data_5YB2 # _entry.id 5YB2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YB2 pdb_00005yb2 10.2210/pdb5yb2/pdb WWPDB D_1300004818 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-28 2 'Structure model' 1 1 2018-03-28 3 'Structure model' 1 2 2024-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation_author.name' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YB2 _pdbx_database_status.recvd_initial_deposition_date 2017-09-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, X.' 1 ? 'Wang, X.' 2 ? 'He, Y.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Cell Infect Microbiol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2235-2988 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 51 _citation.page_last 51 _citation.title 'Structural Insights into the Mechanisms of Action of Short-Peptide HIV-1 Fusion Inhibitors Targeting the Gp41 Pocket' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fcimb.2018.00051 _citation.pdbx_database_id_PubMed 29535974 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, X.' 1 ? primary 'Zhu, Y.' 2 ? primary 'Hu, H.' 3 ? primary 'Zhang, S.' 4 ? primary 'Wang, P.' 5 ? primary 'Chong, H.' 6 ? primary 'He, J.' 7 ? primary 'Wang, X.' 8 ? primary 'He, Y.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Envelope glycoprotein' 8020.283 5 ? ? 'UNP residues 426-467' ? 2 polymer syn 'Envelope glycoprotein' 5037.884 2 ? ? 'UNP residues 27-70' ? 3 polymer syn LP-11 3000.415 7 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no TVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILELTWEEWEKKIEEYTKKIEEILK TVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILELTWEEWEKKIEEYTKKIEEILK E,D,B,A,M ? 2 'polypeptide(L)' no no TVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL TVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL F,C ? 3 'polypeptide(L)' no no ELTWEEWEKKIEEYTKKIEEILK ELTWEEWEKKIEEYTKKIEEILK H,G,I,K,J,L,P ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 VAL n 1 3 GLN n 1 4 ALA n 1 5 ARG n 1 6 GLN n 1 7 LEU n 1 8 LEU n 1 9 SER n 1 10 GLY n 1 11 ILE n 1 12 VAL n 1 13 GLN n 1 14 GLN n 1 15 GLN n 1 16 ASN n 1 17 ASN n 1 18 LEU n 1 19 LEU n 1 20 ARG n 1 21 ALA n 1 22 ILE n 1 23 GLU n 1 24 ALA n 1 25 GLN n 1 26 GLN n 1 27 HIS n 1 28 LEU n 1 29 LEU n 1 30 GLN n 1 31 LEU n 1 32 THR n 1 33 VAL n 1 34 TRP n 1 35 GLY n 1 36 ILE n 1 37 LYS n 1 38 GLN n 1 39 LEU n 1 40 GLN n 1 41 ALA n 1 42 ARG n 1 43 ILE n 1 44 LEU n 1 45 GLU n 1 46 LEU n 1 47 THR n 1 48 TRP n 1 49 GLU n 1 50 GLU n 1 51 TRP n 1 52 GLU n 1 53 LYS n 1 54 LYS n 1 55 ILE n 1 56 GLU n 1 57 GLU n 1 58 TYR n 1 59 THR n 1 60 LYS n 1 61 LYS n 1 62 ILE n 1 63 GLU n 1 64 GLU n 1 65 ILE n 1 66 LEU n 1 67 LYS n 2 1 THR n 2 2 VAL n 2 3 GLN n 2 4 ALA n 2 5 ARG n 2 6 GLN n 2 7 LEU n 2 8 LEU n 2 9 SER n 2 10 GLY n 2 11 ILE n 2 12 VAL n 2 13 GLN n 2 14 GLN n 2 15 GLN n 2 16 ASN n 2 17 ASN n 2 18 LEU n 2 19 LEU n 2 20 ARG n 2 21 ALA n 2 22 ILE n 2 23 GLU n 2 24 ALA n 2 25 GLN n 2 26 GLN n 2 27 HIS n 2 28 LEU n 2 29 LEU n 2 30 GLN n 2 31 LEU n 2 32 THR n 2 33 VAL n 2 34 TRP n 2 35 GLY n 2 36 ILE n 2 37 LYS n 2 38 GLN n 2 39 LEU n 2 40 GLN n 2 41 ALA n 2 42 ARG n 2 43 ILE n 2 44 LEU n 3 1 GLU n 3 2 LEU n 3 3 THR n 3 4 TRP n 3 5 GLU n 3 6 GLU n 3 7 TRP n 3 8 GLU n 3 9 LYS n 3 10 LYS n 3 11 ILE n 3 12 GLU n 3 13 GLU n 3 14 TYR n 3 15 THR n 3 16 LYS n 3 17 LYS n 3 18 ILE n 3 19 GLU n 3 20 GLU n 3 21 ILE n 3 22 LEU n 3 23 LYS n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample 1 67 'Human immunodeficiency virus 1' ? 11676 ? 2 1 sample 1 44 'Human immunodeficiency virus 1' ? 11676 ? 3 1 sample 1 23 'Human immunodeficiency virus 1' ? 11676 ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 -7 ? ? ? E . n A 1 2 VAL 2 -6 ? ? ? E . n A 1 3 GLN 3 -5 ? ? ? E . n A 1 4 ALA 4 -4 ? ? ? E . n A 1 5 ARG 5 -3 ? ? ? E . n A 1 6 GLN 6 -2 ? ? ? E . n A 1 7 LEU 7 -1 ? ? ? E . n A 1 8 LEU 8 0 ? ? ? E . n A 1 9 SER 9 1 1 SER SER E . n A 1 10 GLY 10 2 2 GLY GLY E . n A 1 11 ILE 11 3 3 ILE ILE E . n A 1 12 VAL 12 4 4 VAL VAL E . n A 1 13 GLN 13 5 5 GLN GLN E . n A 1 14 GLN 14 6 6 GLN GLN E . n A 1 15 GLN 15 7 7 GLN GLN E . n A 1 16 ASN 16 8 8 ASN ASN E . n A 1 17 ASN 17 9 9 ASN ASN E . n A 1 18 LEU 18 10 10 LEU LEU E . n A 1 19 LEU 19 11 11 LEU LEU E . n A 1 20 ARG 20 12 12 ARG ARG E . n A 1 21 ALA 21 13 13 ALA ALA E . n A 1 22 ILE 22 14 14 ILE ILE E . n A 1 23 GLU 23 15 15 GLU GLU E . n A 1 24 ALA 24 16 16 ALA ALA E . n A 1 25 GLN 25 17 17 GLN GLN E . n A 1 26 GLN 26 18 18 GLN GLN E . n A 1 27 HIS 27 19 19 HIS HIS E . n A 1 28 LEU 28 20 20 LEU LEU E . n A 1 29 LEU 29 21 21 LEU LEU E . n A 1 30 GLN 30 22 22 GLN GLN E . n A 1 31 LEU 31 23 23 LEU LEU E . n A 1 32 THR 32 24 24 THR THR E . n A 1 33 VAL 33 25 25 VAL VAL E . n A 1 34 TRP 34 26 26 TRP TRP E . n A 1 35 GLY 35 27 27 GLY GLY E . n A 1 36 ILE 36 28 28 ILE ILE E . n A 1 37 LYS 37 29 29 LYS LYS E . n A 1 38 GLN 38 30 30 GLN GLN E . n A 1 39 LEU 39 31 31 LEU LEU E . n A 1 40 GLN 40 32 32 GLN GLN E . n A 1 41 ALA 41 33 33 ALA ALA E . n A 1 42 ARG 42 34 34 ARG ARG E . n A 1 43 ILE 43 35 35 ILE ILE E . n A 1 44 LEU 44 36 36 LEU LEU E . n A 1 45 GLU 45 37 ? ? ? E . n A 1 46 LEU 46 38 ? ? ? E . n A 1 47 THR 47 39 ? ? ? E . n A 1 48 TRP 48 40 ? ? ? E . n A 1 49 GLU 49 41 ? ? ? E . n A 1 50 GLU 50 42 ? ? ? E . n A 1 51 TRP 51 43 ? ? ? E . n A 1 52 GLU 52 44 ? ? ? E . n A 1 53 LYS 53 45 ? ? ? E . n A 1 54 LYS 54 46 ? ? ? E . n A 1 55 ILE 55 47 ? ? ? E . n A 1 56 GLU 56 48 ? ? ? E . n A 1 57 GLU 57 49 ? ? ? E . n A 1 58 TYR 58 50 ? ? ? E . n A 1 59 THR 59 51 ? ? ? E . n A 1 60 LYS 60 52 ? ? ? E . n A 1 61 LYS 61 53 ? ? ? E . n A 1 62 ILE 62 54 ? ? ? E . n A 1 63 GLU 63 55 ? ? ? E . n A 1 64 GLU 64 56 ? ? ? E . n A 1 65 ILE 65 57 ? ? ? E . n A 1 66 LEU 66 58 ? ? ? E . n A 1 67 LYS 67 59 ? ? ? E . n B 1 1 THR 1 -7 ? ? ? D . n B 1 2 VAL 2 -6 ? ? ? D . n B 1 3 GLN 3 -5 ? ? ? D . n B 1 4 ALA 4 -4 ? ? ? D . n B 1 5 ARG 5 -3 ? ? ? D . n B 1 6 GLN 6 -2 ? ? ? D . n B 1 7 LEU 7 -1 ? ? ? D . n B 1 8 LEU 8 0 ? ? ? D . n B 1 9 SER 9 1 1 SER SER D . n B 1 10 GLY 10 2 2 GLY GLY D . n B 1 11 ILE 11 3 3 ILE ILE D . n B 1 12 VAL 12 4 4 VAL VAL D . n B 1 13 GLN 13 5 5 GLN GLN D . n B 1 14 GLN 14 6 6 GLN GLN D . n B 1 15 GLN 15 7 7 GLN GLN D . n B 1 16 ASN 16 8 8 ASN ASN D . n B 1 17 ASN 17 9 9 ASN ASN D . n B 1 18 LEU 18 10 10 LEU LEU D . n B 1 19 LEU 19 11 11 LEU LEU D . n B 1 20 ARG 20 12 12 ARG ARG D . n B 1 21 ALA 21 13 13 ALA ALA D . n B 1 22 ILE 22 14 14 ILE ILE D . n B 1 23 GLU 23 15 15 GLU GLU D . n B 1 24 ALA 24 16 16 ALA ALA D . n B 1 25 GLN 25 17 17 GLN GLN D . n B 1 26 GLN 26 18 18 GLN GLN D . n B 1 27 HIS 27 19 19 HIS HIS D . n B 1 28 LEU 28 20 20 LEU LEU D . n B 1 29 LEU 29 21 21 LEU LEU D . n B 1 30 GLN 30 22 22 GLN GLN D . n B 1 31 LEU 31 23 23 LEU LEU D . n B 1 32 THR 32 24 24 THR THR D . n B 1 33 VAL 33 25 25 VAL VAL D . n B 1 34 TRP 34 26 26 TRP TRP D . n B 1 35 GLY 35 27 27 GLY GLY D . n B 1 36 ILE 36 28 28 ILE ILE D . n B 1 37 LYS 37 29 29 LYS LYS D . n B 1 38 GLN 38 30 30 GLN GLN D . n B 1 39 LEU 39 31 31 LEU LEU D . n B 1 40 GLN 40 32 32 GLN GLN D . n B 1 41 ALA 41 33 33 ALA ALA D . n B 1 42 ARG 42 34 34 ARG ARG D . n B 1 43 ILE 43 35 35 ILE ILE D . n B 1 44 LEU 44 36 36 LEU LEU D . n B 1 45 GLU 45 37 ? ? ? D . n B 1 46 LEU 46 38 ? ? ? D . n B 1 47 THR 47 39 ? ? ? D . n B 1 48 TRP 48 40 ? ? ? D . n B 1 49 GLU 49 41 ? ? ? D . n B 1 50 GLU 50 42 ? ? ? D . n B 1 51 TRP 51 43 ? ? ? D . n B 1 52 GLU 52 44 ? ? ? D . n B 1 53 LYS 53 45 ? ? ? D . n B 1 54 LYS 54 46 ? ? ? D . n B 1 55 ILE 55 47 ? ? ? D . n B 1 56 GLU 56 48 ? ? ? D . n B 1 57 GLU 57 49 ? ? ? D . n B 1 58 TYR 58 50 ? ? ? D . n B 1 59 THR 59 51 ? ? ? D . n B 1 60 LYS 60 52 ? ? ? D . n B 1 61 LYS 61 53 ? ? ? D . n B 1 62 ILE 62 54 ? ? ? D . n B 1 63 GLU 63 55 ? ? ? D . n B 1 64 GLU 64 56 ? ? ? D . n B 1 65 ILE 65 57 ? ? ? D . n B 1 66 LEU 66 58 ? ? ? D . n B 1 67 LYS 67 59 ? ? ? D . n C 2 1 THR 1 -7 ? ? ? F . n C 2 2 VAL 2 -6 ? ? ? F . n C 2 3 GLN 3 -5 ? ? ? F . n C 2 4 ALA 4 -4 ? ? ? F . n C 2 5 ARG 5 -3 ? ? ? F . n C 2 6 GLN 6 -2 ? ? ? F . n C 2 7 LEU 7 -1 ? ? ? F . n C 2 8 LEU 8 0 ? ? ? F . n C 2 9 SER 9 1 ? ? ? F . n C 2 10 GLY 10 2 2 GLY GLY F . n C 2 11 ILE 11 3 3 ILE ILE F . n C 2 12 VAL 12 4 4 VAL VAL F . n C 2 13 GLN 13 5 5 GLN GLN F . n C 2 14 GLN 14 6 6 GLN GLN F . n C 2 15 GLN 15 7 7 GLN GLN F . n C 2 16 ASN 16 8 8 ASN ASN F . n C 2 17 ASN 17 9 9 ASN ASN F . n C 2 18 LEU 18 10 10 LEU LEU F . n C 2 19 LEU 19 11 11 LEU LEU F . n C 2 20 ARG 20 12 12 ARG ARG F . n C 2 21 ALA 21 13 13 ALA ALA F . n C 2 22 ILE 22 14 14 ILE ILE F . n C 2 23 GLU 23 15 15 GLU GLU F . n C 2 24 ALA 24 16 16 ALA ALA F . n C 2 25 GLN 25 17 17 GLN GLN F . n C 2 26 GLN 26 18 18 GLN GLN F . n C 2 27 HIS 27 19 19 HIS HIS F . n C 2 28 LEU 28 20 20 LEU LEU F . n C 2 29 LEU 29 21 21 LEU LEU F . n C 2 30 GLN 30 22 22 GLN GLN F . n C 2 31 LEU 31 23 23 LEU LEU F . n C 2 32 THR 32 24 24 THR THR F . n C 2 33 VAL 33 25 25 VAL VAL F . n C 2 34 TRP 34 26 26 TRP TRP F . n C 2 35 GLY 35 27 27 GLY GLY F . n C 2 36 ILE 36 28 28 ILE ILE F . n C 2 37 LYS 37 29 29 LYS LYS F . n C 2 38 GLN 38 30 30 GLN GLN F . n C 2 39 LEU 39 31 31 LEU LEU F . n C 2 40 GLN 40 32 32 GLN GLN F . n C 2 41 ALA 41 33 33 ALA ALA F . n C 2 42 ARG 42 34 34 ARG ARG F . n C 2 43 ILE 43 35 35 ILE ILE F . n C 2 44 LEU 44 36 36 LEU LEU F . n D 3 1 GLU 1 47 47 GLU GLU H . n D 3 2 LEU 2 48 48 LEU LEU H . n D 3 3 THR 3 49 49 THR THR H . n D 3 4 TRP 4 50 50 TRP TRP H . n D 3 5 GLU 5 51 51 GLU GLU H . n D 3 6 GLU 6 52 52 GLU GLU H . n D 3 7 TRP 7 53 53 TRP TRP H . n D 3 8 GLU 8 54 54 GLU GLU H . n D 3 9 LYS 9 55 55 LYS LYS H . n D 3 10 LYS 10 56 56 LYS LYS H . n D 3 11 ILE 11 57 57 ILE ILE H . n D 3 12 GLU 12 58 58 GLU GLU H . n D 3 13 GLU 13 59 59 GLU GLU H . n D 3 14 TYR 14 60 60 TYR TYR H . n D 3 15 THR 15 61 61 THR THR H . n D 3 16 LYS 16 62 62 LYS LYS H . n D 3 17 LYS 17 63 63 LYS LYS H . n D 3 18 ILE 18 64 64 ILE ILE H . n D 3 19 GLU 19 65 65 GLU GLU H . n D 3 20 GLU 20 66 66 GLU GLU H . n D 3 21 ILE 21 67 67 ILE ILE H . n D 3 22 LEU 22 68 68 LEU LEU H . n D 3 23 LYS 23 69 69 LYS LYS H . n E 3 1 GLU 1 47 47 GLU GLU G . n E 3 2 LEU 2 48 48 LEU LEU G . n E 3 3 THR 3 49 49 THR THR G . n E 3 4 TRP 4 50 50 TRP TRP G . n E 3 5 GLU 5 51 51 GLU GLU G . n E 3 6 GLU 6 52 52 GLU GLU G . n E 3 7 TRP 7 53 53 TRP TRP G . n E 3 8 GLU 8 54 54 GLU GLU G . n E 3 9 LYS 9 55 55 LYS LYS G . n E 3 10 LYS 10 56 56 LYS LYS G . n E 3 11 ILE 11 57 57 ILE ILE G . n E 3 12 GLU 12 58 58 GLU GLU G . n E 3 13 GLU 13 59 59 GLU GLU G . n E 3 14 TYR 14 60 60 TYR TYR G . n E 3 15 THR 15 61 61 THR THR G . n E 3 16 LYS 16 62 62 LYS LYS G . n E 3 17 LYS 17 63 63 LYS LYS G . n E 3 18 ILE 18 64 64 ILE ILE G . n E 3 19 GLU 19 65 65 GLU GLU G . n E 3 20 GLU 20 66 66 GLU GLU G . n E 3 21 ILE 21 67 67 ILE ILE G . n E 3 22 LEU 22 68 68 LEU LEU G . n E 3 23 LYS 23 69 69 LYS LYS G . n F 3 1 GLU 1 47 47 GLU GLU I . n F 3 2 LEU 2 48 48 LEU LEU I . n F 3 3 THR 3 49 49 THR THR I . n F 3 4 TRP 4 50 50 TRP TRP I . n F 3 5 GLU 5 51 51 GLU GLU I . n F 3 6 GLU 6 52 52 GLU GLU I . n F 3 7 TRP 7 53 53 TRP TRP I . n F 3 8 GLU 8 54 54 GLU GLU I . n F 3 9 LYS 9 55 55 LYS LYS I . n F 3 10 LYS 10 56 56 LYS LYS I . n F 3 11 ILE 11 57 57 ILE ILE I . n F 3 12 GLU 12 58 58 GLU GLU I . n F 3 13 GLU 13 59 59 GLU GLU I . n F 3 14 TYR 14 60 60 TYR TYR I . n F 3 15 THR 15 61 61 THR THR I . n F 3 16 LYS 16 62 62 LYS LYS I . n F 3 17 LYS 17 63 63 LYS LYS I . n F 3 18 ILE 18 64 64 ILE ILE I . n F 3 19 GLU 19 65 65 GLU GLU I . n F 3 20 GLU 20 66 66 GLU GLU I . n F 3 21 ILE 21 67 67 ILE ILE I . n F 3 22 LEU 22 68 68 LEU LEU I . n F 3 23 LYS 23 69 69 LYS LYS I . n G 1 1 THR 1 -7 ? ? ? B . n G 1 2 VAL 2 -6 ? ? ? B . n G 1 3 GLN 3 -5 ? ? ? B . n G 1 4 ALA 4 -4 ? ? ? B . n G 1 5 ARG 5 -3 ? ? ? B . n G 1 6 GLN 6 -2 ? ? ? B . n G 1 7 LEU 7 -1 ? ? ? B . n G 1 8 LEU 8 0 ? ? ? B . n G 1 9 SER 9 1 1 SER SER B . n G 1 10 GLY 10 2 2 GLY GLY B . n G 1 11 ILE 11 3 3 ILE ILE B . n G 1 12 VAL 12 4 4 VAL VAL B . n G 1 13 GLN 13 5 5 GLN GLN B . n G 1 14 GLN 14 6 6 GLN GLN B . n G 1 15 GLN 15 7 7 GLN GLN B . n G 1 16 ASN 16 8 8 ASN ASN B . n G 1 17 ASN 17 9 9 ASN ASN B . n G 1 18 LEU 18 10 10 LEU LEU B . n G 1 19 LEU 19 11 11 LEU LEU B . n G 1 20 ARG 20 12 12 ARG ARG B . n G 1 21 ALA 21 13 13 ALA ALA B . n G 1 22 ILE 22 14 14 ILE ILE B . n G 1 23 GLU 23 15 15 GLU GLU B . n G 1 24 ALA 24 16 16 ALA ALA B . n G 1 25 GLN 25 17 17 GLN GLN B . n G 1 26 GLN 26 18 18 GLN GLN B . n G 1 27 HIS 27 19 19 HIS HIS B . n G 1 28 LEU 28 20 20 LEU LEU B . n G 1 29 LEU 29 21 21 LEU LEU B . n G 1 30 GLN 30 22 22 GLN GLN B . n G 1 31 LEU 31 23 23 LEU LEU B . n G 1 32 THR 32 24 24 THR THR B . n G 1 33 VAL 33 25 25 VAL VAL B . n G 1 34 TRP 34 26 26 TRP TRP B . n G 1 35 GLY 35 27 27 GLY GLY B . n G 1 36 ILE 36 28 28 ILE ILE B . n G 1 37 LYS 37 29 29 LYS LYS B . n G 1 38 GLN 38 30 30 GLN GLN B . n G 1 39 LEU 39 31 31 LEU LEU B . n G 1 40 GLN 40 32 32 GLN GLN B . n G 1 41 ALA 41 33 33 ALA ALA B . n G 1 42 ARG 42 34 34 ARG ARG B . n G 1 43 ILE 43 35 35 ILE ILE B . n G 1 44 LEU 44 36 36 LEU LEU B . n G 1 45 GLU 45 37 ? ? ? B . n G 1 46 LEU 46 38 ? ? ? B . n G 1 47 THR 47 39 ? ? ? B . n G 1 48 TRP 48 40 ? ? ? B . n G 1 49 GLU 49 41 ? ? ? B . n G 1 50 GLU 50 42 ? ? ? B . n G 1 51 TRP 51 43 ? ? ? B . n G 1 52 GLU 52 44 ? ? ? B . n G 1 53 LYS 53 45 ? ? ? B . n G 1 54 LYS 54 46 ? ? ? B . n G 1 55 ILE 55 47 ? ? ? B . n G 1 56 GLU 56 48 ? ? ? B . n G 1 57 GLU 57 49 ? ? ? B . n G 1 58 TYR 58 50 ? ? ? B . n G 1 59 THR 59 51 ? ? ? B . n G 1 60 LYS 60 52 ? ? ? B . n G 1 61 LYS 61 53 ? ? ? B . n G 1 62 ILE 62 54 ? ? ? B . n G 1 63 GLU 63 55 ? ? ? B . n G 1 64 GLU 64 56 ? ? ? B . n G 1 65 ILE 65 57 ? ? ? B . n G 1 66 LEU 66 58 ? ? ? B . n G 1 67 LYS 67 59 ? ? ? B . n H 1 1 THR 1 -7 ? ? ? A . n H 1 2 VAL 2 -6 ? ? ? A . n H 1 3 GLN 3 -5 ? ? ? A . n H 1 4 ALA 4 -4 ? ? ? A . n H 1 5 ARG 5 -3 ? ? ? A . n H 1 6 GLN 6 -2 ? ? ? A . n H 1 7 LEU 7 -1 ? ? ? A . n H 1 8 LEU 8 0 ? ? ? A . n H 1 9 SER 9 1 1 SER SER A . n H 1 10 GLY 10 2 2 GLY GLY A . n H 1 11 ILE 11 3 3 ILE ILE A . n H 1 12 VAL 12 4 4 VAL VAL A . n H 1 13 GLN 13 5 5 GLN GLN A . n H 1 14 GLN 14 6 6 GLN GLN A . n H 1 15 GLN 15 7 7 GLN GLN A . n H 1 16 ASN 16 8 8 ASN ASN A . n H 1 17 ASN 17 9 9 ASN ASN A . n H 1 18 LEU 18 10 10 LEU LEU A . n H 1 19 LEU 19 11 11 LEU LEU A . n H 1 20 ARG 20 12 12 ARG ARG A . n H 1 21 ALA 21 13 13 ALA ALA A . n H 1 22 ILE 22 14 14 ILE ILE A . n H 1 23 GLU 23 15 15 GLU GLU A . n H 1 24 ALA 24 16 16 ALA ALA A . n H 1 25 GLN 25 17 17 GLN GLN A . n H 1 26 GLN 26 18 18 GLN GLN A . n H 1 27 HIS 27 19 19 HIS HIS A . n H 1 28 LEU 28 20 20 LEU LEU A . n H 1 29 LEU 29 21 21 LEU LEU A . n H 1 30 GLN 30 22 22 GLN GLN A . n H 1 31 LEU 31 23 23 LEU LEU A . n H 1 32 THR 32 24 24 THR THR A . n H 1 33 VAL 33 25 25 VAL VAL A . n H 1 34 TRP 34 26 26 TRP TRP A . n H 1 35 GLY 35 27 27 GLY GLY A . n H 1 36 ILE 36 28 28 ILE ILE A . n H 1 37 LYS 37 29 29 LYS LYS A . n H 1 38 GLN 38 30 30 GLN GLN A . n H 1 39 LEU 39 31 31 LEU LEU A . n H 1 40 GLN 40 32 32 GLN GLN A . n H 1 41 ALA 41 33 33 ALA ALA A . n H 1 42 ARG 42 34 34 ARG ARG A . n H 1 43 ILE 43 35 35 ILE ILE A . n H 1 44 LEU 44 36 36 LEU LEU A . n H 1 45 GLU 45 37 ? ? ? A . n H 1 46 LEU 46 38 ? ? ? A . n H 1 47 THR 47 39 ? ? ? A . n H 1 48 TRP 48 40 ? ? ? A . n H 1 49 GLU 49 41 ? ? ? A . n H 1 50 GLU 50 42 ? ? ? A . n H 1 51 TRP 51 43 ? ? ? A . n H 1 52 GLU 52 44 ? ? ? A . n H 1 53 LYS 53 45 ? ? ? A . n H 1 54 LYS 54 46 ? ? ? A . n H 1 55 ILE 55 47 ? ? ? A . n H 1 56 GLU 56 48 ? ? ? A . n H 1 57 GLU 57 49 ? ? ? A . n H 1 58 TYR 58 50 ? ? ? A . n H 1 59 THR 59 51 ? ? ? A . n H 1 60 LYS 60 52 ? ? ? A . n H 1 61 LYS 61 53 ? ? ? A . n H 1 62 ILE 62 54 ? ? ? A . n H 1 63 GLU 63 55 ? ? ? A . n H 1 64 GLU 64 56 ? ? ? A . n H 1 65 ILE 65 57 ? ? ? A . n H 1 66 LEU 66 58 ? ? ? A . n H 1 67 LYS 67 59 ? ? ? A . n I 2 1 THR 1 -7 ? ? ? C . n I 2 2 VAL 2 -6 ? ? ? C . n I 2 3 GLN 3 -5 ? ? ? C . n I 2 4 ALA 4 -4 ? ? ? C . n I 2 5 ARG 5 -3 ? ? ? C . n I 2 6 GLN 6 -2 ? ? ? C . n I 2 7 LEU 7 -1 ? ? ? C . n I 2 8 LEU 8 0 ? ? ? C . n I 2 9 SER 9 1 ? ? ? C . n I 2 10 GLY 10 2 2 GLY GLY C . n I 2 11 ILE 11 3 3 ILE ILE C . n I 2 12 VAL 12 4 4 VAL VAL C . n I 2 13 GLN 13 5 5 GLN GLN C . n I 2 14 GLN 14 6 6 GLN GLN C . n I 2 15 GLN 15 7 7 GLN GLN C . n I 2 16 ASN 16 8 8 ASN ASN C . n I 2 17 ASN 17 9 9 ASN ASN C . n I 2 18 LEU 18 10 10 LEU LEU C . n I 2 19 LEU 19 11 11 LEU LEU C . n I 2 20 ARG 20 12 12 ARG ARG C . n I 2 21 ALA 21 13 13 ALA ALA C . n I 2 22 ILE 22 14 14 ILE ILE C . n I 2 23 GLU 23 15 15 GLU GLU C . n I 2 24 ALA 24 16 16 ALA ALA C . n I 2 25 GLN 25 17 17 GLN GLN C . n I 2 26 GLN 26 18 18 GLN GLN C . n I 2 27 HIS 27 19 19 HIS HIS C . n I 2 28 LEU 28 20 20 LEU LEU C . n I 2 29 LEU 29 21 21 LEU LEU C . n I 2 30 GLN 30 22 22 GLN GLN C . n I 2 31 LEU 31 23 23 LEU LEU C . n I 2 32 THR 32 24 24 THR THR C . n I 2 33 VAL 33 25 25 VAL VAL C . n I 2 34 TRP 34 26 26 TRP TRP C . n I 2 35 GLY 35 27 27 GLY GLY C . n I 2 36 ILE 36 28 28 ILE ILE C . n I 2 37 LYS 37 29 29 LYS LYS C . n I 2 38 GLN 38 30 30 GLN GLN C . n I 2 39 LEU 39 31 31 LEU LEU C . n I 2 40 GLN 40 32 32 GLN GLN C . n I 2 41 ALA 41 33 33 ALA ALA C . n I 2 42 ARG 42 34 34 ARG ARG C . n I 2 43 ILE 43 35 35 ILE ILE C . n I 2 44 LEU 44 36 36 LEU LEU C . n J 3 1 GLU 1 47 47 GLU GLU K . n J 3 2 LEU 2 48 48 LEU LEU K . n J 3 3 THR 3 49 49 THR THR K . n J 3 4 TRP 4 50 50 TRP TRP K . n J 3 5 GLU 5 51 51 GLU GLU K . n J 3 6 GLU 6 52 52 GLU GLU K . n J 3 7 TRP 7 53 53 TRP TRP K . n J 3 8 GLU 8 54 54 GLU GLU K . n J 3 9 LYS 9 55 55 LYS LYS K . n J 3 10 LYS 10 56 56 LYS LYS K . n J 3 11 ILE 11 57 57 ILE ILE K . n J 3 12 GLU 12 58 58 GLU GLU K . n J 3 13 GLU 13 59 59 GLU GLU K . n J 3 14 TYR 14 60 60 TYR TYR K . n J 3 15 THR 15 61 61 THR THR K . n J 3 16 LYS 16 62 62 LYS LYS K . n J 3 17 LYS 17 63 63 LYS LYS K . n J 3 18 ILE 18 64 64 ILE ILE K . n J 3 19 GLU 19 65 65 GLU GLU K . n J 3 20 GLU 20 66 66 GLU GLU K . n J 3 21 ILE 21 67 67 ILE ILE K . n J 3 22 LEU 22 68 68 LEU LEU K . n J 3 23 LYS 23 69 69 LYS LYS K . n K 3 1 GLU 1 47 47 GLU GLU J . n K 3 2 LEU 2 48 48 LEU LEU J . n K 3 3 THR 3 49 49 THR THR J . n K 3 4 TRP 4 50 50 TRP TRP J . n K 3 5 GLU 5 51 51 GLU GLU J . n K 3 6 GLU 6 52 52 GLU GLU J . n K 3 7 TRP 7 53 53 TRP TRP J . n K 3 8 GLU 8 54 54 GLU GLU J . n K 3 9 LYS 9 55 55 LYS LYS J . n K 3 10 LYS 10 56 56 LYS LYS J . n K 3 11 ILE 11 57 57 ILE ILE J . n K 3 12 GLU 12 58 58 GLU GLU J . n K 3 13 GLU 13 59 59 GLU GLU J . n K 3 14 TYR 14 60 60 TYR TYR J . n K 3 15 THR 15 61 61 THR THR J . n K 3 16 LYS 16 62 62 LYS LYS J . n K 3 17 LYS 17 63 63 LYS LYS J . n K 3 18 ILE 18 64 64 ILE ILE J . n K 3 19 GLU 19 65 65 GLU GLU J . n K 3 20 GLU 20 66 66 GLU GLU J . n K 3 21 ILE 21 67 67 ILE ILE J . n K 3 22 LEU 22 68 68 LEU LEU J . n K 3 23 LYS 23 69 69 LYS LYS J . n L 3 1 GLU 1 47 47 GLU GLU L . n L 3 2 LEU 2 48 48 LEU LEU L . n L 3 3 THR 3 49 49 THR THR L . n L 3 4 TRP 4 50 50 TRP TRP L . n L 3 5 GLU 5 51 51 GLU GLU L . n L 3 6 GLU 6 52 52 GLU GLU L . n L 3 7 TRP 7 53 53 TRP TRP L . n L 3 8 GLU 8 54 54 GLU GLU L . n L 3 9 LYS 9 55 55 LYS LYS L . n L 3 10 LYS 10 56 56 LYS LYS L . n L 3 11 ILE 11 57 57 ILE ILE L . n L 3 12 GLU 12 58 58 GLU GLU L . n L 3 13 GLU 13 59 59 GLU GLU L . n L 3 14 TYR 14 60 60 TYR TYR L . n L 3 15 THR 15 61 61 THR THR L . n L 3 16 LYS 16 62 62 LYS LYS L . n L 3 17 LYS 17 63 63 LYS LYS L . n L 3 18 ILE 18 64 64 ILE ILE L . n L 3 19 GLU 19 65 65 GLU GLU L . n L 3 20 GLU 20 66 66 GLU GLU L . n L 3 21 ILE 21 67 67 ILE ILE L . n L 3 22 LEU 22 68 68 LEU LEU L . n L 3 23 LYS 23 69 69 LYS LYS L . n M 1 1 THR 1 -7 ? ? ? M . n M 1 2 VAL 2 -6 ? ? ? M . n M 1 3 GLN 3 -5 ? ? ? M . n M 1 4 ALA 4 -4 ? ? ? M . n M 1 5 ARG 5 -3 ? ? ? M . n M 1 6 GLN 6 -2 ? ? ? M . n M 1 7 LEU 7 -1 ? ? ? M . n M 1 8 LEU 8 0 ? ? ? M . n M 1 9 SER 9 1 1 SER SER M . n M 1 10 GLY 10 2 2 GLY GLY M . n M 1 11 ILE 11 3 3 ILE ILE M . n M 1 12 VAL 12 4 4 VAL VAL M . n M 1 13 GLN 13 5 5 GLN GLN M . n M 1 14 GLN 14 6 6 GLN GLN M . n M 1 15 GLN 15 7 7 GLN GLN M . n M 1 16 ASN 16 8 8 ASN ASN M . n M 1 17 ASN 17 9 9 ASN ASN M . n M 1 18 LEU 18 10 10 LEU LEU M . n M 1 19 LEU 19 11 11 LEU LEU M . n M 1 20 ARG 20 12 12 ARG ARG M . n M 1 21 ALA 21 13 13 ALA ALA M . n M 1 22 ILE 22 14 14 ILE ILE M . n M 1 23 GLU 23 15 15 GLU GLU M . n M 1 24 ALA 24 16 16 ALA ALA M . n M 1 25 GLN 25 17 17 GLN GLN M . n M 1 26 GLN 26 18 18 GLN GLN M . n M 1 27 HIS 27 19 19 HIS HIS M . n M 1 28 LEU 28 20 20 LEU LEU M . n M 1 29 LEU 29 21 21 LEU LEU M . n M 1 30 GLN 30 22 22 GLN GLN M . n M 1 31 LEU 31 23 23 LEU LEU M . n M 1 32 THR 32 24 24 THR THR M . n M 1 33 VAL 33 25 25 VAL VAL M . n M 1 34 TRP 34 26 26 TRP TRP M . n M 1 35 GLY 35 27 27 GLY GLY M . n M 1 36 ILE 36 28 28 ILE ILE M . n M 1 37 LYS 37 29 29 LYS LYS M . n M 1 38 GLN 38 30 30 GLN GLN M . n M 1 39 LEU 39 31 31 LEU LEU M . n M 1 40 GLN 40 32 32 GLN GLN M . n M 1 41 ALA 41 33 33 ALA ALA M . n M 1 42 ARG 42 34 34 ARG ARG M . n M 1 43 ILE 43 35 35 ILE ILE M . n M 1 44 LEU 44 36 36 LEU LEU M . n M 1 45 GLU 45 37 ? ? ? M . n M 1 46 LEU 46 38 ? ? ? M . n M 1 47 THR 47 39 ? ? ? M . n M 1 48 TRP 48 40 ? ? ? M . n M 1 49 GLU 49 41 ? ? ? M . n M 1 50 GLU 50 42 ? ? ? M . n M 1 51 TRP 51 43 ? ? ? M . n M 1 52 GLU 52 44 ? ? ? M . n M 1 53 LYS 53 45 ? ? ? M . n M 1 54 LYS 54 46 ? ? ? M . n M 1 55 ILE 55 47 ? ? ? M . n M 1 56 GLU 56 48 ? ? ? M . n M 1 57 GLU 57 49 ? ? ? M . n M 1 58 TYR 58 50 ? ? ? M . n M 1 59 THR 59 51 ? ? ? M . n M 1 60 LYS 60 52 ? ? ? M . n M 1 61 LYS 61 53 ? ? ? M . n M 1 62 ILE 62 54 ? ? ? M . n M 1 63 GLU 63 55 ? ? ? M . n M 1 64 GLU 64 56 ? ? ? M . n M 1 65 ILE 65 57 ? ? ? M . n M 1 66 LEU 66 58 ? ? ? M . n M 1 67 LYS 67 59 ? ? ? M . n N 3 1 GLU 1 47 47 GLU GLU P . n N 3 2 LEU 2 48 48 LEU LEU P . n N 3 3 THR 3 49 49 THR THR P . n N 3 4 TRP 4 50 50 TRP TRP P . n N 3 5 GLU 5 51 51 GLU GLU P . n N 3 6 GLU 6 52 52 GLU GLU P . n N 3 7 TRP 7 53 53 TRP TRP P . n N 3 8 GLU 8 54 54 GLU GLU P . n N 3 9 LYS 9 55 55 LYS LYS P . n N 3 10 LYS 10 56 56 LYS LYS P . n N 3 11 ILE 11 57 57 ILE ILE P . n N 3 12 GLU 12 58 58 GLU GLU P . n N 3 13 GLU 13 59 59 GLU GLU P . n N 3 14 TYR 14 60 60 TYR TYR P . n N 3 15 THR 15 61 61 THR THR P . n N 3 16 LYS 16 62 62 LYS LYS P . n N 3 17 LYS 17 63 63 LYS LYS P . n N 3 18 ILE 18 64 64 ILE ILE P . n N 3 19 GLU 19 65 65 GLU GLU P . n N 3 20 GLU 20 66 66 GLU GLU P . n N 3 21 ILE 21 67 67 ILE ILE P . n N 3 22 LEU 22 68 68 LEU LEU P . n N 3 23 LYS 23 69 69 LYS LYS P . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1-2155-000 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? V1.0 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? V1.0 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 7.0 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5YB2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 110.884 _cell.length_a_esd ? _cell.length_b 110.884 _cell.length_b_esd ? _cell.length_c 125.382 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 63 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YB2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YB2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.08 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES pH 7.5, 2.0 M Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9796 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9796 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5YB2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.8 _reflns.d_resolution_low 27.72 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5647 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YB2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.800 _refine.ls_d_res_low 27.72 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5647 _refine.ls_number_reflns_R_free 252 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2841 _refine.ls_R_factor_R_free 0.3068 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2830 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3495 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3495 _refine_hist.d_res_high 3.800 _refine_hist.d_res_low 27.72 # _refine_ls_shell.R_factor_R_free 0.3879 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3231 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.d_res_high 3.8002 _refine_ls_shell.d_res_low 4.7846 _refine_ls_shell.number_reflns_R_free 99 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? # _struct.entry_id 5YB2 _struct.title 'Crystal structure of LP-11/N44' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YB2 _struct_keywords.text '6-HB, HIV-1, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 1 ? H N N 1 ? I N N 2 ? J N N 3 ? K N N 3 ? L N N 3 ? M N N 1 ? N N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q1HMR5_9HIV1 Q1HMR5 ? 1 TVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL 27 2 UNP Q1HMR5_9HIV1 Q1HMR5 ? 2 TVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL 27 3 PDB 5YB2 5YB2 ? 3 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5YB2 E 1 ? 44 ? Q1HMR5 27 ? 70 ? -7 36 2 1 5YB2 D 1 ? 44 ? Q1HMR5 27 ? 70 ? -7 36 3 2 5YB2 F 1 ? 44 ? Q1HMR5 27 ? 70 ? -7 36 4 3 5YB2 H 1 ? 23 ? 5YB2 47 ? 69 ? 47 69 5 3 5YB2 G 1 ? 23 ? 5YB2 47 ? 69 ? 47 69 6 3 5YB2 I 1 ? 23 ? 5YB2 47 ? 69 ? 47 69 7 1 5YB2 B 1 ? 44 ? Q1HMR5 27 ? 70 ? -7 36 8 1 5YB2 A 1 ? 44 ? Q1HMR5 27 ? 70 ? -7 36 9 2 5YB2 C 1 ? 44 ? Q1HMR5 27 ? 70 ? -7 36 10 3 5YB2 K 1 ? 23 ? 5YB2 47 ? 69 ? 47 69 11 3 5YB2 J 1 ? 23 ? 5YB2 47 ? 69 ? 47 69 12 3 5YB2 L 1 ? 23 ? 5YB2 47 ? 69 ? 47 69 13 1 5YB2 M 1 ? 44 ? Q1HMR5 27 ? 70 ? -7 36 14 3 5YB2 P 1 ? 23 ? 5YB2 47 ? 69 ? 47 69 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5YB2 GLU E 45 ? UNP Q1HMR5 ? ? 'expression tag' 37 1 1 5YB2 LEU E 46 ? UNP Q1HMR5 ? ? 'expression tag' 38 2 1 5YB2 THR E 47 ? UNP Q1HMR5 ? ? 'expression tag' 39 3 1 5YB2 TRP E 48 ? UNP Q1HMR5 ? ? 'expression tag' 40 4 1 5YB2 GLU E 49 ? UNP Q1HMR5 ? ? 'expression tag' 41 5 1 5YB2 GLU E 50 ? UNP Q1HMR5 ? ? 'expression tag' 42 6 1 5YB2 TRP E 51 ? UNP Q1HMR5 ? ? 'expression tag' 43 7 1 5YB2 GLU E 52 ? UNP Q1HMR5 ? ? 'expression tag' 44 8 1 5YB2 LYS E 53 ? UNP Q1HMR5 ? ? 'expression tag' 45 9 1 5YB2 LYS E 54 ? UNP Q1HMR5 ? ? 'expression tag' 46 10 1 5YB2 ILE E 55 ? UNP Q1HMR5 ? ? 'expression tag' 47 11 1 5YB2 GLU E 56 ? UNP Q1HMR5 ? ? 'expression tag' 48 12 1 5YB2 GLU E 57 ? UNP Q1HMR5 ? ? 'expression tag' 49 13 1 5YB2 TYR E 58 ? UNP Q1HMR5 ? ? 'expression tag' 50 14 1 5YB2 THR E 59 ? UNP Q1HMR5 ? ? 'expression tag' 51 15 1 5YB2 LYS E 60 ? UNP Q1HMR5 ? ? 'expression tag' 52 16 1 5YB2 LYS E 61 ? UNP Q1HMR5 ? ? 'expression tag' 53 17 1 5YB2 ILE E 62 ? UNP Q1HMR5 ? ? 'expression tag' 54 18 1 5YB2 GLU E 63 ? UNP Q1HMR5 ? ? 'expression tag' 55 19 1 5YB2 GLU E 64 ? UNP Q1HMR5 ? ? 'expression tag' 56 20 1 5YB2 ILE E 65 ? UNP Q1HMR5 ? ? 'expression tag' 57 21 1 5YB2 LEU E 66 ? UNP Q1HMR5 ? ? 'expression tag' 58 22 1 5YB2 LYS E 67 ? UNP Q1HMR5 ? ? 'expression tag' 59 23 2 5YB2 GLU D 45 ? UNP Q1HMR5 ? ? 'expression tag' 37 24 2 5YB2 LEU D 46 ? UNP Q1HMR5 ? ? 'expression tag' 38 25 2 5YB2 THR D 47 ? UNP Q1HMR5 ? ? 'expression tag' 39 26 2 5YB2 TRP D 48 ? UNP Q1HMR5 ? ? 'expression tag' 40 27 2 5YB2 GLU D 49 ? UNP Q1HMR5 ? ? 'expression tag' 41 28 2 5YB2 GLU D 50 ? UNP Q1HMR5 ? ? 'expression tag' 42 29 2 5YB2 TRP D 51 ? UNP Q1HMR5 ? ? 'expression tag' 43 30 2 5YB2 GLU D 52 ? UNP Q1HMR5 ? ? 'expression tag' 44 31 2 5YB2 LYS D 53 ? UNP Q1HMR5 ? ? 'expression tag' 45 32 2 5YB2 LYS D 54 ? UNP Q1HMR5 ? ? 'expression tag' 46 33 2 5YB2 ILE D 55 ? UNP Q1HMR5 ? ? 'expression tag' 47 34 2 5YB2 GLU D 56 ? UNP Q1HMR5 ? ? 'expression tag' 48 35 2 5YB2 GLU D 57 ? UNP Q1HMR5 ? ? 'expression tag' 49 36 2 5YB2 TYR D 58 ? UNP Q1HMR5 ? ? 'expression tag' 50 37 2 5YB2 THR D 59 ? UNP Q1HMR5 ? ? 'expression tag' 51 38 2 5YB2 LYS D 60 ? UNP Q1HMR5 ? ? 'expression tag' 52 39 2 5YB2 LYS D 61 ? UNP Q1HMR5 ? ? 'expression tag' 53 40 2 5YB2 ILE D 62 ? UNP Q1HMR5 ? ? 'expression tag' 54 41 2 5YB2 GLU D 63 ? UNP Q1HMR5 ? ? 'expression tag' 55 42 2 5YB2 GLU D 64 ? UNP Q1HMR5 ? ? 'expression tag' 56 43 2 5YB2 ILE D 65 ? UNP Q1HMR5 ? ? 'expression tag' 57 44 2 5YB2 LEU D 66 ? UNP Q1HMR5 ? ? 'expression tag' 58 45 2 5YB2 LYS D 67 ? UNP Q1HMR5 ? ? 'expression tag' 59 46 7 5YB2 GLU B 45 ? UNP Q1HMR5 ? ? 'expression tag' 37 47 7 5YB2 LEU B 46 ? UNP Q1HMR5 ? ? 'expression tag' 38 48 7 5YB2 THR B 47 ? UNP Q1HMR5 ? ? 'expression tag' 39 49 7 5YB2 TRP B 48 ? UNP Q1HMR5 ? ? 'expression tag' 40 50 7 5YB2 GLU B 49 ? UNP Q1HMR5 ? ? 'expression tag' 41 51 7 5YB2 GLU B 50 ? UNP Q1HMR5 ? ? 'expression tag' 42 52 7 5YB2 TRP B 51 ? UNP Q1HMR5 ? ? 'expression tag' 43 53 7 5YB2 GLU B 52 ? UNP Q1HMR5 ? ? 'expression tag' 44 54 7 5YB2 LYS B 53 ? UNP Q1HMR5 ? ? 'expression tag' 45 55 7 5YB2 LYS B 54 ? UNP Q1HMR5 ? ? 'expression tag' 46 56 7 5YB2 ILE B 55 ? UNP Q1HMR5 ? ? 'expression tag' 47 57 7 5YB2 GLU B 56 ? UNP Q1HMR5 ? ? 'expression tag' 48 58 7 5YB2 GLU B 57 ? UNP Q1HMR5 ? ? 'expression tag' 49 59 7 5YB2 TYR B 58 ? UNP Q1HMR5 ? ? 'expression tag' 50 60 7 5YB2 THR B 59 ? UNP Q1HMR5 ? ? 'expression tag' 51 61 7 5YB2 LYS B 60 ? UNP Q1HMR5 ? ? 'expression tag' 52 62 7 5YB2 LYS B 61 ? UNP Q1HMR5 ? ? 'expression tag' 53 63 7 5YB2 ILE B 62 ? UNP Q1HMR5 ? ? 'expression tag' 54 64 7 5YB2 GLU B 63 ? UNP Q1HMR5 ? ? 'expression tag' 55 65 7 5YB2 GLU B 64 ? UNP Q1HMR5 ? ? 'expression tag' 56 66 7 5YB2 ILE B 65 ? UNP Q1HMR5 ? ? 'expression tag' 57 67 7 5YB2 LEU B 66 ? UNP Q1HMR5 ? ? 'expression tag' 58 68 7 5YB2 LYS B 67 ? UNP Q1HMR5 ? ? 'expression tag' 59 69 8 5YB2 GLU A 45 ? UNP Q1HMR5 ? ? 'expression tag' 37 70 8 5YB2 LEU A 46 ? UNP Q1HMR5 ? ? 'expression tag' 38 71 8 5YB2 THR A 47 ? UNP Q1HMR5 ? ? 'expression tag' 39 72 8 5YB2 TRP A 48 ? UNP Q1HMR5 ? ? 'expression tag' 40 73 8 5YB2 GLU A 49 ? UNP Q1HMR5 ? ? 'expression tag' 41 74 8 5YB2 GLU A 50 ? UNP Q1HMR5 ? ? 'expression tag' 42 75 8 5YB2 TRP A 51 ? UNP Q1HMR5 ? ? 'expression tag' 43 76 8 5YB2 GLU A 52 ? UNP Q1HMR5 ? ? 'expression tag' 44 77 8 5YB2 LYS A 53 ? UNP Q1HMR5 ? ? 'expression tag' 45 78 8 5YB2 LYS A 54 ? UNP Q1HMR5 ? ? 'expression tag' 46 79 8 5YB2 ILE A 55 ? UNP Q1HMR5 ? ? 'expression tag' 47 80 8 5YB2 GLU A 56 ? UNP Q1HMR5 ? ? 'expression tag' 48 81 8 5YB2 GLU A 57 ? UNP Q1HMR5 ? ? 'expression tag' 49 82 8 5YB2 TYR A 58 ? UNP Q1HMR5 ? ? 'expression tag' 50 83 8 5YB2 THR A 59 ? UNP Q1HMR5 ? ? 'expression tag' 51 84 8 5YB2 LYS A 60 ? UNP Q1HMR5 ? ? 'expression tag' 52 85 8 5YB2 LYS A 61 ? UNP Q1HMR5 ? ? 'expression tag' 53 86 8 5YB2 ILE A 62 ? UNP Q1HMR5 ? ? 'expression tag' 54 87 8 5YB2 GLU A 63 ? UNP Q1HMR5 ? ? 'expression tag' 55 88 8 5YB2 GLU A 64 ? UNP Q1HMR5 ? ? 'expression tag' 56 89 8 5YB2 ILE A 65 ? UNP Q1HMR5 ? ? 'expression tag' 57 90 8 5YB2 LEU A 66 ? UNP Q1HMR5 ? ? 'expression tag' 58 91 8 5YB2 LYS A 67 ? UNP Q1HMR5 ? ? 'expression tag' 59 92 13 5YB2 GLU M 45 ? UNP Q1HMR5 ? ? 'expression tag' 37 93 13 5YB2 LEU M 46 ? UNP Q1HMR5 ? ? 'expression tag' 38 94 13 5YB2 THR M 47 ? UNP Q1HMR5 ? ? 'expression tag' 39 95 13 5YB2 TRP M 48 ? UNP Q1HMR5 ? ? 'expression tag' 40 96 13 5YB2 GLU M 49 ? UNP Q1HMR5 ? ? 'expression tag' 41 97 13 5YB2 GLU M 50 ? UNP Q1HMR5 ? ? 'expression tag' 42 98 13 5YB2 TRP M 51 ? UNP Q1HMR5 ? ? 'expression tag' 43 99 13 5YB2 GLU M 52 ? UNP Q1HMR5 ? ? 'expression tag' 44 100 13 5YB2 LYS M 53 ? UNP Q1HMR5 ? ? 'expression tag' 45 101 13 5YB2 LYS M 54 ? UNP Q1HMR5 ? ? 'expression tag' 46 102 13 5YB2 ILE M 55 ? UNP Q1HMR5 ? ? 'expression tag' 47 103 13 5YB2 GLU M 56 ? UNP Q1HMR5 ? ? 'expression tag' 48 104 13 5YB2 GLU M 57 ? UNP Q1HMR5 ? ? 'expression tag' 49 105 13 5YB2 TYR M 58 ? UNP Q1HMR5 ? ? 'expression tag' 50 106 13 5YB2 THR M 59 ? UNP Q1HMR5 ? ? 'expression tag' 51 107 13 5YB2 LYS M 60 ? UNP Q1HMR5 ? ? 'expression tag' 52 108 13 5YB2 LYS M 61 ? UNP Q1HMR5 ? ? 'expression tag' 53 109 13 5YB2 ILE M 62 ? UNP Q1HMR5 ? ? 'expression tag' 54 110 13 5YB2 GLU M 63 ? UNP Q1HMR5 ? ? 'expression tag' 55 111 13 5YB2 GLU M 64 ? UNP Q1HMR5 ? ? 'expression tag' 56 112 13 5YB2 ILE M 65 ? UNP Q1HMR5 ? ? 'expression tag' 57 113 13 5YB2 LEU M 66 ? UNP Q1HMR5 ? ? 'expression tag' 58 114 13 5YB2 LYS M 67 ? UNP Q1HMR5 ? ? 'expression tag' 59 115 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA hexameric 6 2 author_and_software_defined_assembly PISA hexameric 6 3 author_and_software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9290 ? 1 MORE -93 ? 1 'SSA (A^2)' 9720 ? 2 'ABSA (A^2)' 9300 ? 2 MORE -93 ? 2 'SSA (A^2)' 9560 ? 3 'ABSA (A^2)' 9460 ? 3 MORE -95 ? 3 'SSA (A^2)' 9510 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1 G,H,I,J,K,L 3 1,2,3 M,N # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 55.4420000000 0.8660254038 -0.5000000000 0.0000000000 96.0283608732 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -55.4420000000 -0.8660254038 -0.5000000000 0.0000000000 96.0283608732 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 10 ? ARG A 42 ? GLY E 2 ARG E 34 1 ? 33 HELX_P HELX_P2 AA2 GLY B 10 ? LEU B 44 ? GLY D 2 LEU D 36 1 ? 35 HELX_P HELX_P3 AA3 ILE C 11 ? ARG C 42 ? ILE F 3 ARG F 34 1 ? 32 HELX_P HELX_P4 AA4 THR D 3 ? LEU D 22 ? THR H 49 LEU H 68 1 ? 20 HELX_P HELX_P5 AA5 THR E 3 ? LEU E 22 ? THR G 49 LEU G 68 1 ? 20 HELX_P HELX_P6 AA6 THR F 3 ? LEU F 22 ? THR I 49 LEU I 68 1 ? 20 HELX_P HELX_P7 AA7 GLY G 10 ? ARG G 42 ? GLY B 2 ARG B 34 1 ? 33 HELX_P HELX_P8 AA8 GLY H 10 ? ARG H 42 ? GLY A 2 ARG A 34 1 ? 33 HELX_P HELX_P9 AA9 ILE I 11 ? ARG I 42 ? ILE C 3 ARG C 34 1 ? 32 HELX_P HELX_P10 AB1 THR J 3 ? LEU J 22 ? THR K 49 LEU K 68 1 ? 20 HELX_P HELX_P11 AB2 THR K 3 ? LYS K 23 ? THR J 49 LYS J 69 1 ? 21 HELX_P HELX_P12 AB3 THR L 3 ? LYS L 23 ? THR L 49 LYS L 69 1 ? 21 HELX_P HELX_P13 AB4 GLY M 10 ? ARG M 42 ? GLY M 2 ARG M 34 1 ? 33 HELX_P HELX_P14 AB5 THR N 3 ? LYS N 23 ? THR P 49 LYS P 69 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NZ _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 29 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE2 _pdbx_validate_close_contact.auth_asym_id_2 K _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 54 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.03 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG D GLU 15 ? ? CD D GLU 15 ? ? 1.621 1.515 0.106 0.015 N 2 1 CG F GLU 15 ? ? CD F GLU 15 ? ? 1.631 1.515 0.116 0.015 N 3 1 CG I GLU 47 ? ? CD I GLU 47 ? ? 1.357 1.515 -0.158 0.015 N 4 1 C M SER 1 ? ? N M GLY 2 ? ? 1.482 1.336 0.146 0.023 Y 5 1 CB P GLU 54 ? ? CG P GLU 54 ? ? 1.643 1.517 0.126 0.019 N 6 1 CG P GLU 54 ? ? CD P GLU 54 ? ? 1.609 1.515 0.094 0.015 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB D LEU 21 ? ? CG D LEU 21 ? ? CD1 D LEU 21 ? ? 98.42 111.00 -12.58 1.70 N 2 1 CA D LEU 36 ? ? CB D LEU 36 ? ? CG D LEU 36 ? ? 134.56 115.30 19.26 2.30 N 3 1 OE1 I GLU 47 ? ? CD I GLU 47 ? ? OE2 I GLU 47 ? ? 132.19 123.30 8.89 1.20 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE D 35 ? ? -53.32 -72.02 2 1 GLU P 58 ? ? -45.42 -78.98 3 1 THR P 61 ? ? -39.26 -28.34 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 SER E 1 ? ? GLY E 2 ? ? -129.37 2 1 GLU I 47 ? ? LEU I 48 ? ? -150.00 3 1 SER B 1 ? ? GLY B 2 ? ? -128.51 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -28.4142 _pdbx_refine_tls.origin_y 72.9693 _pdbx_refine_tls.origin_z 7.0774 _pdbx_refine_tls.T[1][1] 1.3569 _pdbx_refine_tls.T[2][2] 1.2773 _pdbx_refine_tls.T[3][3] 1.1955 _pdbx_refine_tls.T[1][2] -0.0193 _pdbx_refine_tls.T[1][3] 0.0648 _pdbx_refine_tls.T[2][3] -0.0324 _pdbx_refine_tls.L[1][1] 1.9287 _pdbx_refine_tls.L[2][2] 2.0145 _pdbx_refine_tls.L[3][3] 1.3725 _pdbx_refine_tls.L[1][2] -0.6054 _pdbx_refine_tls.L[1][3] 0.4838 _pdbx_refine_tls.L[2][3] 0.1244 _pdbx_refine_tls.S[1][1] 0.0827 _pdbx_refine_tls.S[1][2] -0.0488 _pdbx_refine_tls.S[1][3] -0.0474 _pdbx_refine_tls.S[2][1] 0.1322 _pdbx_refine_tls.S[2][2] -0.2432 _pdbx_refine_tls.S[2][3] 0.2232 _pdbx_refine_tls.S[3][1] -0.2695 _pdbx_refine_tls.S[3][2] -0.3073 _pdbx_refine_tls.S[3][3] 0.0001 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 E THR -7 ? A THR 1 2 1 Y 1 E VAL -6 ? A VAL 2 3 1 Y 1 E GLN -5 ? A GLN 3 4 1 Y 1 E ALA -4 ? A ALA 4 5 1 Y 1 E ARG -3 ? A ARG 5 6 1 Y 1 E GLN -2 ? A GLN 6 7 1 Y 1 E LEU -1 ? A LEU 7 8 1 Y 1 E LEU 0 ? A LEU 8 9 1 Y 1 E GLU 37 ? A GLU 45 10 1 Y 1 E LEU 38 ? A LEU 46 11 1 Y 1 E THR 39 ? A THR 47 12 1 Y 1 E TRP 40 ? A TRP 48 13 1 Y 1 E GLU 41 ? A GLU 49 14 1 Y 1 E GLU 42 ? A GLU 50 15 1 Y 1 E TRP 43 ? A TRP 51 16 1 Y 1 E GLU 44 ? A GLU 52 17 1 Y 1 E LYS 45 ? A LYS 53 18 1 Y 1 E LYS 46 ? A LYS 54 19 1 Y 1 E ILE 47 ? A ILE 55 20 1 Y 1 E GLU 48 ? A GLU 56 21 1 Y 1 E GLU 49 ? A GLU 57 22 1 Y 1 E TYR 50 ? A TYR 58 23 1 Y 1 E THR 51 ? A THR 59 24 1 Y 1 E LYS 52 ? A LYS 60 25 1 Y 1 E LYS 53 ? A LYS 61 26 1 Y 1 E ILE 54 ? A ILE 62 27 1 Y 1 E GLU 55 ? A GLU 63 28 1 Y 1 E GLU 56 ? A GLU 64 29 1 Y 1 E ILE 57 ? A ILE 65 30 1 Y 1 E LEU 58 ? A LEU 66 31 1 Y 1 E LYS 59 ? A LYS 67 32 1 Y 1 D THR -7 ? B THR 1 33 1 Y 1 D VAL -6 ? B VAL 2 34 1 Y 1 D GLN -5 ? B GLN 3 35 1 Y 1 D ALA -4 ? B ALA 4 36 1 Y 1 D ARG -3 ? B ARG 5 37 1 Y 1 D GLN -2 ? B GLN 6 38 1 Y 1 D LEU -1 ? B LEU 7 39 1 Y 1 D LEU 0 ? B LEU 8 40 1 Y 1 D GLU 37 ? B GLU 45 41 1 Y 1 D LEU 38 ? B LEU 46 42 1 Y 1 D THR 39 ? B THR 47 43 1 Y 1 D TRP 40 ? B TRP 48 44 1 Y 1 D GLU 41 ? B GLU 49 45 1 Y 1 D GLU 42 ? B GLU 50 46 1 Y 1 D TRP 43 ? B TRP 51 47 1 Y 1 D GLU 44 ? B GLU 52 48 1 Y 1 D LYS 45 ? B LYS 53 49 1 Y 1 D LYS 46 ? B LYS 54 50 1 Y 1 D ILE 47 ? B ILE 55 51 1 Y 1 D GLU 48 ? B GLU 56 52 1 Y 1 D GLU 49 ? B GLU 57 53 1 Y 1 D TYR 50 ? B TYR 58 54 1 Y 1 D THR 51 ? B THR 59 55 1 Y 1 D LYS 52 ? B LYS 60 56 1 Y 1 D LYS 53 ? B LYS 61 57 1 Y 1 D ILE 54 ? B ILE 62 58 1 Y 1 D GLU 55 ? B GLU 63 59 1 Y 1 D GLU 56 ? B GLU 64 60 1 Y 1 D ILE 57 ? B ILE 65 61 1 Y 1 D LEU 58 ? B LEU 66 62 1 Y 1 D LYS 59 ? B LYS 67 63 1 Y 1 F THR -7 ? C THR 1 64 1 Y 1 F VAL -6 ? C VAL 2 65 1 Y 1 F GLN -5 ? C GLN 3 66 1 Y 1 F ALA -4 ? C ALA 4 67 1 Y 1 F ARG -3 ? C ARG 5 68 1 Y 1 F GLN -2 ? C GLN 6 69 1 Y 1 F LEU -1 ? C LEU 7 70 1 Y 1 F LEU 0 ? C LEU 8 71 1 Y 1 F SER 1 ? C SER 9 72 1 Y 1 B THR -7 ? G THR 1 73 1 Y 1 B VAL -6 ? G VAL 2 74 1 Y 1 B GLN -5 ? G GLN 3 75 1 Y 1 B ALA -4 ? G ALA 4 76 1 Y 1 B ARG -3 ? G ARG 5 77 1 Y 1 B GLN -2 ? G GLN 6 78 1 Y 1 B LEU -1 ? G LEU 7 79 1 Y 1 B LEU 0 ? G LEU 8 80 1 Y 1 B GLU 37 ? G GLU 45 81 1 Y 1 B LEU 38 ? G LEU 46 82 1 Y 1 B THR 39 ? G THR 47 83 1 Y 1 B TRP 40 ? G TRP 48 84 1 Y 1 B GLU 41 ? G GLU 49 85 1 Y 1 B GLU 42 ? G GLU 50 86 1 Y 1 B TRP 43 ? G TRP 51 87 1 Y 1 B GLU 44 ? G GLU 52 88 1 Y 1 B LYS 45 ? G LYS 53 89 1 Y 1 B LYS 46 ? G LYS 54 90 1 Y 1 B ILE 47 ? G ILE 55 91 1 Y 1 B GLU 48 ? G GLU 56 92 1 Y 1 B GLU 49 ? G GLU 57 93 1 Y 1 B TYR 50 ? G TYR 58 94 1 Y 1 B THR 51 ? G THR 59 95 1 Y 1 B LYS 52 ? G LYS 60 96 1 Y 1 B LYS 53 ? G LYS 61 97 1 Y 1 B ILE 54 ? G ILE 62 98 1 Y 1 B GLU 55 ? G GLU 63 99 1 Y 1 B GLU 56 ? G GLU 64 100 1 Y 1 B ILE 57 ? G ILE 65 101 1 Y 1 B LEU 58 ? G LEU 66 102 1 Y 1 B LYS 59 ? G LYS 67 103 1 Y 1 A THR -7 ? H THR 1 104 1 Y 1 A VAL -6 ? H VAL 2 105 1 Y 1 A GLN -5 ? H GLN 3 106 1 Y 1 A ALA -4 ? H ALA 4 107 1 Y 1 A ARG -3 ? H ARG 5 108 1 Y 1 A GLN -2 ? H GLN 6 109 1 Y 1 A LEU -1 ? H LEU 7 110 1 Y 1 A LEU 0 ? H LEU 8 111 1 Y 1 A GLU 37 ? H GLU 45 112 1 Y 1 A LEU 38 ? H LEU 46 113 1 Y 1 A THR 39 ? H THR 47 114 1 Y 1 A TRP 40 ? H TRP 48 115 1 Y 1 A GLU 41 ? H GLU 49 116 1 Y 1 A GLU 42 ? H GLU 50 117 1 Y 1 A TRP 43 ? H TRP 51 118 1 Y 1 A GLU 44 ? H GLU 52 119 1 Y 1 A LYS 45 ? H LYS 53 120 1 Y 1 A LYS 46 ? H LYS 54 121 1 Y 1 A ILE 47 ? H ILE 55 122 1 Y 1 A GLU 48 ? H GLU 56 123 1 Y 1 A GLU 49 ? H GLU 57 124 1 Y 1 A TYR 50 ? H TYR 58 125 1 Y 1 A THR 51 ? H THR 59 126 1 Y 1 A LYS 52 ? H LYS 60 127 1 Y 1 A LYS 53 ? H LYS 61 128 1 Y 1 A ILE 54 ? H ILE 62 129 1 Y 1 A GLU 55 ? H GLU 63 130 1 Y 1 A GLU 56 ? H GLU 64 131 1 Y 1 A ILE 57 ? H ILE 65 132 1 Y 1 A LEU 58 ? H LEU 66 133 1 Y 1 A LYS 59 ? H LYS 67 134 1 Y 1 C THR -7 ? I THR 1 135 1 Y 1 C VAL -6 ? I VAL 2 136 1 Y 1 C GLN -5 ? I GLN 3 137 1 Y 1 C ALA -4 ? I ALA 4 138 1 Y 1 C ARG -3 ? I ARG 5 139 1 Y 1 C GLN -2 ? I GLN 6 140 1 Y 1 C LEU -1 ? I LEU 7 141 1 Y 1 C LEU 0 ? I LEU 8 142 1 Y 1 C SER 1 ? I SER 9 143 1 Y 1 M THR -7 ? M THR 1 144 1 Y 1 M VAL -6 ? M VAL 2 145 1 Y 1 M GLN -5 ? M GLN 3 146 1 Y 1 M ALA -4 ? M ALA 4 147 1 Y 1 M ARG -3 ? M ARG 5 148 1 Y 1 M GLN -2 ? M GLN 6 149 1 Y 1 M LEU -1 ? M LEU 7 150 1 Y 1 M LEU 0 ? M LEU 8 151 1 Y 1 M GLU 37 ? M GLU 45 152 1 Y 1 M LEU 38 ? M LEU 46 153 1 Y 1 M THR 39 ? M THR 47 154 1 Y 1 M TRP 40 ? M TRP 48 155 1 Y 1 M GLU 41 ? M GLU 49 156 1 Y 1 M GLU 42 ? M GLU 50 157 1 Y 1 M TRP 43 ? M TRP 51 158 1 Y 1 M GLU 44 ? M GLU 52 159 1 Y 1 M LYS 45 ? M LYS 53 160 1 Y 1 M LYS 46 ? M LYS 54 161 1 Y 1 M ILE 47 ? M ILE 55 162 1 Y 1 M GLU 48 ? M GLU 56 163 1 Y 1 M GLU 49 ? M GLU 57 164 1 Y 1 M TYR 50 ? M TYR 58 165 1 Y 1 M THR 51 ? M THR 59 166 1 Y 1 M LYS 52 ? M LYS 60 167 1 Y 1 M LYS 53 ? M LYS 61 168 1 Y 1 M ILE 54 ? M ILE 62 169 1 Y 1 M GLU 55 ? M GLU 63 170 1 Y 1 M GLU 56 ? M GLU 64 171 1 Y 1 M ILE 57 ? M ILE 65 172 1 Y 1 M LEU 58 ? M LEU 66 173 1 Y 1 M LYS 59 ? M LYS 67 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 HIS N N N N 107 HIS CA C N S 108 HIS C C N N 109 HIS O O N N 110 HIS CB C N N 111 HIS CG C Y N 112 HIS ND1 N Y N 113 HIS CD2 C Y N 114 HIS CE1 C Y N 115 HIS NE2 N Y N 116 HIS OXT O N N 117 HIS H H N N 118 HIS H2 H N N 119 HIS HA H N N 120 HIS HB2 H N N 121 HIS HB3 H N N 122 HIS HD1 H N N 123 HIS HD2 H N N 124 HIS HE1 H N N 125 HIS HE2 H N N 126 HIS HXT H N N 127 ILE N N N N 128 ILE CA C N S 129 ILE C C N N 130 ILE O O N N 131 ILE CB C N S 132 ILE CG1 C N N 133 ILE CG2 C N N 134 ILE CD1 C N N 135 ILE OXT O N N 136 ILE H H N N 137 ILE H2 H N N 138 ILE HA H N N 139 ILE HB H N N 140 ILE HG12 H N N 141 ILE HG13 H N N 142 ILE HG21 H N N 143 ILE HG22 H N N 144 ILE HG23 H N N 145 ILE HD11 H N N 146 ILE HD12 H N N 147 ILE HD13 H N N 148 ILE HXT H N N 149 LEU N N N N 150 LEU CA C N S 151 LEU C C N N 152 LEU O O N N 153 LEU CB C N N 154 LEU CG C N N 155 LEU CD1 C N N 156 LEU CD2 C N N 157 LEU OXT O N N 158 LEU H H N N 159 LEU H2 H N N 160 LEU HA H N N 161 LEU HB2 H N N 162 LEU HB3 H N N 163 LEU HG H N N 164 LEU HD11 H N N 165 LEU HD12 H N N 166 LEU HD13 H N N 167 LEU HD21 H N N 168 LEU HD22 H N N 169 LEU HD23 H N N 170 LEU HXT H N N 171 LYS N N N N 172 LYS CA C N S 173 LYS C C N N 174 LYS O O N N 175 LYS CB C N N 176 LYS CG C N N 177 LYS CD C N N 178 LYS CE C N N 179 LYS NZ N N N 180 LYS OXT O N N 181 LYS H H N N 182 LYS H2 H N N 183 LYS HA H N N 184 LYS HB2 H N N 185 LYS HB3 H N N 186 LYS HG2 H N N 187 LYS HG3 H N N 188 LYS HD2 H N N 189 LYS HD3 H N N 190 LYS HE2 H N N 191 LYS HE3 H N N 192 LYS HZ1 H N N 193 LYS HZ2 H N N 194 LYS HZ3 H N N 195 LYS HXT H N N 196 SER N N N N 197 SER CA C N S 198 SER C C N N 199 SER O O N N 200 SER CB C N N 201 SER OG O N N 202 SER OXT O N N 203 SER H H N N 204 SER H2 H N N 205 SER HA H N N 206 SER HB2 H N N 207 SER HB3 H N N 208 SER HG H N N 209 SER HXT H N N 210 THR N N N N 211 THR CA C N S 212 THR C C N N 213 THR O O N N 214 THR CB C N R 215 THR OG1 O N N 216 THR CG2 C N N 217 THR OXT O N N 218 THR H H N N 219 THR H2 H N N 220 THR HA H N N 221 THR HB H N N 222 THR HG1 H N N 223 THR HG21 H N N 224 THR HG22 H N N 225 THR HG23 H N N 226 THR HXT H N N 227 TRP N N N N 228 TRP CA C N S 229 TRP C C N N 230 TRP O O N N 231 TRP CB C N N 232 TRP CG C Y N 233 TRP CD1 C Y N 234 TRP CD2 C Y N 235 TRP NE1 N Y N 236 TRP CE2 C Y N 237 TRP CE3 C Y N 238 TRP CZ2 C Y N 239 TRP CZ3 C Y N 240 TRP CH2 C Y N 241 TRP OXT O N N 242 TRP H H N N 243 TRP H2 H N N 244 TRP HA H N N 245 TRP HB2 H N N 246 TRP HB3 H N N 247 TRP HD1 H N N 248 TRP HE1 H N N 249 TRP HE3 H N N 250 TRP HZ2 H N N 251 TRP HZ3 H N N 252 TRP HH2 H N N 253 TRP HXT H N N 254 TYR N N N N 255 TYR CA C N S 256 TYR C C N N 257 TYR O O N N 258 TYR CB C N N 259 TYR CG C Y N 260 TYR CD1 C Y N 261 TYR CD2 C Y N 262 TYR CE1 C Y N 263 TYR CE2 C Y N 264 TYR CZ C Y N 265 TYR OH O N N 266 TYR OXT O N N 267 TYR H H N N 268 TYR H2 H N N 269 TYR HA H N N 270 TYR HB2 H N N 271 TYR HB3 H N N 272 TYR HD1 H N N 273 TYR HD2 H N N 274 TYR HE1 H N N 275 TYR HE2 H N N 276 TYR HH H N N 277 TYR HXT H N N 278 VAL N N N N 279 VAL CA C N S 280 VAL C C N N 281 VAL O O N N 282 VAL CB C N N 283 VAL CG1 C N N 284 VAL CG2 C N N 285 VAL OXT O N N 286 VAL H H N N 287 VAL H2 H N N 288 VAL HA H N N 289 VAL HB H N N 290 VAL HG11 H N N 291 VAL HG12 H N N 292 VAL HG13 H N N 293 VAL HG21 H N N 294 VAL HG22 H N N 295 VAL HG23 H N N 296 VAL HXT H N N 297 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 HIS N CA sing N N 101 HIS N H sing N N 102 HIS N H2 sing N N 103 HIS CA C sing N N 104 HIS CA CB sing N N 105 HIS CA HA sing N N 106 HIS C O doub N N 107 HIS C OXT sing N N 108 HIS CB CG sing N N 109 HIS CB HB2 sing N N 110 HIS CB HB3 sing N N 111 HIS CG ND1 sing Y N 112 HIS CG CD2 doub Y N 113 HIS ND1 CE1 doub Y N 114 HIS ND1 HD1 sing N N 115 HIS CD2 NE2 sing Y N 116 HIS CD2 HD2 sing N N 117 HIS CE1 NE2 sing Y N 118 HIS CE1 HE1 sing N N 119 HIS NE2 HE2 sing N N 120 HIS OXT HXT sing N N 121 ILE N CA sing N N 122 ILE N H sing N N 123 ILE N H2 sing N N 124 ILE CA C sing N N 125 ILE CA CB sing N N 126 ILE CA HA sing N N 127 ILE C O doub N N 128 ILE C OXT sing N N 129 ILE CB CG1 sing N N 130 ILE CB CG2 sing N N 131 ILE CB HB sing N N 132 ILE CG1 CD1 sing N N 133 ILE CG1 HG12 sing N N 134 ILE CG1 HG13 sing N N 135 ILE CG2 HG21 sing N N 136 ILE CG2 HG22 sing N N 137 ILE CG2 HG23 sing N N 138 ILE CD1 HD11 sing N N 139 ILE CD1 HD12 sing N N 140 ILE CD1 HD13 sing N N 141 ILE OXT HXT sing N N 142 LEU N CA sing N N 143 LEU N H sing N N 144 LEU N H2 sing N N 145 LEU CA C sing N N 146 LEU CA CB sing N N 147 LEU CA HA sing N N 148 LEU C O doub N N 149 LEU C OXT sing N N 150 LEU CB CG sing N N 151 LEU CB HB2 sing N N 152 LEU CB HB3 sing N N 153 LEU CG CD1 sing N N 154 LEU CG CD2 sing N N 155 LEU CG HG sing N N 156 LEU CD1 HD11 sing N N 157 LEU CD1 HD12 sing N N 158 LEU CD1 HD13 sing N N 159 LEU CD2 HD21 sing N N 160 LEU CD2 HD22 sing N N 161 LEU CD2 HD23 sing N N 162 LEU OXT HXT sing N N 163 LYS N CA sing N N 164 LYS N H sing N N 165 LYS N H2 sing N N 166 LYS CA C sing N N 167 LYS CA CB sing N N 168 LYS CA HA sing N N 169 LYS C O doub N N 170 LYS C OXT sing N N 171 LYS CB CG sing N N 172 LYS CB HB2 sing N N 173 LYS CB HB3 sing N N 174 LYS CG CD sing N N 175 LYS CG HG2 sing N N 176 LYS CG HG3 sing N N 177 LYS CD CE sing N N 178 LYS CD HD2 sing N N 179 LYS CD HD3 sing N N 180 LYS CE NZ sing N N 181 LYS CE HE2 sing N N 182 LYS CE HE3 sing N N 183 LYS NZ HZ1 sing N N 184 LYS NZ HZ2 sing N N 185 LYS NZ HZ3 sing N N 186 LYS OXT HXT sing N N 187 SER N CA sing N N 188 SER N H sing N N 189 SER N H2 sing N N 190 SER CA C sing N N 191 SER CA CB sing N N 192 SER CA HA sing N N 193 SER C O doub N N 194 SER C OXT sing N N 195 SER CB OG sing N N 196 SER CB HB2 sing N N 197 SER CB HB3 sing N N 198 SER OG HG sing N N 199 SER OXT HXT sing N N 200 THR N CA sing N N 201 THR N H sing N N 202 THR N H2 sing N N 203 THR CA C sing N N 204 THR CA CB sing N N 205 THR CA HA sing N N 206 THR C O doub N N 207 THR C OXT sing N N 208 THR CB OG1 sing N N 209 THR CB CG2 sing N N 210 THR CB HB sing N N 211 THR OG1 HG1 sing N N 212 THR CG2 HG21 sing N N 213 THR CG2 HG22 sing N N 214 THR CG2 HG23 sing N N 215 THR OXT HXT sing N N 216 TRP N CA sing N N 217 TRP N H sing N N 218 TRP N H2 sing N N 219 TRP CA C sing N N 220 TRP CA CB sing N N 221 TRP CA HA sing N N 222 TRP C O doub N N 223 TRP C OXT sing N N 224 TRP CB CG sing N N 225 TRP CB HB2 sing N N 226 TRP CB HB3 sing N N 227 TRP CG CD1 doub Y N 228 TRP CG CD2 sing Y N 229 TRP CD1 NE1 sing Y N 230 TRP CD1 HD1 sing N N 231 TRP CD2 CE2 doub Y N 232 TRP CD2 CE3 sing Y N 233 TRP NE1 CE2 sing Y N 234 TRP NE1 HE1 sing N N 235 TRP CE2 CZ2 sing Y N 236 TRP CE3 CZ3 doub Y N 237 TRP CE3 HE3 sing N N 238 TRP CZ2 CH2 doub Y N 239 TRP CZ2 HZ2 sing N N 240 TRP CZ3 CH2 sing Y N 241 TRP CZ3 HZ3 sing N N 242 TRP CH2 HH2 sing N N 243 TRP OXT HXT sing N N 244 TYR N CA sing N N 245 TYR N H sing N N 246 TYR N H2 sing N N 247 TYR CA C sing N N 248 TYR CA CB sing N N 249 TYR CA HA sing N N 250 TYR C O doub N N 251 TYR C OXT sing N N 252 TYR CB CG sing N N 253 TYR CB HB2 sing N N 254 TYR CB HB3 sing N N 255 TYR CG CD1 doub Y N 256 TYR CG CD2 sing Y N 257 TYR CD1 CE1 sing Y N 258 TYR CD1 HD1 sing N N 259 TYR CD2 CE2 doub Y N 260 TYR CD2 HD2 sing N N 261 TYR CE1 CZ doub Y N 262 TYR CE1 HE1 sing N N 263 TYR CE2 CZ sing Y N 264 TYR CE2 HE2 sing N N 265 TYR CZ OH sing N N 266 TYR OH HH sing N N 267 TYR OXT HXT sing N N 268 VAL N CA sing N N 269 VAL N H sing N N 270 VAL N H2 sing N N 271 VAL CA C sing N N 272 VAL CA CB sing N N 273 VAL CA HA sing N N 274 VAL C O doub N N 275 VAL C OXT sing N N 276 VAL CB CG1 sing N N 277 VAL CB CG2 sing N N 278 VAL CB HB sing N N 279 VAL CG1 HG11 sing N N 280 VAL CG1 HG12 sing N N 281 VAL CG1 HG13 sing N N 282 VAL CG2 HG21 sing N N 283 VAL CG2 HG22 sing N N 284 VAL CG2 HG23 sing N N 285 VAL OXT HXT sing N N 286 # _atom_sites.entry_id 5YB2 _atom_sites.fract_transf_matrix[1][1] 0.009018 _atom_sites.fract_transf_matrix[1][2] 0.005207 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010414 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007976 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O # loop_