data_5Y0Y # _entry.id 5Y0Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5Y0Y pdb_00005y0y 10.2210/pdb5y0y/pdb WWPDB D_1300004483 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-13 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 1 2 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5Y0Y _pdbx_database_status.recvd_initial_deposition_date 2017-07-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wu, Y.' 1 ? 'Gao, F.' 2 ? 'Qi, J.X.' 3 ? 'Chai, Y.' 4 ? 'Gao, G.F.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 114 _citation.language ? _citation.page_first E7564 _citation.page_last E7573 _citation.title 'Structures of phlebovirus glycoprotein Gn and identification of a neutralizing antibody epitope' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1705176114 _citation.pdbx_database_id_PubMed 28827346 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, Y.' 1 ? primary 'Zhu, Y.H.' 2 ? primary 'Gao, F.' 3 ? primary 'Jiao, Y.J.' 4 ? primary 'Oladejo, B.O.' 5 ? primary 'Chai, Y.' 6 ? primary 'Bi, Y.H.' 7 ? primary 'Lu, S.' 8 ? primary 'Dong, M.Q.' 9 ? primary 'Zhang, C.' 10 ? primary 'Huang, G.M.' 11 ? primary 'Wong, G.' 12 ? primary 'Li, N.' 13 ? primary 'Zhang, Y.F.' 14 ? primary 'Li, Y.' 15 ? primary 'Feng, W.H.' 16 ? primary 'Shi, Y.' 17 ? primary 'Liang, M.F.' 18 ? primary 'Zhang, R.G.' 19 ? primary 'Qi, J.X.' 20 ? primary 'Gao, G.F.' 21 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man NSmGnGc 35769.699 1 ? ? 'UNP residues 154-469' ? 2 non-polymer syn 'GOLD ION' 196.967 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'glycoprotein N' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EDPHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLQS AHGNPCMKEKLVMKTHCPNDYQSAHYLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSK LKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTIDSGQTKRE LKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSHHHH HH ; _entity_poly.pdbx_seq_one_letter_code_can ;EDPHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLQS AHGNPCMKEKLVMKTHCPNDYQSAHYLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSK LKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTIDSGQTKRE LKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSHHHH HH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'GOLD ION' _pdbx_entity_nonpoly.comp_id AU # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASP n 1 3 PRO n 1 4 HIS n 1 5 LEU n 1 6 ARG n 1 7 ASN n 1 8 ARG n 1 9 PRO n 1 10 GLY n 1 11 LYS n 1 12 GLY n 1 13 HIS n 1 14 ASN n 1 15 TYR n 1 16 ILE n 1 17 ASP n 1 18 GLY n 1 19 MET n 1 20 THR n 1 21 GLN n 1 22 GLU n 1 23 ASP n 1 24 ALA n 1 25 THR n 1 26 CYS n 1 27 LYS n 1 28 PRO n 1 29 VAL n 1 30 THR n 1 31 TYR n 1 32 ALA n 1 33 GLY n 1 34 ALA n 1 35 CYS n 1 36 SER n 1 37 SER n 1 38 PHE n 1 39 ASP n 1 40 VAL n 1 41 LEU n 1 42 LEU n 1 43 GLU n 1 44 LYS n 1 45 GLY n 1 46 LYS n 1 47 PHE n 1 48 PRO n 1 49 LEU n 1 50 PHE n 1 51 GLN n 1 52 SER n 1 53 TYR n 1 54 ALA n 1 55 HIS n 1 56 HIS n 1 57 ARG n 1 58 THR n 1 59 LEU n 1 60 LEU n 1 61 GLU n 1 62 ALA n 1 63 VAL n 1 64 HIS n 1 65 ASP n 1 66 THR n 1 67 ILE n 1 68 ILE n 1 69 ALA n 1 70 LYS n 1 71 ALA n 1 72 ASP n 1 73 PRO n 1 74 PRO n 1 75 SER n 1 76 CYS n 1 77 ASP n 1 78 LEU n 1 79 GLN n 1 80 SER n 1 81 ALA n 1 82 HIS n 1 83 GLY n 1 84 ASN n 1 85 PRO n 1 86 CYS n 1 87 MET n 1 88 LYS n 1 89 GLU n 1 90 LYS n 1 91 LEU n 1 92 VAL n 1 93 MET n 1 94 LYS n 1 95 THR n 1 96 HIS n 1 97 CYS n 1 98 PRO n 1 99 ASN n 1 100 ASP n 1 101 TYR n 1 102 GLN n 1 103 SER n 1 104 ALA n 1 105 HIS n 1 106 TYR n 1 107 LEU n 1 108 ASN n 1 109 ASN n 1 110 ASP n 1 111 GLY n 1 112 LYS n 1 113 MET n 1 114 ALA n 1 115 SER n 1 116 VAL n 1 117 LYS n 1 118 CYS n 1 119 PRO n 1 120 PRO n 1 121 LYS n 1 122 TYR n 1 123 GLU n 1 124 LEU n 1 125 THR n 1 126 GLU n 1 127 ASP n 1 128 CYS n 1 129 ASN n 1 130 PHE n 1 131 CYS n 1 132 ARG n 1 133 GLN n 1 134 MET n 1 135 THR n 1 136 GLY n 1 137 ALA n 1 138 SER n 1 139 LEU n 1 140 LYS n 1 141 LYS n 1 142 GLY n 1 143 SER n 1 144 TYR n 1 145 PRO n 1 146 LEU n 1 147 GLN n 1 148 ASP n 1 149 LEU n 1 150 PHE n 1 151 CYS n 1 152 GLN n 1 153 SER n 1 154 SER n 1 155 GLU n 1 156 ASP n 1 157 ASP n 1 158 GLY n 1 159 SER n 1 160 LYS n 1 161 LEU n 1 162 LYS n 1 163 THR n 1 164 LYS n 1 165 MET n 1 166 LYS n 1 167 GLY n 1 168 VAL n 1 169 CYS n 1 170 GLU n 1 171 VAL n 1 172 GLY n 1 173 VAL n 1 174 GLN n 1 175 ALA n 1 176 LEU n 1 177 LYS n 1 178 LYS n 1 179 CYS n 1 180 ASP n 1 181 GLY n 1 182 GLN n 1 183 LEU n 1 184 SER n 1 185 THR n 1 186 ALA n 1 187 HIS n 1 188 GLU n 1 189 VAL n 1 190 VAL n 1 191 PRO n 1 192 PHE n 1 193 ALA n 1 194 VAL n 1 195 PHE n 1 196 LYS n 1 197 ASN n 1 198 SER n 1 199 LYS n 1 200 LYS n 1 201 VAL n 1 202 TYR n 1 203 LEU n 1 204 ASP n 1 205 LYS n 1 206 LEU n 1 207 ASP n 1 208 LEU n 1 209 LYS n 1 210 THR n 1 211 GLU n 1 212 GLU n 1 213 ASN n 1 214 LEU n 1 215 LEU n 1 216 PRO n 1 217 ASP n 1 218 SER n 1 219 PHE n 1 220 VAL n 1 221 CYS n 1 222 PHE n 1 223 GLU n 1 224 HIS n 1 225 LYS n 1 226 GLY n 1 227 GLN n 1 228 TYR n 1 229 LYS n 1 230 GLY n 1 231 THR n 1 232 ILE n 1 233 ASP n 1 234 SER n 1 235 GLY n 1 236 GLN n 1 237 THR n 1 238 LYS n 1 239 ARG n 1 240 GLU n 1 241 LEU n 1 242 LYS n 1 243 SER n 1 244 PHE n 1 245 ASP n 1 246 ILE n 1 247 SER n 1 248 GLN n 1 249 CYS n 1 250 PRO n 1 251 LYS n 1 252 ILE n 1 253 GLY n 1 254 GLY n 1 255 HIS n 1 256 GLY n 1 257 SER n 1 258 LYS n 1 259 LYS n 1 260 CYS n 1 261 THR n 1 262 GLY n 1 263 ASP n 1 264 ALA n 1 265 ALA n 1 266 PHE n 1 267 CYS n 1 268 SER n 1 269 ALA n 1 270 TYR n 1 271 GLU n 1 272 CYS n 1 273 THR n 1 274 ALA n 1 275 GLN n 1 276 TYR n 1 277 ALA n 1 278 ASN n 1 279 ALA n 1 280 TYR n 1 281 CYS n 1 282 SER n 1 283 HIS n 1 284 ALA n 1 285 ASN n 1 286 GLY n 1 287 SER n 1 288 GLY n 1 289 ILE n 1 290 VAL n 1 291 GLN n 1 292 ILE n 1 293 GLN n 1 294 VAL n 1 295 SER n 1 296 GLY n 1 297 VAL n 1 298 TRP n 1 299 LYS n 1 300 LYS n 1 301 PRO n 1 302 LEU n 1 303 CYS n 1 304 VAL n 1 305 GLY n 1 306 TYR n 1 307 GLU n 1 308 ARG n 1 309 VAL n 1 310 VAL n 1 311 VAL n 1 312 LYS n 1 313 ARG n 1 314 GLU n 1 315 LEU n 1 316 SER n 1 317 HIS n 1 318 HIS n 1 319 HIS n 1 320 HIS n 1 321 HIS n 1 322 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 322 _entity_src_gen.gene_src_common_name RVFV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rift valley fever virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11588 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Baculovirus expression vector pFastBac1-HM' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 274590 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 AU non-polymer . 'GOLD ION' ? 'Au 1' 196.967 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 ? ? ? A . n A 1 80 SER 80 80 ? ? ? A . n A 1 81 ALA 81 81 ? ? ? A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLY 83 83 83 GLY ALA A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 CYS 118 118 118 CYS CYS A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 CYS 131 131 131 CYS CYS A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 THR 135 135 ? ? ? A . n A 1 136 GLY 136 136 ? ? ? A . n A 1 137 ALA 137 137 ? ? ? A . n A 1 138 SER 138 138 ? ? ? A . n A 1 139 LEU 139 139 ? ? ? A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 CYS 151 151 151 CYS CYS A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 MET 165 165 165 MET MET A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 CYS 169 169 169 CYS CYS A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 CYS 179 179 179 CYS CYS A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 GLN 182 182 182 GLN GLN A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 CYS 221 221 221 CYS CYS A . n A 1 222 PHE 222 222 222 PHE PHE A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 HIS 224 224 224 HIS HIS A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 GLY 226 226 ? ? ? A . n A 1 227 GLN 227 227 ? ? ? A . n A 1 228 TYR 228 228 ? ? ? A . n A 1 229 LYS 229 229 ? ? ? A . n A 1 230 GLY 230 230 ? ? ? A . n A 1 231 THR 231 231 ? ? ? A . n A 1 232 ILE 232 232 ? ? ? A . n A 1 233 ASP 233 233 ? ? ? A . n A 1 234 SER 234 234 ? ? ? A . n A 1 235 GLY 235 235 ? ? ? A . n A 1 236 GLN 236 236 ? ? ? A . n A 1 237 THR 237 237 ? ? ? A . n A 1 238 LYS 238 238 ? ? ? A . n A 1 239 ARG 239 239 ? ? ? A . n A 1 240 GLU 240 240 ? ? ? A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 PHE 244 244 244 PHE PHE A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 GLN 248 248 248 GLN GLN A . n A 1 249 CYS 249 249 249 CYS CYS A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 LYS 251 251 251 LYS LYS A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 GLY 254 254 254 GLY GLY A . n A 1 255 HIS 255 255 255 HIS HIS A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 SER 257 257 257 SER SER A . n A 1 258 LYS 258 258 258 LYS LYS A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 CYS 260 260 260 CYS CYS A . n A 1 261 THR 261 261 261 THR THR A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 ASP 263 263 263 ASP ASP A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 PHE 266 266 266 PHE PHE A . n A 1 267 CYS 267 267 267 CYS CYS A . n A 1 268 SER 268 268 268 SER SER A . n A 1 269 ALA 269 269 269 ALA ALA A . n A 1 270 TYR 270 270 270 TYR TYR A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 CYS 272 272 272 CYS CYS A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 ALA 274 274 274 ALA ALA A . n A 1 275 GLN 275 275 ? ? ? A . n A 1 276 TYR 276 276 ? ? ? A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 ASN 278 278 278 ASN ASN A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 TYR 280 280 280 TYR TYR A . n A 1 281 CYS 281 281 281 CYS CYS A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 HIS 283 283 283 HIS HIS A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 ASN 285 285 285 ASN ASN A . n A 1 286 GLY 286 286 286 GLY GLY A . n A 1 287 SER 287 287 287 SER SER A . n A 1 288 GLY 288 288 288 GLY GLY A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 VAL 290 290 290 VAL VAL A . n A 1 291 GLN 291 291 291 GLN GLN A . n A 1 292 ILE 292 292 292 ILE ILE A . n A 1 293 GLN 293 293 293 GLN GLN A . n A 1 294 VAL 294 294 294 VAL VAL A . n A 1 295 SER 295 295 295 SER SER A . n A 1 296 GLY 296 296 296 GLY GLY A . n A 1 297 VAL 297 297 297 VAL VAL A . n A 1 298 TRP 298 298 298 TRP TRP A . n A 1 299 LYS 299 299 299 LYS LYS A . n A 1 300 LYS 300 300 300 LYS LYS A . n A 1 301 PRO 301 301 301 PRO PRO A . n A 1 302 LEU 302 302 302 LEU LEU A . n A 1 303 CYS 303 303 303 CYS CYS A . n A 1 304 VAL 304 304 304 VAL VAL A . n A 1 305 GLY 305 305 305 GLY GLY A . n A 1 306 TYR 306 306 306 TYR TYR A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 ARG 308 308 308 ARG ARG A . n A 1 309 VAL 309 309 309 VAL VAL A . n A 1 310 VAL 310 310 310 VAL VAL A . n A 1 311 VAL 311 311 311 VAL VAL A . n A 1 312 LYS 312 312 312 LYS LYS A . n A 1 313 ARG 313 313 313 ARG ARG A . n A 1 314 GLU 314 314 314 GLU GLU A . n A 1 315 LEU 315 315 315 LEU LEU A . n A 1 316 SER 316 316 316 SER SER A . n A 1 317 HIS 317 317 ? ? ? A . n A 1 318 HIS 318 318 ? ? ? A . n A 1 319 HIS 319 319 ? ? ? A . n A 1 320 HIS 320 320 ? ? ? A . n A 1 321 HIS 321 321 ? ? ? A . n A 1 322 HIS 322 322 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AU 1 401 2 AU AU A . C 2 AU 1 402 5 AU AU A . D 2 AU 1 403 6 AU AU A . E 2 AU 1 404 7 AU AU A . F 2 AU 1 405 8 AU AU A . G 2 AU 1 406 9 AU AU A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.entry_id 5Y0Y _cell.length_a 97.180 _cell.length_b 97.180 _cell.length_c 184.128 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5Y0Y _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5Y0Y _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M ammonium sulfate, 0.1M MES, pH 6.5, 20% (w/v) PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03906 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03906 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5Y0Y _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.4 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7634 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.4 _reflns_shell.d_res_low 3.52 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 740 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.887 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 15.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5Y0Y _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 7585 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 42.972 _refine.ls_d_res_high 3.398 _refine.ls_percent_reflns_obs 99.67 _refine.ls_R_factor_obs 0.2776 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2754 _refine.ls_R_factor_R_free 0.3166 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.01 _refine.ls_number_reflns_R_free 380 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.51 _refine.pdbx_overall_phase_error 31.47 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2234 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2240 _refine_hist.d_res_high 3.398 _refine_hist.d_res_low 42.972 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.003 ? ? 2289 'X-RAY DIFFRACTION' ? f_angle_d 0.653 ? ? 3083 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 18.556 ? ? 880 'X-RAY DIFFRACTION' ? f_chiral_restr 0.042 ? ? 332 'X-RAY DIFFRACTION' ? f_plane_restr 0.006 ? ? 394 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 3.3982 3.8896 2324 0.2724 99.00 0.3165 . . 120 . . . . 'X-RAY DIFFRACTION' . 3.8896 4.8994 2363 0.2425 100.00 0.2834 . . 117 . . . . 'X-RAY DIFFRACTION' . 4.8994 42.9755 2518 0.3032 100.00 0.3387 . . 143 . . . . # _struct.entry_id 5Y0Y _struct.title 'RVFV GN-AU' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5Y0Y _struct_keywords.text 'RVFV, GN, phlebovirus, bunyavirus, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code H9BSP3_RVFV _struct_ref.pdbx_db_accession H9BSP3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EDPHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLQS AHGNPCMKEKLVMKTHCPNDYQSAHYLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSK LKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTIDSGQTKRE LKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELS ; _struct_ref.pdbx_align_begin 154 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5Y0Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 316 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession H9BSP3 _struct_ref_seq.db_align_beg 154 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 469 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 316 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5Y0Y HIS A 317 ? UNP H9BSP3 ? ? 'expression tag' 317 1 1 5Y0Y HIS A 318 ? UNP H9BSP3 ? ? 'expression tag' 318 2 1 5Y0Y HIS A 319 ? UNP H9BSP3 ? ? 'expression tag' 319 3 1 5Y0Y HIS A 320 ? UNP H9BSP3 ? ? 'expression tag' 320 4 1 5Y0Y HIS A 321 ? UNP H9BSP3 ? ? 'expression tag' 321 5 1 5Y0Y HIS A 322 ? UNP H9BSP3 ? ? 'expression tag' 322 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 14440 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 38 ? LEU A 42 ? PHE A 38 LEU A 42 5 ? 5 HELX_P HELX_P2 AA2 PHE A 47 ? TYR A 53 ? PHE A 47 TYR A 53 1 ? 7 HELX_P HELX_P3 AA3 THR A 58 ? ASP A 65 ? THR A 58 ASP A 65 1 ? 8 HELX_P HELX_P4 AA4 CYS A 86 ? MET A 93 ? CYS A 86 MET A 93 1 ? 8 HELX_P HELX_P5 AA5 LEU A 215 ? ASP A 217 ? LEU A 215 ASP A 217 5 ? 3 HELX_P HELX_P6 AA6 ASP A 245 ? CYS A 249 ? ASP A 245 CYS A 249 5 ? 5 HELX_P HELX_P7 AA7 ALA A 265 ? TYR A 270 ? ALA A 265 TYR A 270 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 26 A CYS 35 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf2 disulf ? ? A CYS 76 SG ? ? ? 1_555 A CYS 86 SG ? ? A CYS 76 A CYS 86 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf3 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 128 SG ? ? A CYS 97 A CYS 128 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf4 disulf ? ? A CYS 118 SG ? ? ? 1_555 A CYS 131 SG ? ? A CYS 118 A CYS 131 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf5 disulf ? ? A CYS 151 SG ? ? ? 1_555 A CYS 303 SG ? ? A CYS 151 A CYS 303 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf6 disulf ? ? A CYS 169 SG ? ? ? 1_555 A CYS 179 SG ? ? A CYS 169 A CYS 179 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf7 disulf ? ? A CYS 221 SG ? ? ? 1_555 A CYS 281 SG ? ? A CYS 221 A CYS 281 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf8 disulf ? ? A CYS 249 SG ? ? ? 1_555 A CYS 260 SG ? ? A CYS 249 A CYS 260 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf9 disulf ? ? A CYS 267 SG ? ? ? 1_555 A CYS 272 SG ? ? A CYS 267 A CYS 272 1_555 ? ? ? ? ? ? ? 2.035 ? ? metalc1 metalc ? ? A HIS 13 ND1 ? ? ? 1_555 G AU . AU ? ? A HIS 13 A AU 406 1_555 ? ? ? ? ? ? ? 2.209 ? ? metalc2 metalc ? ? A MET 19 SD ? ? ? 1_555 E AU . AU ? ? A MET 19 A AU 404 1_555 ? ? ? ? ? ? ? 2.501 ? ? metalc3 metalc ? ? A HIS 56 ND1 ? ? ? 1_555 C AU . AU ? ? A HIS 56 A AU 402 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc4 metalc ? ? A HIS 82 ND1 ? ? ? 1_555 B AU . AU ? ? A HIS 82 A AU 401 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc5 metalc ? ? A HIS 283 ND1 ? ? ? 1_555 B AU . AU ? ? A HIS 283 A AU 401 8_567 ? ? ? ? ? ? ? 2.627 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id ND1 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id HIS _pdbx_struct_conn_angle.ptnr1_label_seq_id 82 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id HIS _pdbx_struct_conn_angle.ptnr1_auth_seq_id 82 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id AU _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id AU _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id AU _pdbx_struct_conn_angle.ptnr2_auth_seq_id 401 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id ND1 _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id HIS _pdbx_struct_conn_angle.ptnr3_label_seq_id 283 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HIS _pdbx_struct_conn_angle.ptnr3_auth_seq_id 283 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 33.6 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 26 ? CYS A 35 ? CYS A 26 ? 1_555 CYS A 35 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 76 ? CYS A 86 ? CYS A 76 ? 1_555 CYS A 86 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 97 ? CYS A 128 ? CYS A 97 ? 1_555 CYS A 128 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 118 ? CYS A 131 ? CYS A 118 ? 1_555 CYS A 131 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 151 ? CYS A 303 ? CYS A 151 ? 1_555 CYS A 303 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 169 ? CYS A 179 ? CYS A 169 ? 1_555 CYS A 179 ? 1_555 SG SG . . . None 'Disulfide bridge' 7 CYS A 221 ? CYS A 281 ? CYS A 221 ? 1_555 CYS A 281 ? 1_555 SG SG . . . None 'Disulfide bridge' 8 CYS A 249 ? CYS A 260 ? CYS A 249 ? 1_555 CYS A 260 ? 1_555 SG SG . . . None 'Disulfide bridge' 9 CYS A 267 ? CYS A 272 ? CYS A 267 ? 1_555 CYS A 272 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 27 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 27 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 28 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 28 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -12.48 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 3 ? AA6 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 105 ? LEU A 107 ? HIS A 105 LEU A 107 AA1 2 MET A 113 ? SER A 115 ? MET A 113 SER A 115 AA2 1 GLU A 123 ? LEU A 124 ? GLU A 123 LEU A 124 AA2 2 CYS A 131 ? ARG A 132 ? CYS A 131 ARG A 132 AA3 1 ASP A 148 ? CYS A 151 ? ASP A 148 CYS A 151 AA3 2 CYS A 303 ? GLU A 314 ? CYS A 303 GLU A 314 AA3 3 VAL A 168 ? VAL A 171 ? VAL A 168 VAL A 171 AA3 4 GLN A 174 ? ALA A 175 ? GLN A 174 ALA A 175 AA4 1 ASP A 148 ? CYS A 151 ? ASP A 148 CYS A 151 AA4 2 CYS A 303 ? GLU A 314 ? CYS A 303 GLU A 314 AA4 3 LEU A 183 ? VAL A 194 ? LEU A 183 VAL A 194 AA4 4 LYS A 200 ? TYR A 202 ? LYS A 200 TYR A 202 AA5 1 LEU A 208 ? GLU A 212 ? LEU A 208 GLU A 212 AA5 2 GLY A 288 ? VAL A 294 ? GLY A 288 VAL A 294 AA5 3 VAL A 297 ? LYS A 299 ? VAL A 297 LYS A 299 AA6 1 PHE A 219 ? CYS A 221 ? PHE A 219 CYS A 221 AA6 2 ALA A 279 ? HIS A 283 ? ALA A 279 HIS A 283 AA6 3 CYS A 260 ? GLY A 262 ? CYS A 260 GLY A 262 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 106 ? N TYR A 106 O ALA A 114 ? O ALA A 114 AA2 1 2 N GLU A 123 ? N GLU A 123 O ARG A 132 ? O ARG A 132 AA3 1 2 N ASP A 148 ? N ASP A 148 O TYR A 306 ? O TYR A 306 AA3 2 3 O LYS A 312 ? O LYS A 312 N GLU A 170 ? N GLU A 170 AA3 3 4 N VAL A 171 ? N VAL A 171 O GLN A 174 ? O GLN A 174 AA4 1 2 N ASP A 148 ? N ASP A 148 O TYR A 306 ? O TYR A 306 AA4 2 3 O GLU A 307 ? O GLU A 307 N VAL A 190 ? N VAL A 190 AA4 3 4 N ALA A 193 ? N ALA A 193 O VAL A 201 ? O VAL A 201 AA5 1 2 N GLU A 211 ? N GLU A 211 O ILE A 289 ? O ILE A 289 AA5 2 3 N VAL A 294 ? N VAL A 294 O VAL A 297 ? O VAL A 297 AA6 1 2 N VAL A 220 ? N VAL A 220 O SER A 282 ? O SER A 282 AA6 2 3 O CYS A 281 ? O CYS A 281 N THR A 261 ? N THR A 261 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A AU 401 ? 2 'binding site for residue AU A 401' AC2 Software A AU 402 ? 3 'binding site for residue AU A 402' AC3 Software A AU 403 ? 2 'binding site for residue AU A 403' AC4 Software A AU 404 ? 3 'binding site for residue AU A 404' AC5 Software A AU 405 ? 2 'binding site for residue AU A 405' AC6 Software A AU 406 ? 3 'binding site for residue AU A 406' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 HIS A 82 ? HIS A 82 . ? 1_555 ? 2 AC1 2 HIS A 283 ? HIS A 283 . ? 8_667 ? 3 AC2 3 HIS A 55 ? HIS A 55 . ? 1_555 ? 4 AC2 3 HIS A 56 ? HIS A 56 . ? 1_555 ? 5 AC2 3 GLY A 286 ? GLY A 286 . ? 1_555 ? 6 AC3 2 HIS A 13 ? HIS A 13 . ? 1_555 ? 7 AC3 2 PRO A 28 ? PRO A 28 . ? 1_555 ? 8 AC4 3 MET A 19 ? MET A 19 . ? 1_555 ? 9 AC4 3 GLN A 102 ? GLN A 102 . ? 1_555 ? 10 AC4 3 LYS A 117 ? LYS A 117 . ? 1_555 ? 11 AC5 2 HIS A 187 ? HIS A 187 . ? 1_555 ? 12 AC5 2 HIS A 187 ? HIS A 187 . ? 12_556 ? 13 AC6 3 HIS A 13 ? HIS A 13 . ? 1_555 ? 14 AC6 3 TYR A 15 ? TYR A 15 . ? 1_555 ? 15 AC6 3 HIS A 64 ? HIS A 64 . ? 1_555 ? # _pdbx_entry_details.entry_id 5Y0Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CG A PRO 28 ? ? AU A AU 403 ? ? 1.68 2 1 CG A HIS 82 ? ? AU A AU 401 ? ? 2.09 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 4 ? ? -91.85 48.89 2 1 VAL A 29 ? ? -42.87 -86.89 3 1 THR A 30 ? ? 66.26 -175.89 4 1 THR A 66 ? ? 57.39 13.93 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id AU _pdbx_struct_special_symmetry.auth_seq_id 405 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id AU _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 1 ? A GLU 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A GLN 79 ? A GLN 79 4 1 Y 1 A SER 80 ? A SER 80 5 1 Y 1 A ALA 81 ? A ALA 81 6 1 Y 1 A THR 135 ? A THR 135 7 1 Y 1 A GLY 136 ? A GLY 136 8 1 Y 1 A ALA 137 ? A ALA 137 9 1 Y 1 A SER 138 ? A SER 138 10 1 Y 1 A LEU 139 ? A LEU 139 11 1 Y 1 A GLY 226 ? A GLY 226 12 1 Y 1 A GLN 227 ? A GLN 227 13 1 Y 1 A TYR 228 ? A TYR 228 14 1 Y 1 A LYS 229 ? A LYS 229 15 1 Y 1 A GLY 230 ? A GLY 230 16 1 Y 1 A THR 231 ? A THR 231 17 1 Y 1 A ILE 232 ? A ILE 232 18 1 Y 1 A ASP 233 ? A ASP 233 19 1 Y 1 A SER 234 ? A SER 234 20 1 Y 1 A GLY 235 ? A GLY 235 21 1 Y 1 A GLN 236 ? A GLN 236 22 1 Y 1 A THR 237 ? A THR 237 23 1 Y 1 A LYS 238 ? A LYS 238 24 1 Y 1 A ARG 239 ? A ARG 239 25 1 Y 1 A GLU 240 ? A GLU 240 26 1 Y 1 A GLN 275 ? A GLN 275 27 1 Y 1 A TYR 276 ? A TYR 276 28 1 Y 1 A HIS 317 ? A HIS 317 29 1 Y 1 A HIS 318 ? A HIS 318 30 1 Y 1 A HIS 319 ? A HIS 319 31 1 Y 1 A HIS 320 ? A HIS 320 32 1 Y 1 A HIS 321 ? A HIS 321 33 1 Y 1 A HIS 322 ? A HIS 322 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 AU AU AU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _atom_sites.entry_id 5Y0Y _atom_sites.fract_transf_matrix[1][1] 0.010290 _atom_sites.fract_transf_matrix[1][2] 0.005941 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011882 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005431 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol AU C N O S # loop_