, B.' 3 primary 'Park, S.H.' 4 primary 'Park, H.' 5 primary 'Oh, T.J.' 6 primary 'Lee, J.H.' 7 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5XNT _cell.details ? _cell.formula_units_Z ? _cell.length_a 77.658 _cell.length_a_esd ? _cell.length_b 77.658 _cell.length_b_esd ? _cell.length_c 282.216 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5XNT _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome P450 CYP106' 47433.875 1 ? ? ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 water nat water 18.015 24 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKEVIAIKEFTRFKTRTEEFSPYAWCKRMLENDPVSYHEGTDTWNVFKYEDVKRVLSDYKHFSSVRKRTTISVGTDSEEG SVPDKIKITEADPPEHRKRRSLLAAAFTPRSLQNWEPRIQEIADELIEEMDEETEIDIVQSLASPLPIIVMSDLMGVPSK DRLLFKKWVDILFLPFDKEKQEEVNELKQVAAKEYYQYLYPIVVQKRLNPADDIISDLLKAEVDGEMFTDDEVVRTTMLI LGAGVETTSHLLANSFYSLLYDDKEVYQELHENLDLVPQAVEEMLRYRFNLIKLDRTVKEDNDLLGVELKEGENVVVWMS AANLDEEMFEDAFTLNIHRPNNKKHLTFGNGPHFCLGAPLARLEAKIALTTFLKKFKHIEAVPSFQLEDNLTDSATGQTL TSLPLKACRTL ; _entity_poly.pdbx_seq_one_letter_code_can ;MKEVIAIKEFTRFKTRTEEFSPYAWCKRMLENDPVSYHEGTDTWNVFKYEDVKRVLSDYKHFSSVRKRTTISVGTDSEEG SVPDKIKITEADPPEHRKRRSLLAAAFTPRSLQNWEPRIQEIADELIEEMDEETEIDIVQSLASPLPIIVMSDLMGVPSK DRLLFKKWVDILFLPFDKEKQEEVNELKQVAAKEYYQYLYPIVVQKRLNPADDIISDLLKAEVDGEMFTDDEVVRTTMLI LGAGVETTSHLLANSFYSLLYDDKEVYQELHENLDLVPQAVEEMLRYRFNLIKLDRTVKEDNDLLGVELKEGENVVVWMS AANLDEEMFEDAFTLNIHRPNNKKHLTFGNGPHFCLGAPLARLEAKIALTTFLKKFKHIEAVPSFQLEDNLTDSATGQTL TSLPLKACRTL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLU n 1 4 VAL n 1 5 ILE n 1 6 ALA n 1 7 ILE n 1 8 LYS n 1 9 GLU n 1 10 PHE n 1 11 THR n 1 12 ARG n 1 13 PHE n 1 14 LYS n 1 15 THR n 1 16 ARG n 1 17 THR n 1 18 GLU n 1 19 GLU n 1 20 PHE n 1 21 SER n 1 22 PRO n 1 23 TYR n 1 24 ALA n 1 25 TRP n 1 26 CYS n 1 27 LYS n 1 28 ARG n 1 29 MET n 1 30 LEU n 1 31 GLU n 1 32 ASN n 1 33 ASP n 1 34 PRO n 1 35 VAL n 1 36 SER n 1 37 TYR n 1 38 HIS n 1 39 GLU n 1 40 GLY n 1 41 THR n 1 42 ASP n 1 43 THR n 1 44 TRP n 1 45 ASN n 1 46 VAL n 1 47 PHE n 1 48 LYS n 1 49 TYR n 1 50 GLU n 1 51 ASP n 1 52 VAL n 1 53 LYS n 1 54 ARG n 1 55 VAL n 1 56 LEU n 1 57 SER n 1 58 ASP n 1 59 TYR n 1 60 LYS n 1 61 HIS n 1 62 PHE n 1 63 SER n 1 64 SER n 1 65 VAL n 1 66 ARG n 1 67 LYS n 1 68 ARG n 1 69 THR n 1 70 THR n 1 71 ILE n 1 72 SER n 1 73 VAL n 1 74 GLY n 1 75 THR n 1 76 ASP n 1 77 SER n 1 78 GLU n 1 79 GLU n 1 80 GLY n 1 81 SER n 1 82 VAL n 1 83 PRO n 1 84 ASP n 1 85 LYS n 1 86 ILE n 1 87 LYS n 1 88 ILE n 1 89 THR n 1 90 GLU n 1 91 ALA n 1 92 ASP n 1 93 PRO n 1 94 PRO n 1 95 GLU n 1 96 HIS n 1 97 ARG n 1 98 LYS n 1 99 ARG n 1 100 ARG n 1 101 SER n 1 102 LEU n 1 103 LEU n 1 104 ALA n 1 105 ALA n 1 106 ALA n 1 107 PHE n 1 108 THR n 1 109 PRO n 1 110 ARG n 1 111 SER n 1 112 LEU n 1 113 GLN n 1 114 ASN n 1 115 TRP n 1 116 GLU n 1 117 PRO n 1 118 ARG n 1 119 ILE n 1 120 GLN n 1 121 GLU n 1 122 ILE n 1 123 ALA n 1 124 ASP n 1 125 GLU n 1 126 LEU n 1 127 ILE n 1 128 GLU n 1 129 GLU n 1 130 MET n 1 131 ASP n 1 132 GLU n 1 133 GLU n 1 134 THR n 1 135 GLU n 1 136 ILE n 1 137 ASP n 1 138 ILE n 1 139 VAL n 1 140 GLN n 1 141 SER n 1 142 LEU n 1 143 ALA n 1 144 SER n 1 145 PRO n 1 146 LEU n 1 147 PRO n 1 148 ILE n 1 149 ILE n 1 150 VAL n 1 151 MET n 1 152 SER n 1 153 ASP n 1 154 LEU n 1 155 MET n 1 156 GLY n 1 157 VAL n 1 158 PRO n 1 159 SER n 1 160 LYS n 1 161 ASP n 1 162 ARG n 1 163 LEU n 1 164 LEU n 1 165 PHE n 1 166 LYS n 1 167 LYS n 1 168 TRP n 1 169 VAL n 1 170 ASP n 1 171 ILE n 1 172 LEU n 1 173 PHE n 1 174 LEU n 1 175 PRO n 1 176 PHE n 1 177 ASP n 1 178 LYS n 1 179 GLU n 1 180 LYS n 1 181 GLN n 1 182 GLU n 1 183 GLU n 1 184 VAL n 1 185 ASN n 1 186 GLU n 1 187 LEU n 1 188 LYS n 1 189 GLN n 1 190 VAL n 1 191 ALA n 1 192 ALA n 1 193 LYS n 1 194 GLU n 1 195 TYR n 1 196 TYR n 1 197 GLN n 1 198 TYR n 1 199 LEU n 1 200 TYR n 1 201 PRO n 1 202 ILE n 1 203 VAL n 1 204 VAL n 1 205 GLN n 1 206 LYS n 1 207 ARG n 1 208 LEU n 1 209 ASN n 1 210 PRO n 1 211 ALA n 1 212 ASP n 1 213 ASP n 1 214 ILE n 1 215 ILE n 1 216 SER n 1 217 ASP n 1 218 LEU n 1 219 LEU n 1 220 LYS n 1 221 ALA n 1 222 GLU n 1 223 VAL n 1 224 ASP n 1 225 GLY n 1 226 GLU n 1 227 MET n 1 228 PHE n 1 229 THR n 1 230 ASP n 1 231 ASP n 1 232 GLU n 1 233 VAL n 1 234 VAL n 1 235 ARG n 1 236 THR n 1 237 THR n 1 238 MET n 1 239 LEU n 1 240 ILE n 1 241 LEU n 1 242 GLY n 1 243 ALA n 1 244 GLY n 1 245 VAL n 1 246 GLU n 1 247 THR n 1 248 THR n 1 249 SER n 1 250 HIS n 1 251 LEU n 1 252 LEU n 1 253 ALA n 1 254 ASN n 1 255 SER n 1 256 PHE n 1 257 TYR n 1 258 SER n 1 259 LEU n 1 260 LEU n 1 261 TYR n 1 262 ASP n 1 263 ASP n 1 264 LYS n 1 265 GLU n 1 266 VAL n 1 267 TYR n 1 268 GLN n 1 269 GLU n 1 270 LEU n 1 271 HIS n 1 272 GLU n 1 273 ASN n 1 274 LEU n 1 275 ASP n 1 276 LEU n 1 277 VAL n 1 278 PRO n 1 279 GLN n 1 280 ALA n 1 281 VAL n 1 282 GLU n 1 283 GLU n 1 284 MET n 1 285 LEU n 1 286 ARG n 1 287 TYR n 1 288 ARG n 1 289 PHE n 1 290 ASN n 1 291 LEU n 1 292 ILE n 1 293 LYS n 1 294 LEU n 1 295 ASP n 1 296 ARG n 1 297 THR n 1 298 VAL n 1 299 LYS n 1 300 GLU n 1 301 ASP n 1 302 ASN n 1 303 ASP n 1 304 LEU n 1 305 LEU n 1 306 GLY n 1 307 VAL n 1 308 GLU n 1 309 LEU n 1 310 LYS n 1 311 GLU n 1 312 GLY n 1 313 GLU n 1 314 ASN n 1 315 VAL n 1 316 VAL n 1 317 VAL n 1 318 TRP n 1 319 MET n 1 320 SER n 1 321 ALA n 1 322 ALA n 1 323 ASN n 1 324 LEU n 1 325 ASP n 1 326 GLU n 1 327 GLU n 1 328 MET n 1 329 PHE n 1 330 GLU n 1 331 ASP n 1 332 ALA n 1 333 PHE n 1 334 THR n 1 335 LEU n 1 336 ASN n 1 337 ILE n 1 338 HIS n 1 339 ARG n 1 340 PRO n 1 341 ASN n 1 342 ASN n 1 343 LYS n 1 344 LYS n 1 345 HIS n 1 346 LEU n 1 347 THR n 1 348 PHE n 1 349 GLY n 1 350 ASN n 1 351 GLY n 1 352 PRO n 1 353 HIS n 1 354 PHE n 1 355 CYS n 1 356 LEU n 1 357 GLY n 1 358 ALA n 1 359 PRO n 1 360 LEU n 1 361 ALA n 1 362 ARG n 1 363 LEU n 1 364 GLU n 1 365 ALA n 1 366 LYS n 1 367 ILE n 1 368 ALA n 1 369 LEU n 1 370 THR n 1 371 THR n 1 372 PHE n 1 373 LEU n 1 374 LYS n 1 375 LYS n 1 376 PHE n 1 377 LYS n 1 378 HIS n 1 379 ILE n 1 380 GLU n 1 381 ALA n 1 382 VAL n 1 383 PRO n 1 384 SER n 1 385 PHE n 1 386 GLN n 1 387 LEU n 1 388 GLU n 1 389 ASP n 1 390 ASN n 1 391 LEU n 1 392 THR n 1 393 ASP n 1 394 SER n 1 395 ALA n 1 396 THR n 1 397 GLY n 1 398 GLN n 1 399 THR n 1 400 LEU n 1 401 THR n 1 402 SER n 1 403 LEU n 1 404 PRO n 1 405 LEU n 1 406 LYS n 1 407 ALA n 1 408 CYS n 1 409 ARG n 1 410 THR n 1 411 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 411 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus butanolivorans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 421767 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5XNT _struct_ref.pdbx_db_accession 5XNT _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XNT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 411 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5XNT _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 411 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 411 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XNT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.59 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.50 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M sodium cacodylate:HCl pH 6.5, 1.26 M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5XNT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.70 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14704 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 40.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.01 _refine.aniso_B[1][2] -0.01 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.01 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.03 _refine.B_iso_max ? _refine.B_iso_mean 57.205 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.948 _refine.correlation_coeff_Fo_to_Fc_free 0.910 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5XNT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.70 _refine.ls_d_res_low 48.68 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13914 _refine.ls_number_reflns_R_free 714 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.40 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19406 _refine.ls_R_factor_R_free 0.25674 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19066 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 1.021 _refine.pdbx_overall_ESU_R_Free 0.342 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 12.218 _refine.overall_SU_ML 0.252 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 3196 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 3263 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 48.68 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.019 3313 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 3092 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.656 1.992 4499 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.035 3.000 7188 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.353 5.000 390 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.278 24.812 160 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.699 15.000 601 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.390 15.000 19 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.093 0.200 499 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.021 3621 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 658 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.033 5.466 1566 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.027 5.463 1565 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.156 8.188 1954 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.157 8.192 1955 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.779 6.036 1745 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.777 6.038 1743 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.683 8.783 2544 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 9.891 63.014 3696 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 9.890 63.013 3697 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.702 _refine_ls_shell.d_res_low 2.772 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 43 _refine_ls_shell.number_reflns_R_work 1026 _refine_ls_shell.percent_reflns_obs 99.81 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.321 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.188 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5XNT _struct.title 'Structure of CYP106A2 from Bacillus sp. PAMC 23377' _struct.pdbx_descriptor 'Cytochrome P450 CYP106' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XNT _struct_keywords.text 'Bacillus sp. cytochrome P450 steroid hydroxylase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 7 ? ARG A 12 ? ILE A 7 ARG A 12 1 ? 6 HELX_P HELX_P2 AA2 THR A 15 ? SER A 21 ? THR A 15 SER A 21 1 ? 7 HELX_P HELX_P3 AA3 PRO A 22 ? ASP A 33 ? PRO A 22 ASP A 33 1 ? 12 HELX_P HELX_P4 AA4 LYS A 48 ? ASP A 58 ? LYS A 48 ASP A 58 1 ? 11 HELX_P HELX_P5 AA5 LYS A 87 ? ALA A 91 ? LYS A 87 ALA A 91 5 ? 5 HELX_P HELX_P6 AA6 PRO A 94 ? ALA A 105 ? PRO A 94 ALA A 105 1 ? 12 HELX_P HELX_P7 AA7 THR A 108 ? GLU A 129 ? THR A 108 GLU A 129 1 ? 22 HELX_P HELX_P8 AA8 ILE A 138 ? LEU A 142 ? ILE A 138 LEU A 142 1 ? 5 HELX_P HELX_P9 AA9 SER A 144 ? GLY A 156 ? SER A 144 GLY A 156 1 ? 13 HELX_P HELX_P10 AB1 PRO A 158 ? LYS A 160 ? PRO A 158 LYS A 160 5 ? 3 HELX_P HELX_P11 AB2 ASP A 161 ? LEU A 174 ? ASP A 161 LEU A 174 1 ? 14 HELX_P HELX_P12 AB3 GLU A 183 ? ASN A 209 ? GLU A 183 ASN A 209 1 ? 27 HELX_P HELX_P13 AB4 ASP A 213 ? ALA A 221 ? ASP A 213 ALA A 221 1 ? 9 HELX_P HELX_P14 AB5 THR A 229 ? ASP A 262 ? THR A 229 ASP A 262 1 ? 34 HELX_P HELX_P15 AB6 GLU A 265 ? ASN A 273 ? GLU A 265 ASN A 273 1 ? 9 HELX_P HELX_P16 AB7 LEU A 276 ? ARG A 288 ? LEU A 276 ARG A 288 1 ? 13 HELX_P HELX_P17 AB8 MET A 319 ? ASN A 323 ? MET A 319 ASN A 323 1 ? 5 HELX_P HELX_P18 AB9 ASN A 341 ? HIS A 345 ? ASN A 341 HIS A 345 5 ? 5 HELX_P HELX_P19 AC1 GLY A 357 ? LYS A 375 ? GLY A 357 LYS A 375 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 408 SG ? ? ? 1_555 A CYS 408 SG ? ? A CYS 408 A CYS 408 12_555 ? ? ? ? ? ? ? 2.681 ? metalc1 metalc ? ? A CYS 355 SG ? ? ? 1_555 B HEM . FE ? ? A CYS 355 A HEM 501 1_555 ? ? ? ? ? ? ? 2.275 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 93 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 93 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 94 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 94 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 11.12 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 35 ? TYR A 37 ? VAL A 35 TYR A 37 AA1 2 THR A 43 ? VAL A 46 ? THR A 43 VAL A 46 AA1 3 ASN A 314 ? TRP A 318 ? ASN A 314 TRP A 318 AA1 4 LYS A 293 ? VAL A 298 ? LYS A 293 VAL A 298 AA1 5 PHE A 62 ? SER A 63 ? PHE A 62 SER A 63 AA2 1 ILE A 136 ? ASP A 137 ? ILE A 136 ASP A 137 AA2 2 PRO A 404 ? ARG A 409 ? PRO A 404 ARG A 409 AA2 3 PHE A 376 ? ALA A 381 ? PHE A 376 ALA A 381 AA3 1 LEU A 391 ? SER A 394 ? LEU A 391 SER A 394 AA3 2 GLY A 397 ? LEU A 400 ? GLY A 397 LEU A 400 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 36 ? N SER A 36 O ASN A 45 ? O ASN A 45 AA1 2 3 N TRP A 44 ? N TRP A 44 O ASN A 314 ? O ASN A 314 AA1 3 4 O VAL A 317 ? O VAL A 317 N LEU A 294 ? N LEU A 294 AA1 4 5 O THR A 297 ? O THR A 297 N SER A 63 ? N SER A 63 AA2 1 2 N ILE A 136 ? N ILE A 136 O LEU A 405 ? O LEU A 405 AA2 2 3 O LYS A 406 ? O LYS A 406 N GLU A 380 ? N GLU A 380 AA3 1 2 N THR A 392 ? N THR A 392 O THR A 399 ? O THR A 399 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEM _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'binding site for residue HEM A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 ILE A 88 ? ILE A 88 . ? 1_555 ? 2 AC1 16 HIS A 96 ? HIS A 96 . ? 1_555 ? 3 AC1 16 ARG A 100 ? ARG A 100 . ? 1_555 ? 4 AC1 16 PHE A 107 ? PHE A 107 . ? 1_555 ? 5 AC1 16 ALA A 243 ? ALA A 243 . ? 1_555 ? 6 AC1 16 GLY A 244 ? GLY A 244 . ? 1_555 ? 7 AC1 16 THR A 247 ? THR A 247 . ? 1_555 ? 8 AC1 16 THR A 248 ? THR A 248 . ? 1_555 ? 9 AC1 16 LEU A 294 ? LEU A 294 . ? 1_555 ? 10 AC1 16 ARG A 296 ? ARG A 296 . ? 1_555 ? 11 AC1 16 THR A 347 ? THR A 347 . ? 1_555 ? 12 AC1 16 PHE A 348 ? PHE A 348 . ? 1_555 ? 13 AC1 16 GLY A 349 ? GLY A 349 . ? 1_555 ? 14 AC1 16 HIS A 353 ? HIS A 353 . ? 1_555 ? 15 AC1 16 CYS A 355 ? CYS A 355 . ? 1_555 ? 16 AC1 16 GLY A 357 ? GLY A 357 . ? 1_555 ? # _atom_sites.entry_id 5XNT _atom_sites.fract_transf_matrix[1][1] 0.012877 _atom_sites.fract_transf_matrix[1][2] 0.007435 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014869 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003543 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 ILE 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ARG 68 68 ? ? ? A . n A 1 69 THR 69 69 ? ? ? A . n A 1 70 THR 70 70 ? ? ? A . n A 1 71 ILE 71 71 ? ? ? A . n A 1 72 SER 72 72 ? ? ? A . n A 1 73 VAL 73 73 ? ? ? A . n A 1 74 GLY 74 74 ? ? ? A . n A 1 75 THR 75 75 ? ? ? A . n A 1 76 ASP 76 76 ? ? ? A . n A 1 77 SER 77 77 ? ? ? A . n A 1 78 GLU 78 78 ? ? ? A . n A 1 79 GLU 79 79 ? ? ? A . n A 1 80 GLY 80 80 ? ? ? A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 MET 151 151 151 MET MET A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 MET 155 155 155 MET MET A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 TRP 168 168 168 TRP TRP A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 GLN 189 189 189 GLN GLN A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 TYR 195 195 195 TYR TYR A . n A 1 196 TYR 196 196 196 TYR TYR A . n A 1 197 GLN 197 197 197 GLN GLN A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 PRO 201 201 201 PRO PRO A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 ARG 207 207 207 ARG ARG A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 ASN 209 209 209 ASN ASN A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 MET 227 227 227 MET MET A . n A 1 228 PHE 228 228 228 PHE PHE A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 ASP 231 231 231 ASP ASP A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 ARG 235 235 235 ARG ARG A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 MET 238 238 238 MET MET A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 ILE 240 240 240 ILE ILE A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 GLY 242 242 242 GLY GLY A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 THR 247 247 247 THR THR A . n A 1 248 THR 248 248 248 THR THR A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 HIS 250 250 250 HIS HIS A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 ASN 254 254 254 ASN ASN A . n A 1 255 SER 255 255 255 SER SER A . n A 1 256 PHE 256 256 256 PHE PHE A . n A 1 257 TYR 257 257 257 TYR TYR A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 TYR 261 261 261 TYR TYR A . n A 1 262 ASP 262 262 262 ASP ASP A . n A 1 263 ASP 263 263 263 ASP ASP A . n A 1 264 LYS 264 264 264 LYS LYS A . n A 1 265 GLU 265 265 265 GLU GLU A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 TYR 267 267 267 TYR TYR A . n A 1 268 GLN 268 268 268 GLN GLN A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 HIS 271 271 271 HIS HIS A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 ASN 273 273 273 ASN ASN A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 ASP 275 275 275 ASP ASP A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 PRO 278 278 278 PRO PRO A . n A 1 279 GLN 279 279 279 GLN GLN A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 VAL 281 281 281 VAL VAL A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 MET 284 284 284 MET MET A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 ARG 286 286 286 ARG ARG A . n A 1 287 TYR 287 287 287 TYR TYR A . n A 1 288 ARG 288 288 288 ARG ARG A . n A 1 289 PHE 289 289 289 PHE PHE A . n A 1 290 ASN 290 290 290 ASN ASN A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 ILE 292 292 292 ILE ILE A . n A 1 293 LYS 293 293 293 LYS LYS A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 ASP 295 295 295 ASP ASP A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 THR 297 297 297 THR THR A . n A 1 298 VAL 298 298 298 VAL VAL A . n A 1 299 LYS 299 299 299 LYS LYS A . n A 1 300 GLU 300 300 300 GLU GLU A . n A 1 301 ASP 301 301 301 ASP ASP A . n A 1 302 ASN 302 302 302 ASN ASN A . n A 1 303 ASP 303 303 303 ASP ASP A . n A 1 304 LEU 304 304 304 LEU LEU A . n A 1 305 LEU 305 305 305 LEU LEU A . n A 1 306 GLY 306 306 306 GLY GLY A . n A 1 307 VAL 307 307 307 VAL VAL A . n A 1 308 GLU 308 308 308 GLU GLU A . n A 1 309 LEU 309 309 309 LEU LEU A . n A 1 310 LYS 310 310 310 LYS LYS A . n A 1 311 GLU 311 311 311 GLU GLU A . n A 1 312 GLY 312 312 312 GLY GLY A . n A 1 313 GLU 313 313 313 GLU GLU A . n A 1 314 ASN 314 314 314 ASN ASN A . n A 1 315 VAL 315 315 315 VAL VAL A . n A 1 316 VAL 316 316 316 VAL VAL A . n A 1 317 VAL 317 317 317 VAL VAL A . n A 1 318 TRP 318 318 318 TRP TRP A . n A 1 319 MET 319 319 319 MET MET A . n A 1 320 SER 320 320 320 SER SER A . n A 1 321 ALA 321 321 321 ALA ALA A . n A 1 322 ALA 322 322 322 ALA ALA A . n A 1 323 ASN 323 323 323 ASN ASN A . n A 1 324 LEU 324 324 324 LEU LEU A . n A 1 325 ASP 325 325 325 ASP ASP A . n A 1 326 GLU 326 326 326 GLU GLU A . n A 1 327 GLU 327 327 327 GLU GLU A . n A 1 328 MET 328 328 328 MET MET A . n A 1 329 PHE 329 329 329 PHE PHE A . n A 1 330 GLU 330 330 330 GLU GLU A . n A 1 331 ASP 331 331 331 ASP ASP A . n A 1 332 ALA 332 332 332 ALA ALA A . n A 1 333 PHE 333 333 333 PHE PHE A . n A 1 334 THR 334 334 334 THR THR A . n A 1 335 LEU 335 335 335 LEU LEU A . n A 1 336 ASN 336 336 336 ASN ASN A . n A 1 337 ILE 337 337 337 ILE ILE A . n A 1 338 HIS 338 338 338 HIS HIS A . n A 1 339 ARG 339 339 339 ARG ARG A . n A 1 340 PRO 340 340 340 PRO PRO A . n A 1 341 ASN 341 341 341 ASN ASN A . n A 1 342 ASN 342 342 342 ASN ASN A . n A 1 343 LYS 343 343 343 LYS LYS A . n A 1 344 LYS 344 344 344 LYS LYS A . n A 1 345 HIS 345 345 345 HIS HIS A . n A 1 346 LEU 346 346 346 LEU LEU A . n A 1 347 THR 347 347 347 THR THR A . n A 1 348 PHE 348 348 348 PHE PHE A . n A 1 349 GLY 349 349 349 GLY GLY A . n A 1 350 ASN 350 350 350 ASN ASN A . n A 1 351 GLY 351 351 351 GLY GLY A . n A 1 352 PRO 352 352 352 PRO PRO A . n A 1 353 HIS 353 353 353 HIS HIS A . n A 1 354 PHE 354 354 354 PHE PHE A . n A 1 355 CYS 355 355 355 CYS CYS A . n A 1 356 LEU 356 356 356 LEU LEU A . n A 1 357 GLY 357 357 357 GLY GLY A . n A 1 358 ALA 358 358 358 ALA ALA A . n A 1 359 PRO 359 359 359 PRO PRO A . n A 1 360 LEU 360 360 360 LEU LEU A . n A 1 361 ALA 361 361 361 ALA ALA A . n A 1 362 ARG 362 362 362 ARG ARG A . n A 1 363 LEU 363 363 363 LEU LEU A . n A 1 364 GLU 364 364 364 GLU GLU A . n A 1 365 ALA 365 365 365 ALA ALA A . n A 1 366 LYS 366 366 366 LYS LYS A . n A 1 367 ILE 367 367 367 ILE ILE A . n A 1 368 ALA 368 368 368 ALA ALA A . n A 1 369 LEU 369 369 369 LEU LEU A . n A 1 370 THR 370 370 370 THR THR A . n A 1 371 THR 371 371 371 THR THR A . n A 1 372 PHE 372 372 372 PHE PHE A . n A 1 373 LEU 373 373 373 LEU LEU A . n A 1 374 LYS 374 374 374 LYS LYS A . n A 1 375 LYS 375 375 375 LYS LYS A . n A 1 376 PHE 376 376 376 PHE PHE A . n A 1 377 LYS 377 377 377 LYS LYS A . n A 1 378 HIS 378 378 378 HIS HIS A . n A 1 379 ILE 379 379 379 ILE ILE A . n A 1 380 GLU 380 380 380 GLU GLU A . n A 1 381 ALA 381 381 381 ALA ALA A . n A 1 382 VAL 382 382 382 VAL VAL A . n A 1 383 PRO 383 383 383 PRO PRO A . n A 1 384 SER 384 384 384 SER SER A . n A 1 385 PHE 385 385 385 PHE PHE A . n A 1 386 GLN 386 386 386 GLN GLN A . n A 1 387 LEU 387 387 387 LEU LEU A . n A 1 388 GLU 388 388 388 GLU GLU A . n A 1 389 ASP 389 389 389 ASP ASP A . n A 1 390 ASN 390 390 390 ASN ASN A . n A 1 391 LEU 391 391 391 LEU LEU A . n A 1 392 THR 392 392 392 THR THR A . n A 1 393 ASP 393 393 393 ASP ASP A . n A 1 394 SER 394 394 394 SER SER A . n A 1 395 ALA 395 395 395 ALA ALA A . n A 1 396 THR 396 396 396 THR THR A . n A 1 397 GLY 397 397 397 GLY GLY A . n A 1 398 GLN 398 398 398 GLN GLN A . n A 1 399 THR 399 399 399 THR THR A . n A 1 400 LEU 400 400 400 LEU LEU A . n A 1 401 THR 401 401 401 THR THR A . n A 1 402 SER 402 402 402 SER SER A . n A 1 403 LEU 403 403 403 LEU LEU A . n A 1 404 PRO 404 404 404 PRO PRO A . n A 1 405 LEU 405 405 405 LEU LEU A . n A 1 406 LYS 406 406 406 LYS LYS A . n A 1 407 ALA 407 407 407 ALA ALA A . n A 1 408 CYS 408 408 408 CYS CYS A . n A 1 409 ARG 409 409 409 ARG ARG A . n A 1 410 THR 410 410 410 THR THR A . n A 1 411 LEU 411 411 411 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 501 1 HEM HEM A . C 3 HOH 1 601 6 HOH HOH A . C 3 HOH 2 602 2 HOH HOH A . C 3 HOH 3 603 1 HOH HOH A . C 3 HOH 4 604 17 HOH HOH A . C 3 HOH 5 605 5 HOH HOH A . C 3 HOH 6 606 21 HOH HOH A . C 3 HOH 7 607 24 HOH HOH A . C 3 HOH 8 608 18 HOH HOH A . C 3 HOH 9 609 23 HOH HOH A . C 3 HOH 10 610 13 HOH HOH A . C 3 HOH 11 611 12 HOH HOH A . C 3 HOH 12 612 11 HOH HOH A . C 3 HOH 13 613 16 HOH HOH A . C 3 HOH 14 614 3 HOH HOH A . C 3 HOH 15 615 8 HOH HOH A . C 3 HOH 16 616 22 HOH HOH A . C 3 HOH 17 617 15 HOH HOH A . C 3 HOH 18 618 7 HOH HOH A . C 3 HOH 19 619 4 HOH HOH A . C 3 HOH 20 620 10 HOH HOH A . C 3 HOH 21 621 19 HOH HOH A . C 3 HOH 22 622 9 HOH HOH A . C 3 HOH 23 623 20 HOH HOH A . C 3 HOH 24 624 14 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1220 ? 1 MORE -24 ? 1 'SSA (A^2)' 17880 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 355 ? A CYS 355 ? 1_555 FE ? B HEM . ? A HEM 501 ? 1_555 NA ? B HEM . ? A HEM 501 ? 1_555 98.9 ? 2 SG ? A CYS 355 ? A CYS 355 ? 1_555 FE ? B HEM . ? A HEM 501 ? 1_555 NB ? B HEM . ? A HEM 501 ? 1_555 84.2 ? 3 NA ? B HEM . ? A HEM 501 ? 1_555 FE ? B HEM . ? A HEM 501 ? 1_555 NB ? B HEM . ? A HEM 501 ? 1_555 89.3 ? 4 SG ? A CYS 355 ? A CYS 355 ? 1_555 FE ? B HEM . ? A HEM 501 ? 1_555 NC ? B HEM . ? A HEM 501 ? 1_555 83.0 ? 5 NA ? B HEM . ? A HEM 501 ? 1_555 FE ? B HEM . ? A HEM 501 ? 1_555 NC ? B HEM . ? A HEM 501 ? 1_555 176.8 ? 6 NB ? B HEM . ? A HEM 501 ? 1_555 FE ? B HEM . ? A HEM 501 ? 1_555 NC ? B HEM . ? A HEM 501 ? 1_555 88.3 ? 7 SG ? A CYS 355 ? A CYS 355 ? 1_555 FE ? B HEM . ? A HEM 501 ? 1_555 ND ? B HEM . ? A HEM 501 ? 1_555 97.4 ? 8 NA ? B HEM . ? A HEM 501 ? 1_555 FE ? B HEM . ? A HEM 501 ? 1_555 ND ? B HEM . ? A HEM 501 ? 1_555 90.8 ? 9 NB ? B HEM . ? A HEM 501 ? 1_555 FE ? B HEM . ? A HEM 501 ? 1_555 ND ? B HEM . ? A HEM 501 ? 1_555 178.3 ? 10 NC ? B HEM . ? A HEM 501 ? 1_555 FE ? B HEM . ? A HEM 501 ? 1_555 ND ? B HEM . ? A HEM 501 ? 1_555 91.5 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2018-04-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 10 ? ? 162.72 -50.56 2 1 THR A 11 ? ? -65.84 -70.54 3 1 ARG A 12 ? ? 54.46 82.52 4 1 SER A 21 ? ? -119.14 74.09 5 1 PRO A 22 ? ? -87.50 40.69 6 1 ASP A 33 ? ? -159.17 56.65 7 1 ASP A 84 ? ? 116.33 -56.94 8 1 GLU A 90 ? ? -100.81 41.42 9 1 LEU A 142 ? ? -147.35 -54.83 10 1 PRO A 175 ? ? -55.64 89.82 11 1 PHE A 176 ? ? 42.03 -170.29 12 1 ASP A 177 ? ? -94.12 -152.08 13 1 GLN A 181 ? ? -130.52 -127.30 14 1 ASP A 263 ? ? -160.90 108.09 15 1 LEU A 291 ? ? 12.12 96.03 16 1 ASP A 303 ? ? -83.79 -88.05 17 1 LEU A 304 ? ? 61.37 -49.62 18 1 PHE A 354 ? ? -34.60 123.77 19 1 THR A 410 ? ? 54.43 -145.26 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ASN _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 290 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LEU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 291 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -135.70 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A ILE 5 ? A ILE 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A ARG 68 ? A ARG 68 8 1 Y 1 A THR 69 ? A THR 69 9 1 Y 1 A THR 70 ? A THR 70 10 1 Y 1 A ILE 71 ? A ILE 71 11 1 Y 1 A SER 72 ? A SER 72 12 1 Y 1 A VAL 73 ? A VAL 73 13 1 Y 1 A GLY 74 ? A GLY 74 14 1 Y 1 A THR 75 ? A THR 75 15 1 Y 1 A ASP 76 ? A ASP 76 16 1 Y 1 A SER 77 ? A SER 77 17 1 Y 1 A GLU 78 ? A GLU 78 18 1 Y 1 A GLU 79 ? A GLU 79 19 1 Y 1 A GLY 80 ? A GLY 80 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #