data_5Y0Y
# 
_entry.id   5Y0Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5Y0Y         pdb_00005y0y 10.2210/pdb5y0y/pdb 
WWPDB D_1300004483 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-09-13 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2024-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
4 3 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                  
2 3 'Structure model' chem_comp_atom            
3 3 'Structure model' chem_comp_bond            
4 3 'Structure model' database_2                
5 3 'Structure model' pdbx_entry_details        
6 3 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'            
2 2 'Structure model' '_citation.page_first'                
3 2 'Structure model' '_citation.page_last'                 
4 3 'Structure model' '_database_2.pdbx_DOI'                
5 3 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5Y0Y 
_pdbx_database_status.recvd_initial_deposition_date   2017-07-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wu, Y.'    1 ? 
'Gao, F.'   2 ? 
'Qi, J.X.'  3 ? 
'Chai, Y.'  4 ? 
'Gao, G.F.' 5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                E7564 
_citation.page_last                 E7573 
_citation.title                     
'Structures of phlebovirus glycoprotein Gn and identification of a neutralizing antibody epitope' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1705176114 
_citation.pdbx_database_id_PubMed   28827346 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wu, Y.'        1  ? 
primary 'Zhu, Y.H.'     2  ? 
primary 'Gao, F.'       3  ? 
primary 'Jiao, Y.J.'    4  ? 
primary 'Oladejo, B.O.' 5  ? 
primary 'Chai, Y.'      6  ? 
primary 'Bi, Y.H.'      7  ? 
primary 'Lu, S.'        8  ? 
primary 'Dong, M.Q.'    9  ? 
primary 'Zhang, C.'     10 ? 
primary 'Huang, G.M.'   11 ? 
primary 'Wong, G.'      12 ? 
primary 'Li, N.'        13 ? 
primary 'Zhang, Y.F.'   14 ? 
primary 'Li, Y.'        15 ? 
primary 'Feng, W.H.'    16 ? 
primary 'Shi, Y.'       17 ? 
primary 'Liang, M.F.'   18 ? 
primary 'Zhang, R.G.'   19 ? 
primary 'Qi, J.X.'      20 ? 
primary 'Gao, G.F.'     21 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man NSmGnGc    35769.699 1 ? ? 'UNP residues 154-469' ? 
2 non-polymer syn 'GOLD ION' 196.967   6 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'glycoprotein N' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EDPHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLQS
AHGNPCMKEKLVMKTHCPNDYQSAHYLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSK
LKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTIDSGQTKRE
LKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSHHHH
HH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EDPHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLQS
AHGNPCMKEKLVMKTHCPNDYQSAHYLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSK
LKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTIDSGQTKRE
LKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSHHHH
HH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'GOLD ION' 
_pdbx_entity_nonpoly.comp_id     AU 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASP n 
1 3   PRO n 
1 4   HIS n 
1 5   LEU n 
1 6   ARG n 
1 7   ASN n 
1 8   ARG n 
1 9   PRO n 
1 10  GLY n 
1 11  LYS n 
1 12  GLY n 
1 13  HIS n 
1 14  ASN n 
1 15  TYR n 
1 16  ILE n 
1 17  ASP n 
1 18  GLY n 
1 19  MET n 
1 20  THR n 
1 21  GLN n 
1 22  GLU n 
1 23  ASP n 
1 24  ALA n 
1 25  THR n 
1 26  CYS n 
1 27  LYS n 
1 28  PRO n 
1 29  VAL n 
1 30  THR n 
1 31  TYR n 
1 32  ALA n 
1 33  GLY n 
1 34  ALA n 
1 35  CYS n 
1 36  SER n 
1 37  SER n 
1 38  PHE n 
1 39  ASP n 
1 40  VAL n 
1 41  LEU n 
1 42  LEU n 
1 43  GLU n 
1 44  LYS n 
1 45  GLY n 
1 46  LYS n 
1 47  PHE n 
1 48  PRO n 
1 49  LEU n 
1 50  PHE n 
1 51  GLN n 
1 52  SER n 
1 53  TYR n 
1 54  ALA n 
1 55  HIS n 
1 56  HIS n 
1 57  ARG n 
1 58  THR n 
1 59  LEU n 
1 60  LEU n 
1 61  GLU n 
1 62  ALA n 
1 63  VAL n 
1 64  HIS n 
1 65  ASP n 
1 66  THR n 
1 67  ILE n 
1 68  ILE n 
1 69  ALA n 
1 70  LYS n 
1 71  ALA n 
1 72  ASP n 
1 73  PRO n 
1 74  PRO n 
1 75  SER n 
1 76  CYS n 
1 77  ASP n 
1 78  LEU n 
1 79  GLN n 
1 80  SER n 
1 81  ALA n 
1 82  HIS n 
1 83  GLY n 
1 84  ASN n 
1 85  PRO n 
1 86  CYS n 
1 87  MET n 
1 88  LYS n 
1 89  GLU n 
1 90  LYS n 
1 91  LEU n 
1 92  VAL n 
1 93  MET n 
1 94  LYS n 
1 95  THR n 
1 96  HIS n 
1 97  CYS n 
1 98  PRO n 
1 99  ASN n 
1 100 ASP n 
1 101 TYR n 
1 102 GLN n 
1 103 SER n 
1 104 ALA n 
1 105 HIS n 
1 106 TYR n 
1 107 LEU n 
1 108 ASN n 
1 109 ASN n 
1 110 ASP n 
1 111 GLY n 
1 112 LYS n 
1 113 MET n 
1 114 ALA n 
1 115 SER n 
1 116 VAL n 
1 117 LYS n 
1 118 CYS n 
1 119 PRO n 
1 120 PRO n 
1 121 LYS n 
1 122 TYR n 
1 123 GLU n 
1 124 LEU n 
1 125 THR n 
1 126 GLU n 
1 127 ASP n 
1 128 CYS n 
1 129 ASN n 
1 130 PHE n 
1 131 CYS n 
1 132 ARG n 
1 133 GLN n 
1 134 MET n 
1 135 THR n 
1 136 GLY n 
1 137 ALA n 
1 138 SER n 
1 139 LEU n 
1 140 LYS n 
1 141 LYS n 
1 142 GLY n 
1 143 SER n 
1 144 TYR n 
1 145 PRO n 
1 146 LEU n 
1 147 GLN n 
1 148 ASP n 
1 149 LEU n 
1 150 PHE n 
1 151 CYS n 
1 152 GLN n 
1 153 SER n 
1 154 SER n 
1 155 GLU n 
1 156 ASP n 
1 157 ASP n 
1 158 GLY n 
1 159 SER n 
1 160 LYS n 
1 161 LEU n 
1 162 LYS n 
1 163 THR n 
1 164 LYS n 
1 165 MET n 
1 166 LYS n 
1 167 GLY n 
1 168 VAL n 
1 169 CYS n 
1 170 GLU n 
1 171 VAL n 
1 172 GLY n 
1 173 VAL n 
1 174 GLN n 
1 175 ALA n 
1 176 LEU n 
1 177 LYS n 
1 178 LYS n 
1 179 CYS n 
1 180 ASP n 
1 181 GLY n 
1 182 GLN n 
1 183 LEU n 
1 184 SER n 
1 185 THR n 
1 186 ALA n 
1 187 HIS n 
1 188 GLU n 
1 189 VAL n 
1 190 VAL n 
1 191 PRO n 
1 192 PHE n 
1 193 ALA n 
1 194 VAL n 
1 195 PHE n 
1 196 LYS n 
1 197 ASN n 
1 198 SER n 
1 199 LYS n 
1 200 LYS n 
1 201 VAL n 
1 202 TYR n 
1 203 LEU n 
1 204 ASP n 
1 205 LYS n 
1 206 LEU n 
1 207 ASP n 
1 208 LEU n 
1 209 LYS n 
1 210 THR n 
1 211 GLU n 
1 212 GLU n 
1 213 ASN n 
1 214 LEU n 
1 215 LEU n 
1 216 PRO n 
1 217 ASP n 
1 218 SER n 
1 219 PHE n 
1 220 VAL n 
1 221 CYS n 
1 222 PHE n 
1 223 GLU n 
1 224 HIS n 
1 225 LYS n 
1 226 GLY n 
1 227 GLN n 
1 228 TYR n 
1 229 LYS n 
1 230 GLY n 
1 231 THR n 
1 232 ILE n 
1 233 ASP n 
1 234 SER n 
1 235 GLY n 
1 236 GLN n 
1 237 THR n 
1 238 LYS n 
1 239 ARG n 
1 240 GLU n 
1 241 LEU n 
1 242 LYS n 
1 243 SER n 
1 244 PHE n 
1 245 ASP n 
1 246 ILE n 
1 247 SER n 
1 248 GLN n 
1 249 CYS n 
1 250 PRO n 
1 251 LYS n 
1 252 ILE n 
1 253 GLY n 
1 254 GLY n 
1 255 HIS n 
1 256 GLY n 
1 257 SER n 
1 258 LYS n 
1 259 LYS n 
1 260 CYS n 
1 261 THR n 
1 262 GLY n 
1 263 ASP n 
1 264 ALA n 
1 265 ALA n 
1 266 PHE n 
1 267 CYS n 
1 268 SER n 
1 269 ALA n 
1 270 TYR n 
1 271 GLU n 
1 272 CYS n 
1 273 THR n 
1 274 ALA n 
1 275 GLN n 
1 276 TYR n 
1 277 ALA n 
1 278 ASN n 
1 279 ALA n 
1 280 TYR n 
1 281 CYS n 
1 282 SER n 
1 283 HIS n 
1 284 ALA n 
1 285 ASN n 
1 286 GLY n 
1 287 SER n 
1 288 GLY n 
1 289 ILE n 
1 290 VAL n 
1 291 GLN n 
1 292 ILE n 
1 293 GLN n 
1 294 VAL n 
1 295 SER n 
1 296 GLY n 
1 297 VAL n 
1 298 TRP n 
1 299 LYS n 
1 300 LYS n 
1 301 PRO n 
1 302 LEU n 
1 303 CYS n 
1 304 VAL n 
1 305 GLY n 
1 306 TYR n 
1 307 GLU n 
1 308 ARG n 
1 309 VAL n 
1 310 VAL n 
1 311 VAL n 
1 312 LYS n 
1 313 ARG n 
1 314 GLU n 
1 315 LEU n 
1 316 SER n 
1 317 HIS n 
1 318 HIS n 
1 319 HIS n 
1 320 HIS n 
1 321 HIS n 
1 322 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   322 
_entity_src_gen.gene_src_common_name               RVFV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rift valley fever virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11588 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Baculovirus expression vector pFastBac1-HM' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     274590 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
AU  non-polymer         . 'GOLD ION'      ? 'Au 1'           196.967 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   3   PRO PRO A . n 
A 1 4   HIS 4   4   4   HIS HIS A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  HIS 13  13  13  HIS HIS A . n 
A 1 14  ASN 14  14  14  ASN ASN A . n 
A 1 15  TYR 15  15  15  TYR TYR A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  MET 19  19  19  MET MET A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  TYR 31  31  31  TYR TYR A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  CYS 35  35  35  CYS CYS A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  HIS 55  55  55  HIS HIS A . n 
A 1 56  HIS 56  56  56  HIS HIS A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  CYS 76  76  76  CYS CYS A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  GLN 79  79  ?   ?   ?   A . n 
A 1 80  SER 80  80  ?   ?   ?   A . n 
A 1 81  ALA 81  81  ?   ?   ?   A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  GLY 83  83  83  GLY ALA A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  CYS 86  86  86  CYS CYS A . n 
A 1 87  MET 87  87  87  MET MET A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  MET 93  93  93  MET MET A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  CYS 97  97  97  CYS CYS A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 GLN 102 102 102 GLN GLN A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 TYR 106 106 106 TYR TYR A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 ASN 109 109 109 ASN ASN A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 MET 113 113 113 MET MET A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 LYS 117 117 117 LYS LYS A . n 
A 1 118 CYS 118 118 118 CYS CYS A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 CYS 128 128 128 CYS CYS A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 CYS 131 131 131 CYS CYS A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 GLN 133 133 133 GLN GLN A . n 
A 1 134 MET 134 134 134 MET MET A . n 
A 1 135 THR 135 135 ?   ?   ?   A . n 
A 1 136 GLY 136 136 ?   ?   ?   A . n 
A 1 137 ALA 137 137 ?   ?   ?   A . n 
A 1 138 SER 138 138 ?   ?   ?   A . n 
A 1 139 LEU 139 139 ?   ?   ?   A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 CYS 151 151 151 CYS CYS A . n 
A 1 152 GLN 152 152 152 GLN GLN A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 THR 163 163 163 THR THR A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 MET 165 165 165 MET MET A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 CYS 169 169 169 CYS CYS A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 LYS 178 178 178 LYS LYS A . n 
A 1 179 CYS 179 179 179 CYS CYS A . n 
A 1 180 ASP 180 180 180 ASP ASP A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 HIS 187 187 187 HIS HIS A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 ASN 197 197 197 ASN ASN A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 TYR 202 202 202 TYR TYR A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 ASP 207 207 207 ASP ASP A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 ASN 213 213 213 ASN ASN A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 PRO 216 216 216 PRO PRO A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 CYS 221 221 221 CYS CYS A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 HIS 224 224 224 HIS HIS A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 GLY 226 226 ?   ?   ?   A . n 
A 1 227 GLN 227 227 ?   ?   ?   A . n 
A 1 228 TYR 228 228 ?   ?   ?   A . n 
A 1 229 LYS 229 229 ?   ?   ?   A . n 
A 1 230 GLY 230 230 ?   ?   ?   A . n 
A 1 231 THR 231 231 ?   ?   ?   A . n 
A 1 232 ILE 232 232 ?   ?   ?   A . n 
A 1 233 ASP 233 233 ?   ?   ?   A . n 
A 1 234 SER 234 234 ?   ?   ?   A . n 
A 1 235 GLY 235 235 ?   ?   ?   A . n 
A 1 236 GLN 236 236 ?   ?   ?   A . n 
A 1 237 THR 237 237 ?   ?   ?   A . n 
A 1 238 LYS 238 238 ?   ?   ?   A . n 
A 1 239 ARG 239 239 ?   ?   ?   A . n 
A 1 240 GLU 240 240 ?   ?   ?   A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 LYS 242 242 242 LYS LYS A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 PHE 244 244 244 PHE PHE A . n 
A 1 245 ASP 245 245 245 ASP ASP A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 CYS 249 249 249 CYS CYS A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 LYS 251 251 251 LYS LYS A . n 
A 1 252 ILE 252 252 252 ILE ILE A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 GLY 254 254 254 GLY GLY A . n 
A 1 255 HIS 255 255 255 HIS HIS A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 LYS 259 259 259 LYS LYS A . n 
A 1 260 CYS 260 260 260 CYS CYS A . n 
A 1 261 THR 261 261 261 THR THR A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 ALA 264 264 264 ALA ALA A . n 
A 1 265 ALA 265 265 265 ALA ALA A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 CYS 267 267 267 CYS CYS A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 TYR 270 270 270 TYR TYR A . n 
A 1 271 GLU 271 271 271 GLU GLU A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 THR 273 273 273 THR THR A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 GLN 275 275 ?   ?   ?   A . n 
A 1 276 TYR 276 276 ?   ?   ?   A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 TYR 280 280 280 TYR TYR A . n 
A 1 281 CYS 281 281 281 CYS CYS A . n 
A 1 282 SER 282 282 282 SER SER A . n 
A 1 283 HIS 283 283 283 HIS HIS A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 ASN 285 285 285 ASN ASN A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 SER 287 287 287 SER SER A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 VAL 290 290 290 VAL VAL A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 ILE 292 292 292 ILE ILE A . n 
A 1 293 GLN 293 293 293 GLN GLN A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 SER 295 295 295 SER SER A . n 
A 1 296 GLY 296 296 296 GLY GLY A . n 
A 1 297 VAL 297 297 297 VAL VAL A . n 
A 1 298 TRP 298 298 298 TRP TRP A . n 
A 1 299 LYS 299 299 299 LYS LYS A . n 
A 1 300 LYS 300 300 300 LYS LYS A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 CYS 303 303 303 CYS CYS A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 TYR 306 306 306 TYR TYR A . n 
A 1 307 GLU 307 307 307 GLU GLU A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 VAL 309 309 309 VAL VAL A . n 
A 1 310 VAL 310 310 310 VAL VAL A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 LYS 312 312 312 LYS LYS A . n 
A 1 313 ARG 313 313 313 ARG ARG A . n 
A 1 314 GLU 314 314 314 GLU GLU A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 SER 316 316 316 SER SER A . n 
A 1 317 HIS 317 317 ?   ?   ?   A . n 
A 1 318 HIS 318 318 ?   ?   ?   A . n 
A 1 319 HIS 319 319 ?   ?   ?   A . n 
A 1 320 HIS 320 320 ?   ?   ?   A . n 
A 1 321 HIS 321 321 ?   ?   ?   A . n 
A 1 322 HIS 322 322 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 AU 1 401 2 AU AU A . 
C 2 AU 1 402 5 AU AU A . 
D 2 AU 1 403 6 AU AU A . 
E 2 AU 1 404 7 AU AU A . 
F 2 AU 1 405 8 AU AU A . 
G 2 AU 1 406 9 AU AU A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.11.1_2575: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .                    4 
# 
_cell.entry_id           5Y0Y 
_cell.length_a           97.180 
_cell.length_b           97.180 
_cell.length_c           184.128 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5Y0Y 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5Y0Y 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.51 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.94 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2M ammonium sulfate, 0.1M MES, pH 6.5, 20% (w/v) PEG 8000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-12-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03906 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.03906 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5Y0Y 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.4 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       7634 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  14.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            23.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.4 
_reflns_shell.d_res_low                   3.52 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           740 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.887 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             15.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5Y0Y 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     7585 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.972 
_refine.ls_d_res_high                            3.398 
_refine.ls_percent_reflns_obs                    99.67 
_refine.ls_R_factor_obs                          0.2776 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2754 
_refine.ls_R_factor_R_free                       0.3166 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_number_reflns_R_free                  380 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.51 
_refine.pdbx_overall_phase_error                 31.47 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2234 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2240 
_refine_hist.d_res_high                       3.398 
_refine_hist.d_res_low                        42.972 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 2289 'X-RAY DIFFRACTION' ? 
f_angle_d          0.653  ? ? 3083 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.556 ? ? 880  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.042  ? ? 332  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 394  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.3982 3.8896  2324 0.2724 99.00  0.3165 . . 120 . . . . 
'X-RAY DIFFRACTION' . 3.8896 4.8994  2363 0.2425 100.00 0.2834 . . 117 . . . . 
'X-RAY DIFFRACTION' . 4.8994 42.9755 2518 0.3032 100.00 0.3387 . . 143 . . . . 
# 
_struct.entry_id                     5Y0Y 
_struct.title                        'RVFV GN-AU' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5Y0Y 
_struct_keywords.text            'RVFV, GN, phlebovirus, bunyavirus, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    H9BSP3_RVFV 
_struct_ref.pdbx_db_accession          H9BSP3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EDPHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLQS
AHGNPCMKEKLVMKTHCPNDYQSAHYLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSK
LKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTIDSGQTKRE
LKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELS
;
_struct_ref.pdbx_align_begin           154 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5Y0Y 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 316 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             H9BSP3 
_struct_ref_seq.db_align_beg                  154 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  469 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       316 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5Y0Y HIS A 317 ? UNP H9BSP3 ? ? 'expression tag' 317 1 
1 5Y0Y HIS A 318 ? UNP H9BSP3 ? ? 'expression tag' 318 2 
1 5Y0Y HIS A 319 ? UNP H9BSP3 ? ? 'expression tag' 319 3 
1 5Y0Y HIS A 320 ? UNP H9BSP3 ? ? 'expression tag' 320 4 
1 5Y0Y HIS A 321 ? UNP H9BSP3 ? ? 'expression tag' 321 5 
1 5Y0Y HIS A 322 ? UNP H9BSP3 ? ? 'expression tag' 322 6 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0     ? 
1 MORE         0     ? 
1 'SSA (A^2)'  14440 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PHE A 38  ? LEU A 42  ? PHE A 38  LEU A 42  5 ? 5 
HELX_P HELX_P2 AA2 PHE A 47  ? TYR A 53  ? PHE A 47  TYR A 53  1 ? 7 
HELX_P HELX_P3 AA3 THR A 58  ? ASP A 65  ? THR A 58  ASP A 65  1 ? 8 
HELX_P HELX_P4 AA4 CYS A 86  ? MET A 93  ? CYS A 86  MET A 93  1 ? 8 
HELX_P HELX_P5 AA5 LEU A 215 ? ASP A 217 ? LEU A 215 ASP A 217 5 ? 3 
HELX_P HELX_P6 AA6 ASP A 245 ? CYS A 249 ? ASP A 245 CYS A 249 5 ? 5 
HELX_P HELX_P7 AA7 ALA A 265 ? TYR A 270 ? ALA A 265 TYR A 270 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 26  SG  ? ? ? 1_555 A CYS 35  SG ? ? A CYS 26  A CYS 35  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf2 disulf ? ? A CYS 76  SG  ? ? ? 1_555 A CYS 86  SG ? ? A CYS 76  A CYS 86  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf3 disulf ? ? A CYS 97  SG  ? ? ? 1_555 A CYS 128 SG ? ? A CYS 97  A CYS 128 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf4 disulf ? ? A CYS 118 SG  ? ? ? 1_555 A CYS 131 SG ? ? A CYS 118 A CYS 131 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf5 disulf ? ? A CYS 151 SG  ? ? ? 1_555 A CYS 303 SG ? ? A CYS 151 A CYS 303 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf6 disulf ? ? A CYS 169 SG  ? ? ? 1_555 A CYS 179 SG ? ? A CYS 169 A CYS 179 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf7 disulf ? ? A CYS 221 SG  ? ? ? 1_555 A CYS 281 SG ? ? A CYS 221 A CYS 281 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf8 disulf ? ? A CYS 249 SG  ? ? ? 1_555 A CYS 260 SG ? ? A CYS 249 A CYS 260 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf9 disulf ? ? A CYS 267 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 267 A CYS 272 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
metalc1 metalc ? ? A HIS 13  ND1 ? ? ? 1_555 G AU  .   AU ? ? A HIS 13  A AU  406 1_555 ? ? ? ? ? ? ? 2.209 ? ? 
metalc2 metalc ? ? A MET 19  SD  ? ? ? 1_555 E AU  .   AU ? ? A MET 19  A AU  404 1_555 ? ? ? ? ? ? ? 2.501 ? ? 
metalc3 metalc ? ? A HIS 56  ND1 ? ? ? 1_555 C AU  .   AU ? ? A HIS 56  A AU  402 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc4 metalc ? ? A HIS 82  ND1 ? ? ? 1_555 B AU  .   AU ? ? A HIS 82  A AU  401 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc5 metalc ? ? A HIS 283 ND1 ? ? ? 1_555 B AU  .   AU ? ? A HIS 283 A AU  401 8_567 ? ? ? ? ? ? ? 2.627 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   ND1 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   HIS 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    82 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    HIS 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     82 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   AU 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   AU 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    AU 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     401 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   ND1 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   HIS 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    283 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    HIS 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     283 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 33.6 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 26  ? CYS A 35  ? CYS A 26  ? 1_555 CYS A 35  ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 76  ? CYS A 86  ? CYS A 76  ? 1_555 CYS A 86  ? 1_555 SG SG . . . None 'Disulfide bridge' 
3 CYS A 97  ? CYS A 128 ? CYS A 97  ? 1_555 CYS A 128 ? 1_555 SG SG . . . None 'Disulfide bridge' 
4 CYS A 118 ? CYS A 131 ? CYS A 118 ? 1_555 CYS A 131 ? 1_555 SG SG . . . None 'Disulfide bridge' 
5 CYS A 151 ? CYS A 303 ? CYS A 151 ? 1_555 CYS A 303 ? 1_555 SG SG . . . None 'Disulfide bridge' 
6 CYS A 169 ? CYS A 179 ? CYS A 169 ? 1_555 CYS A 179 ? 1_555 SG SG . . . None 'Disulfide bridge' 
7 CYS A 221 ? CYS A 281 ? CYS A 221 ? 1_555 CYS A 281 ? 1_555 SG SG . . . None 'Disulfide bridge' 
8 CYS A 249 ? CYS A 260 ? CYS A 249 ? 1_555 CYS A 260 ? 1_555 SG SG . . . None 'Disulfide bridge' 
9 CYS A 267 ? CYS A 272 ? CYS A 267 ? 1_555 CYS A 272 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           27 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            27 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    28 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     28 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -12.48 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 3 ? 
AA6 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 HIS A 105 ? LEU A 107 ? HIS A 105 LEU A 107 
AA1 2 MET A 113 ? SER A 115 ? MET A 113 SER A 115 
AA2 1 GLU A 123 ? LEU A 124 ? GLU A 123 LEU A 124 
AA2 2 CYS A 131 ? ARG A 132 ? CYS A 131 ARG A 132 
AA3 1 ASP A 148 ? CYS A 151 ? ASP A 148 CYS A 151 
AA3 2 CYS A 303 ? GLU A 314 ? CYS A 303 GLU A 314 
AA3 3 VAL A 168 ? VAL A 171 ? VAL A 168 VAL A 171 
AA3 4 GLN A 174 ? ALA A 175 ? GLN A 174 ALA A 175 
AA4 1 ASP A 148 ? CYS A 151 ? ASP A 148 CYS A 151 
AA4 2 CYS A 303 ? GLU A 314 ? CYS A 303 GLU A 314 
AA4 3 LEU A 183 ? VAL A 194 ? LEU A 183 VAL A 194 
AA4 4 LYS A 200 ? TYR A 202 ? LYS A 200 TYR A 202 
AA5 1 LEU A 208 ? GLU A 212 ? LEU A 208 GLU A 212 
AA5 2 GLY A 288 ? VAL A 294 ? GLY A 288 VAL A 294 
AA5 3 VAL A 297 ? LYS A 299 ? VAL A 297 LYS A 299 
AA6 1 PHE A 219 ? CYS A 221 ? PHE A 219 CYS A 221 
AA6 2 ALA A 279 ? HIS A 283 ? ALA A 279 HIS A 283 
AA6 3 CYS A 260 ? GLY A 262 ? CYS A 260 GLY A 262 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N TYR A 106 ? N TYR A 106 O ALA A 114 ? O ALA A 114 
AA2 1 2 N GLU A 123 ? N GLU A 123 O ARG A 132 ? O ARG A 132 
AA3 1 2 N ASP A 148 ? N ASP A 148 O TYR A 306 ? O TYR A 306 
AA3 2 3 O LYS A 312 ? O LYS A 312 N GLU A 170 ? N GLU A 170 
AA3 3 4 N VAL A 171 ? N VAL A 171 O GLN A 174 ? O GLN A 174 
AA4 1 2 N ASP A 148 ? N ASP A 148 O TYR A 306 ? O TYR A 306 
AA4 2 3 O GLU A 307 ? O GLU A 307 N VAL A 190 ? N VAL A 190 
AA4 3 4 N ALA A 193 ? N ALA A 193 O VAL A 201 ? O VAL A 201 
AA5 1 2 N GLU A 211 ? N GLU A 211 O ILE A 289 ? O ILE A 289 
AA5 2 3 N VAL A 294 ? N VAL A 294 O VAL A 297 ? O VAL A 297 
AA6 1 2 N VAL A 220 ? N VAL A 220 O SER A 282 ? O SER A 282 
AA6 2 3 O CYS A 281 ? O CYS A 281 N THR A 261 ? N THR A 261 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A AU 401 ? 2 'binding site for residue AU A 401' 
AC2 Software A AU 402 ? 3 'binding site for residue AU A 402' 
AC3 Software A AU 403 ? 2 'binding site for residue AU A 403' 
AC4 Software A AU 404 ? 3 'binding site for residue AU A 404' 
AC5 Software A AU 405 ? 2 'binding site for residue AU A 405' 
AC6 Software A AU 406 ? 3 'binding site for residue AU A 406' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 HIS A 82  ? HIS A 82  . ? 1_555  ? 
2  AC1 2 HIS A 283 ? HIS A 283 . ? 8_667  ? 
3  AC2 3 HIS A 55  ? HIS A 55  . ? 1_555  ? 
4  AC2 3 HIS A 56  ? HIS A 56  . ? 1_555  ? 
5  AC2 3 GLY A 286 ? GLY A 286 . ? 1_555  ? 
6  AC3 2 HIS A 13  ? HIS A 13  . ? 1_555  ? 
7  AC3 2 PRO A 28  ? PRO A 28  . ? 1_555  ? 
8  AC4 3 MET A 19  ? MET A 19  . ? 1_555  ? 
9  AC4 3 GLN A 102 ? GLN A 102 . ? 1_555  ? 
10 AC4 3 LYS A 117 ? LYS A 117 . ? 1_555  ? 
11 AC5 2 HIS A 187 ? HIS A 187 . ? 1_555  ? 
12 AC5 2 HIS A 187 ? HIS A 187 . ? 12_556 ? 
13 AC6 3 HIS A 13  ? HIS A 13  . ? 1_555  ? 
14 AC6 3 TYR A 15  ? TYR A 15  . ? 1_555  ? 
15 AC6 3 HIS A 64  ? HIS A 64  . ? 1_555  ? 
# 
_pdbx_entry_details.entry_id                   5Y0Y 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CG A PRO 28 ? ? AU A AU 403 ? ? 1.68 
2 1 CG A HIS 82 ? ? AU A AU 401 ? ? 2.09 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 4  ? ? -91.85 48.89   
2 1 VAL A 29 ? ? -42.87 -86.89  
3 1 THR A 30 ? ? 66.26  -175.89 
4 1 THR A 66 ? ? 57.39  13.93   
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    AU 
_pdbx_struct_special_symmetry.auth_seq_id     405 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   AU 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 1   ? A GLU 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A GLN 79  ? A GLN 79  
4  1 Y 1 A SER 80  ? A SER 80  
5  1 Y 1 A ALA 81  ? A ALA 81  
6  1 Y 1 A THR 135 ? A THR 135 
7  1 Y 1 A GLY 136 ? A GLY 136 
8  1 Y 1 A ALA 137 ? A ALA 137 
9  1 Y 1 A SER 138 ? A SER 138 
10 1 Y 1 A LEU 139 ? A LEU 139 
11 1 Y 1 A GLY 226 ? A GLY 226 
12 1 Y 1 A GLN 227 ? A GLN 227 
13 1 Y 1 A TYR 228 ? A TYR 228 
14 1 Y 1 A LYS 229 ? A LYS 229 
15 1 Y 1 A GLY 230 ? A GLY 230 
16 1 Y 1 A THR 231 ? A THR 231 
17 1 Y 1 A ILE 232 ? A ILE 232 
18 1 Y 1 A ASP 233 ? A ASP 233 
19 1 Y 1 A SER 234 ? A SER 234 
20 1 Y 1 A GLY 235 ? A GLY 235 
21 1 Y 1 A GLN 236 ? A GLN 236 
22 1 Y 1 A THR 237 ? A THR 237 
23 1 Y 1 A LYS 238 ? A LYS 238 
24 1 Y 1 A ARG 239 ? A ARG 239 
25 1 Y 1 A GLU 240 ? A GLU 240 
26 1 Y 1 A GLN 275 ? A GLN 275 
27 1 Y 1 A TYR 276 ? A TYR 276 
28 1 Y 1 A HIS 317 ? A HIS 317 
29 1 Y 1 A HIS 318 ? A HIS 318 
30 1 Y 1 A HIS 319 ? A HIS 319 
31 1 Y 1 A HIS 320 ? A HIS 320 
32 1 Y 1 A HIS 321 ? A HIS 321 
33 1 Y 1 A HIS 322 ? A HIS 322 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
AU  AU   AU N N 74  
CYS N    N  N N 75  
CYS CA   C  N R 76  
CYS C    C  N N 77  
CYS O    O  N N 78  
CYS CB   C  N N 79  
CYS SG   S  N N 80  
CYS OXT  O  N N 81  
CYS H    H  N N 82  
CYS H2   H  N N 83  
CYS HA   H  N N 84  
CYS HB2  H  N N 85  
CYS HB3  H  N N 86  
CYS HG   H  N N 87  
CYS HXT  H  N N 88  
GLN N    N  N N 89  
GLN CA   C  N S 90  
GLN C    C  N N 91  
GLN O    O  N N 92  
GLN CB   C  N N 93  
GLN CG   C  N N 94  
GLN CD   C  N N 95  
GLN OE1  O  N N 96  
GLN NE2  N  N N 97  
GLN OXT  O  N N 98  
GLN H    H  N N 99  
GLN H2   H  N N 100 
GLN HA   H  N N 101 
GLN HB2  H  N N 102 
GLN HB3  H  N N 103 
GLN HG2  H  N N 104 
GLN HG3  H  N N 105 
GLN HE21 H  N N 106 
GLN HE22 H  N N 107 
GLN HXT  H  N N 108 
GLU N    N  N N 109 
GLU CA   C  N S 110 
GLU C    C  N N 111 
GLU O    O  N N 112 
GLU CB   C  N N 113 
GLU CG   C  N N 114 
GLU CD   C  N N 115 
GLU OE1  O  N N 116 
GLU OE2  O  N N 117 
GLU OXT  O  N N 118 
GLU H    H  N N 119 
GLU H2   H  N N 120 
GLU HA   H  N N 121 
GLU HB2  H  N N 122 
GLU HB3  H  N N 123 
GLU HG2  H  N N 124 
GLU HG3  H  N N 125 
GLU HE2  H  N N 126 
GLU HXT  H  N N 127 
GLY N    N  N N 128 
GLY CA   C  N N 129 
GLY C    C  N N 130 
GLY O    O  N N 131 
GLY OXT  O  N N 132 
GLY H    H  N N 133 
GLY H2   H  N N 134 
GLY HA2  H  N N 135 
GLY HA3  H  N N 136 
GLY HXT  H  N N 137 
HIS N    N  N N 138 
HIS CA   C  N S 139 
HIS C    C  N N 140 
HIS O    O  N N 141 
HIS CB   C  N N 142 
HIS CG   C  Y N 143 
HIS ND1  N  Y N 144 
HIS CD2  C  Y N 145 
HIS CE1  C  Y N 146 
HIS NE2  N  Y N 147 
HIS OXT  O  N N 148 
HIS H    H  N N 149 
HIS H2   H  N N 150 
HIS HA   H  N N 151 
HIS HB2  H  N N 152 
HIS HB3  H  N N 153 
HIS HD1  H  N N 154 
HIS HD2  H  N N 155 
HIS HE1  H  N N 156 
HIS HE2  H  N N 157 
HIS HXT  H  N N 158 
ILE N    N  N N 159 
ILE CA   C  N S 160 
ILE C    C  N N 161 
ILE O    O  N N 162 
ILE CB   C  N S 163 
ILE CG1  C  N N 164 
ILE CG2  C  N N 165 
ILE CD1  C  N N 166 
ILE OXT  O  N N 167 
ILE H    H  N N 168 
ILE H2   H  N N 169 
ILE HA   H  N N 170 
ILE HB   H  N N 171 
ILE HG12 H  N N 172 
ILE HG13 H  N N 173 
ILE HG21 H  N N 174 
ILE HG22 H  N N 175 
ILE HG23 H  N N 176 
ILE HD11 H  N N 177 
ILE HD12 H  N N 178 
ILE HD13 H  N N 179 
ILE HXT  H  N N 180 
LEU N    N  N N 181 
LEU CA   C  N S 182 
LEU C    C  N N 183 
LEU O    O  N N 184 
LEU CB   C  N N 185 
LEU CG   C  N N 186 
LEU CD1  C  N N 187 
LEU CD2  C  N N 188 
LEU OXT  O  N N 189 
LEU H    H  N N 190 
LEU H2   H  N N 191 
LEU HA   H  N N 192 
LEU HB2  H  N N 193 
LEU HB3  H  N N 194 
LEU HG   H  N N 195 
LEU HD11 H  N N 196 
LEU HD12 H  N N 197 
LEU HD13 H  N N 198 
LEU HD21 H  N N 199 
LEU HD22 H  N N 200 
LEU HD23 H  N N 201 
LEU HXT  H  N N 202 
LYS N    N  N N 203 
LYS CA   C  N S 204 
LYS C    C  N N 205 
LYS O    O  N N 206 
LYS CB   C  N N 207 
LYS CG   C  N N 208 
LYS CD   C  N N 209 
LYS CE   C  N N 210 
LYS NZ   N  N N 211 
LYS OXT  O  N N 212 
LYS H    H  N N 213 
LYS H2   H  N N 214 
LYS HA   H  N N 215 
LYS HB2  H  N N 216 
LYS HB3  H  N N 217 
LYS HG2  H  N N 218 
LYS HG3  H  N N 219 
LYS HD2  H  N N 220 
LYS HD3  H  N N 221 
LYS HE2  H  N N 222 
LYS HE3  H  N N 223 
LYS HZ1  H  N N 224 
LYS HZ2  H  N N 225 
LYS HZ3  H  N N 226 
LYS HXT  H  N N 227 
MET N    N  N N 228 
MET CA   C  N S 229 
MET C    C  N N 230 
MET O    O  N N 231 
MET CB   C  N N 232 
MET CG   C  N N 233 
MET SD   S  N N 234 
MET CE   C  N N 235 
MET OXT  O  N N 236 
MET H    H  N N 237 
MET H2   H  N N 238 
MET HA   H  N N 239 
MET HB2  H  N N 240 
MET HB3  H  N N 241 
MET HG2  H  N N 242 
MET HG3  H  N N 243 
MET HE1  H  N N 244 
MET HE2  H  N N 245 
MET HE3  H  N N 246 
MET HXT  H  N N 247 
PHE N    N  N N 248 
PHE CA   C  N S 249 
PHE C    C  N N 250 
PHE O    O  N N 251 
PHE CB   C  N N 252 
PHE CG   C  Y N 253 
PHE CD1  C  Y N 254 
PHE CD2  C  Y N 255 
PHE CE1  C  Y N 256 
PHE CE2  C  Y N 257 
PHE CZ   C  Y N 258 
PHE OXT  O  N N 259 
PHE H    H  N N 260 
PHE H2   H  N N 261 
PHE HA   H  N N 262 
PHE HB2  H  N N 263 
PHE HB3  H  N N 264 
PHE HD1  H  N N 265 
PHE HD2  H  N N 266 
PHE HE1  H  N N 267 
PHE HE2  H  N N 268 
PHE HZ   H  N N 269 
PHE HXT  H  N N 270 
PRO N    N  N N 271 
PRO CA   C  N S 272 
PRO C    C  N N 273 
PRO O    O  N N 274 
PRO CB   C  N N 275 
PRO CG   C  N N 276 
PRO CD   C  N N 277 
PRO OXT  O  N N 278 
PRO H    H  N N 279 
PRO HA   H  N N 280 
PRO HB2  H  N N 281 
PRO HB3  H  N N 282 
PRO HG2  H  N N 283 
PRO HG3  H  N N 284 
PRO HD2  H  N N 285 
PRO HD3  H  N N 286 
PRO HXT  H  N N 287 
SER N    N  N N 288 
SER CA   C  N S 289 
SER C    C  N N 290 
SER O    O  N N 291 
SER CB   C  N N 292 
SER OG   O  N N 293 
SER OXT  O  N N 294 
SER H    H  N N 295 
SER H2   H  N N 296 
SER HA   H  N N 297 
SER HB2  H  N N 298 
SER HB3  H  N N 299 
SER HG   H  N N 300 
SER HXT  H  N N 301 
THR N    N  N N 302 
THR CA   C  N S 303 
THR C    C  N N 304 
THR O    O  N N 305 
THR CB   C  N R 306 
THR OG1  O  N N 307 
THR CG2  C  N N 308 
THR OXT  O  N N 309 
THR H    H  N N 310 
THR H2   H  N N 311 
THR HA   H  N N 312 
THR HB   H  N N 313 
THR HG1  H  N N 314 
THR HG21 H  N N 315 
THR HG22 H  N N 316 
THR HG23 H  N N 317 
THR HXT  H  N N 318 
TRP N    N  N N 319 
TRP CA   C  N S 320 
TRP C    C  N N 321 
TRP O    O  N N 322 
TRP CB   C  N N 323 
TRP CG   C  Y N 324 
TRP CD1  C  Y N 325 
TRP CD2  C  Y N 326 
TRP NE1  N  Y N 327 
TRP CE2  C  Y N 328 
TRP CE3  C  Y N 329 
TRP CZ2  C  Y N 330 
TRP CZ3  C  Y N 331 
TRP CH2  C  Y N 332 
TRP OXT  O  N N 333 
TRP H    H  N N 334 
TRP H2   H  N N 335 
TRP HA   H  N N 336 
TRP HB2  H  N N 337 
TRP HB3  H  N N 338 
TRP HD1  H  N N 339 
TRP HE1  H  N N 340 
TRP HE3  H  N N 341 
TRP HZ2  H  N N 342 
TRP HZ3  H  N N 343 
TRP HH2  H  N N 344 
TRP HXT  H  N N 345 
TYR N    N  N N 346 
TYR CA   C  N S 347 
TYR C    C  N N 348 
TYR O    O  N N 349 
TYR CB   C  N N 350 
TYR CG   C  Y N 351 
TYR CD1  C  Y N 352 
TYR CD2  C  Y N 353 
TYR CE1  C  Y N 354 
TYR CE2  C  Y N 355 
TYR CZ   C  Y N 356 
TYR OH   O  N N 357 
TYR OXT  O  N N 358 
TYR H    H  N N 359 
TYR H2   H  N N 360 
TYR HA   H  N N 361 
TYR HB2  H  N N 362 
TYR HB3  H  N N 363 
TYR HD1  H  N N 364 
TYR HD2  H  N N 365 
TYR HE1  H  N N 366 
TYR HE2  H  N N 367 
TYR HH   H  N N 368 
TYR HXT  H  N N 369 
VAL N    N  N N 370 
VAL CA   C  N S 371 
VAL C    C  N N 372 
VAL O    O  N N 373 
VAL CB   C  N N 374 
VAL CG1  C  N N 375 
VAL CG2  C  N N 376 
VAL OXT  O  N N 377 
VAL H    H  N N 378 
VAL H2   H  N N 379 
VAL HA   H  N N 380 
VAL HB   H  N N 381 
VAL HG11 H  N N 382 
VAL HG12 H  N N 383 
VAL HG13 H  N N 384 
VAL HG21 H  N N 385 
VAL HG22 H  N N 386 
VAL HG23 H  N N 387 
VAL HXT  H  N N 388 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TRP N   CA   sing N N 304 
TRP N   H    sing N N 305 
TRP N   H2   sing N N 306 
TRP CA  C    sing N N 307 
TRP CA  CB   sing N N 308 
TRP CA  HA   sing N N 309 
TRP C   O    doub N N 310 
TRP C   OXT  sing N N 311 
TRP CB  CG   sing N N 312 
TRP CB  HB2  sing N N 313 
TRP CB  HB3  sing N N 314 
TRP CG  CD1  doub Y N 315 
TRP CG  CD2  sing Y N 316 
TRP CD1 NE1  sing Y N 317 
TRP CD1 HD1  sing N N 318 
TRP CD2 CE2  doub Y N 319 
TRP CD2 CE3  sing Y N 320 
TRP NE1 CE2  sing Y N 321 
TRP NE1 HE1  sing N N 322 
TRP CE2 CZ2  sing Y N 323 
TRP CE3 CZ3  doub Y N 324 
TRP CE3 HE3  sing N N 325 
TRP CZ2 CH2  doub Y N 326 
TRP CZ2 HZ2  sing N N 327 
TRP CZ3 CH2  sing Y N 328 
TRP CZ3 HZ3  sing N N 329 
TRP CH2 HH2  sing N N 330 
TRP OXT HXT  sing N N 331 
TYR N   CA   sing N N 332 
TYR N   H    sing N N 333 
TYR N   H2   sing N N 334 
TYR CA  C    sing N N 335 
TYR CA  CB   sing N N 336 
TYR CA  HA   sing N N 337 
TYR C   O    doub N N 338 
TYR C   OXT  sing N N 339 
TYR CB  CG   sing N N 340 
TYR CB  HB2  sing N N 341 
TYR CB  HB3  sing N N 342 
TYR CG  CD1  doub Y N 343 
TYR CG  CD2  sing Y N 344 
TYR CD1 CE1  sing Y N 345 
TYR CD1 HD1  sing N N 346 
TYR CD2 CE2  doub Y N 347 
TYR CD2 HD2  sing N N 348 
TYR CE1 CZ   doub Y N 349 
TYR CE1 HE1  sing N N 350 
TYR CE2 CZ   sing Y N 351 
TYR CE2 HE2  sing N N 352 
TYR CZ  OH   sing N N 353 
TYR OH  HH   sing N N 354 
TYR OXT HXT  sing N N 355 
VAL N   CA   sing N N 356 
VAL N   H    sing N N 357 
VAL N   H2   sing N N 358 
VAL CA  C    sing N N 359 
VAL CA  CB   sing N N 360 
VAL CA  HA   sing N N 361 
VAL C   O    doub N N 362 
VAL C   OXT  sing N N 363 
VAL CB  CG1  sing N N 364 
VAL CB  CG2  sing N N 365 
VAL CB  HB   sing N N 366 
VAL CG1 HG11 sing N N 367 
VAL CG1 HG12 sing N N 368 
VAL CG1 HG13 sing N N 369 
VAL CG2 HG21 sing N N 370 
VAL CG2 HG22 sing N N 371 
VAL CG2 HG23 sing N N 372 
VAL OXT HXT  sing N N 373 
# 
_atom_sites.entry_id                    5Y0Y 
_atom_sites.fract_transf_matrix[1][1]   0.010290 
_atom_sites.fract_transf_matrix[1][2]   0.005941 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011882 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005431 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AU 
C  
N  
O  
S  
# 
loop_