data_5YBJ # _entry.id 5YBJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.288 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5YBJ WWPDB D_1300005005 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YBJ _pdbx_database_status.recvd_initial_deposition_date 2017-09-05 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Guo, Q.' 1 ? 'Liao, S.' 2 ? 'Min, J.' 3 ? 'Xu, C.' 4 ? 'Structural Genomics Consortium (SGC)' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 293 _citation.language ? _citation.page_first 557 _citation.page_last 566 _citation.title 'Structural basis for the recognition of kinesin family member 21A (KIF21A) by the ankyrin domains of KANK1 and KANK2 proteins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M117.817494 _citation.pdbx_database_id_PubMed 29183992 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Guo, Q.' 1 primary 'Liao, S.' 2 primary 'Zhu, Z.' 3 primary 'Li, Y.' 4 primary 'Li, F.' 5 primary 'Xu, C.' 6 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5YBJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.903 _cell.length_a_esd ? _cell.length_b 47.602 _cell.length_b_esd ? _cell.length_c 137.745 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YBJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'KN motif and ankyrin repeat domain-containing protein 1' 27310.148 1 ? ? 'UNP residues 1080-1329' ? 2 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 3 water nat water 18.015 15 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ankyrin repeat domain-containing protein 15,Kidney ankyrin repeat-containing protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYIAAFEAISPDVLRYVIN LADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQT ALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDI AVLLYAHVNFAKA ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYIAAFEAISPDVLRYVIN LADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQT ALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDI AVLLYAHVNFAKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier KANK1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ARG n 1 5 GLU n 1 6 ARG n 1 7 TYR n 1 8 GLU n 1 9 LEU n 1 10 SER n 1 11 GLU n 1 12 LYS n 1 13 MET n 1 14 LEU n 1 15 SER n 1 16 ALA n 1 17 CYS n 1 18 ASN n 1 19 LEU n 1 20 LEU n 1 21 LYS n 1 22 ASN n 1 23 THR n 1 24 ILE n 1 25 ASN n 1 26 ASP n 1 27 PRO n 1 28 LYS n 1 29 ALA n 1 30 LEU n 1 31 THR n 1 32 SER n 1 33 LYS n 1 34 ASP n 1 35 MET n 1 36 ARG n 1 37 PHE n 1 38 CYS n 1 39 LEU n 1 40 ASN n 1 41 THR n 1 42 LEU n 1 43 GLN n 1 44 HIS n 1 45 GLU n 1 46 TRP n 1 47 PHE n 1 48 ARG n 1 49 VAL n 1 50 SER n 1 51 SER n 1 52 GLN n 1 53 LYS n 1 54 SER n 1 55 ALA n 1 56 ILE n 1 57 PRO n 1 58 ALA n 1 59 MET n 1 60 VAL n 1 61 GLY n 1 62 ASP n 1 63 TYR n 1 64 ILE n 1 65 ALA n 1 66 ALA n 1 67 PHE n 1 68 GLU n 1 69 ALA n 1 70 ILE n 1 71 SER n 1 72 PRO n 1 73 ASP n 1 74 VAL n 1 75 LEU n 1 76 ARG n 1 77 TYR n 1 78 VAL n 1 79 ILE n 1 80 ASN n 1 81 LEU n 1 82 ALA n 1 83 ASP n 1 84 GLY n 1 85 ASN n 1 86 GLY n 1 87 ASN n 1 88 THR n 1 89 ALA n 1 90 LEU n 1 91 HIS n 1 92 TYR n 1 93 SER n 1 94 VAL n 1 95 SER n 1 96 HIS n 1 97 SER n 1 98 ASN n 1 99 PHE n 1 100 GLU n 1 101 ILE n 1 102 VAL n 1 103 LYS n 1 104 LEU n 1 105 LEU n 1 106 LEU n 1 107 ASP n 1 108 ALA n 1 109 ASP n 1 110 VAL n 1 111 CYS n 1 112 ASN n 1 113 VAL n 1 114 ASP n 1 115 HIS n 1 116 GLN n 1 117 ASN n 1 118 LYS n 1 119 ALA n 1 120 GLY n 1 121 TYR n 1 122 THR n 1 123 PRO n 1 124 ILE n 1 125 MET n 1 126 LEU n 1 127 ALA n 1 128 ALA n 1 129 LEU n 1 130 ALA n 1 131 ALA n 1 132 VAL n 1 133 GLU n 1 134 ALA n 1 135 GLU n 1 136 LYS n 1 137 ASP n 1 138 MET n 1 139 ARG n 1 140 ILE n 1 141 VAL n 1 142 GLU n 1 143 GLU n 1 144 LEU n 1 145 PHE n 1 146 GLY n 1 147 CYS n 1 148 GLY n 1 149 ASP n 1 150 VAL n 1 151 ASN n 1 152 ALA n 1 153 LYS n 1 154 ALA n 1 155 SER n 1 156 GLN n 1 157 ALA n 1 158 GLY n 1 159 GLN n 1 160 THR n 1 161 ALA n 1 162 LEU n 1 163 MET n 1 164 LEU n 1 165 ALA n 1 166 VAL n 1 167 SER n 1 168 HIS n 1 169 GLY n 1 170 ARG n 1 171 ILE n 1 172 ASP n 1 173 MET n 1 174 VAL n 1 175 LYS n 1 176 GLY n 1 177 LEU n 1 178 LEU n 1 179 ALA n 1 180 CYS n 1 181 GLY n 1 182 ALA n 1 183 ASP n 1 184 VAL n 1 185 ASN n 1 186 ILE n 1 187 GLN n 1 188 ASP n 1 189 ASP n 1 190 GLU n 1 191 GLY n 1 192 SER n 1 193 THR n 1 194 ALA n 1 195 LEU n 1 196 MET n 1 197 CYS n 1 198 ALA n 1 199 SER n 1 200 GLU n 1 201 HIS n 1 202 GLY n 1 203 HIS n 1 204 VAL n 1 205 GLU n 1 206 ILE n 1 207 VAL n 1 208 LYS n 1 209 LEU n 1 210 LEU n 1 211 LEU n 1 212 ALA n 1 213 GLN n 1 214 PRO n 1 215 GLY n 1 216 CYS n 1 217 ASN n 1 218 GLY n 1 219 HIS n 1 220 LEU n 1 221 GLU n 1 222 ASP n 1 223 ASN n 1 224 ASP n 1 225 GLY n 1 226 SER n 1 227 THR n 1 228 ALA n 1 229 LEU n 1 230 SER n 1 231 ILE n 1 232 ALA n 1 233 LEU n 1 234 GLU n 1 235 ALA n 1 236 GLY n 1 237 HIS n 1 238 LYS n 1 239 ASP n 1 240 ILE n 1 241 ALA n 1 242 VAL n 1 243 LEU n 1 244 LEU n 1 245 TYR n 1 246 ALA n 1 247 HIS n 1 248 VAL n 1 249 ASN n 1 250 PHE n 1 251 ALA n 1 252 LYS n 1 253 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 253 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KANK1, ANKRD15, KANK, KIAA0172' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli-Thermus thermophilus shuttle vector pTRH1T' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 1085940 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KANK1_HUMAN _struct_ref.pdbx_db_accession Q14678 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYIAAFEAISPDVLRYVINLAD GNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALM LAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVL LYAHVNFAKA ; _struct_ref.pdbx_align_begin 1080 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5YBJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 253 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14678 _struct_ref_seq.db_align_beg 1080 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1329 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1080 _struct_ref_seq.pdbx_auth_seq_align_end 1329 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5YBJ GLY A 1 ? UNP Q14678 ? ? 'expression tag' 1077 1 1 5YBJ HIS A 2 ? UNP Q14678 ? ? 'expression tag' 1078 2 1 5YBJ MET A 3 ? UNP Q14678 ? ? 'expression tag' 1079 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YBJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M HEPES, pH 7.5, 0.2M Lithium sulfate monohydrate, 25% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-01-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9796 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9796 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5YBJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.34 _reflns.d_resolution_low 44.99 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12363 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YBJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.341 _refine.ls_d_res_low 44.99 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12362 _refine.ls_number_reflns_R_free 583 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.90 _refine.ls_percent_reflns_R_free 4.72 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2140 _refine.ls_R_factor_R_free 0.2417 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2125 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.46 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.24 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1824 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1857 _refine_hist.d_res_high 2.341 _refine_hist.d_res_low 44.99 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1895 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.229 ? 2572 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 18.645 ? 671 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.070 ? 302 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 336 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3415 2.5771 . . 140 2828 97.00 . . . 0.2784 . 0.2232 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5771 2.9499 . . 131 2921 100.00 . . . 0.2995 . 0.2408 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9499 3.7163 . . 149 2953 100.00 . . . 0.2664 . 0.2335 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7163 44.9995 . . 163 3077 99.00 . . . 0.2157 . 0.1958 . . . . . . . . . . # _struct.entry_id 5YBJ _struct.title 'Structure of apo KANK1 ankyrin domain' _struct.pdbx_descriptor 'KN motif and ankyrin repeat domain-containing protein 1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YBJ _struct_keywords.text 'cell adhesion' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 10 ? ILE A 24 ? SER A 1086 ILE A 1100 1 ? 15 HELX_P HELX_P2 AA2 ASP A 26 ? THR A 31 ? ASP A 1102 THR A 1107 1 ? 6 HELX_P HELX_P3 AA3 SER A 32 ? SER A 51 ? SER A 1108 SER A 1127 1 ? 20 HELX_P HELX_P4 AA4 ILE A 56 ? SER A 71 ? ILE A 1132 SER A 1147 1 ? 16 HELX_P HELX_P5 AA5 SER A 71 ? ASN A 80 ? SER A 1147 ASN A 1156 1 ? 10 HELX_P HELX_P6 AA6 THR A 88 ? HIS A 96 ? THR A 1164 HIS A 1172 1 ? 9 HELX_P HELX_P7 AA7 ASN A 98 ? ALA A 108 ? ASN A 1174 ALA A 1184 1 ? 11 HELX_P HELX_P8 AA8 THR A 122 ? ALA A 130 ? THR A 1198 ALA A 1206 1 ? 9 HELX_P HELX_P9 AA9 ALA A 134 ? GLY A 146 ? ALA A 1210 GLY A 1222 1 ? 13 HELX_P HELX_P10 AB1 THR A 160 ? HIS A 168 ? THR A 1236 HIS A 1244 1 ? 9 HELX_P HELX_P11 AB2 ARG A 170 ? CYS A 180 ? ARG A 1246 CYS A 1256 1 ? 11 HELX_P HELX_P12 AB3 THR A 193 ? GLY A 202 ? THR A 1269 GLY A 1278 1 ? 10 HELX_P HELX_P13 AB4 HIS A 203 ? GLN A 213 ? HIS A 1279 GLN A 1289 1 ? 11 HELX_P HELX_P14 AB5 THR A 227 ? ALA A 235 ? THR A 1303 ALA A 1311 1 ? 9 HELX_P HELX_P15 AB6 HIS A 237 ? ASN A 249 ? HIS A 1313 ASN A 1325 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 1401 ? 3 'binding site for residue GOL A 1401' AC2 Software A GOL 1402 ? 3 'binding site for residue GOL A 1402' AC3 Software A GOL 1403 ? 7 'binding site for residue GOL A 1403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 GLY A 236 ? GLY A 1312 . ? 1_555 ? 2 AC1 3 LYS A 238 ? LYS A 1314 . ? 1_555 ? 3 AC1 3 ASP A 239 ? ASP A 1315 . ? 1_555 ? 4 AC2 3 LEU A 106 ? LEU A 1182 . ? 1_555 ? 5 AC2 3 ASP A 109 ? ASP A 1185 . ? 1_555 ? 6 AC2 3 CYS A 111 ? CYS A 1187 . ? 1_555 ? 7 AC3 7 LYS A 103 ? LYS A 1179 . ? 1_555 ? 8 AC3 7 LEU A 104 ? LEU A 1180 . ? 1_555 ? 9 AC3 7 ASP A 107 ? ASP A 1183 . ? 1_555 ? 10 AC3 7 ALA A 182 ? ALA A 1258 . ? 4_475 ? 11 AC3 7 ASP A 183 ? ASP A 1259 . ? 4_475 ? 12 AC3 7 VAL A 184 ? VAL A 1260 . ? 4_475 ? 13 AC3 7 PRO A 214 ? PRO A 1290 . ? 4_475 ? # _atom_sites.entry_id 5YBJ _atom_sites.fract_transf_matrix[1][1] 0.023308 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021008 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007260 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1077 ? ? ? A . n A 1 2 HIS 2 1078 1078 HIS HIS A . n A 1 3 MET 3 1079 1079 MET MET A . n A 1 4 ARG 4 1080 1080 ARG ARG A . n A 1 5 GLU 5 1081 1081 GLU GLU A . n A 1 6 ARG 6 1082 1082 ARG ARG A . n A 1 7 TYR 7 1083 1083 TYR TYR A . n A 1 8 GLU 8 1084 1084 GLU GLU A . n A 1 9 LEU 9 1085 1085 LEU LEU A . n A 1 10 SER 10 1086 1086 SER SER A . n A 1 11 GLU 11 1087 1087 GLU GLU A . n A 1 12 LYS 12 1088 1088 LYS LYS A . n A 1 13 MET 13 1089 1089 MET MET A . n A 1 14 LEU 14 1090 1090 LEU LEU A . n A 1 15 SER 15 1091 1091 SER SER A . n A 1 16 ALA 16 1092 1092 ALA ALA A . n A 1 17 CYS 17 1093 1093 CYS CYS A . n A 1 18 ASN 18 1094 1094 ASN ASN A . n A 1 19 LEU 19 1095 1095 LEU LEU A . n A 1 20 LEU 20 1096 1096 LEU LEU A . n A 1 21 LYS 21 1097 1097 LYS LYS A . n A 1 22 ASN 22 1098 1098 ASN ASN A . n A 1 23 THR 23 1099 1099 THR THR A . n A 1 24 ILE 24 1100 1100 ILE ILE A . n A 1 25 ASN 25 1101 1101 ASN ASN A . n A 1 26 ASP 26 1102 1102 ASP ASP A . n A 1 27 PRO 27 1103 1103 PRO PRO A . n A 1 28 LYS 28 1104 1104 LYS LYS A . n A 1 29 ALA 29 1105 1105 ALA ALA A . n A 1 30 LEU 30 1106 1106 LEU LEU A . n A 1 31 THR 31 1107 1107 THR THR A . n A 1 32 SER 32 1108 1108 SER SER A . n A 1 33 LYS 33 1109 1109 LYS LYS A . n A 1 34 ASP 34 1110 1110 ASP ASP A . n A 1 35 MET 35 1111 1111 MET MET A . n A 1 36 ARG 36 1112 1112 ARG ARG A . n A 1 37 PHE 37 1113 1113 PHE PHE A . n A 1 38 CYS 38 1114 1114 CYS CYS A . n A 1 39 LEU 39 1115 1115 LEU LEU A . n A 1 40 ASN 40 1116 1116 ASN ASN A . n A 1 41 THR 41 1117 1117 THR THR A . n A 1 42 LEU 42 1118 1118 LEU LEU A . n A 1 43 GLN 43 1119 1119 GLN GLN A . n A 1 44 HIS 44 1120 1120 HIS HIS A . n A 1 45 GLU 45 1121 1121 GLU GLU A . n A 1 46 TRP 46 1122 1122 TRP TRP A . n A 1 47 PHE 47 1123 1123 PHE PHE A . n A 1 48 ARG 48 1124 1124 ARG ARG A . n A 1 49 VAL 49 1125 1125 VAL VAL A . n A 1 50 SER 50 1126 1126 SER SER A . n A 1 51 SER 51 1127 1127 SER SER A . n A 1 52 GLN 52 1128 1128 GLN GLN A . n A 1 53 LYS 53 1129 1129 LYS LYS A . n A 1 54 SER 54 1130 1130 SER SER A . n A 1 55 ALA 55 1131 1131 ALA ALA A . n A 1 56 ILE 56 1132 1132 ILE ILE A . n A 1 57 PRO 57 1133 1133 PRO PRO A . n A 1 58 ALA 58 1134 1134 ALA ALA A . n A 1 59 MET 59 1135 1135 MET MET A . n A 1 60 VAL 60 1136 1136 VAL VAL A . n A 1 61 GLY 61 1137 1137 GLY GLY A . n A 1 62 ASP 62 1138 1138 ASP ASP A . n A 1 63 TYR 63 1139 1139 TYR TYR A . n A 1 64 ILE 64 1140 1140 ILE ILE A . n A 1 65 ALA 65 1141 1141 ALA ALA A . n A 1 66 ALA 66 1142 1142 ALA ALA A . n A 1 67 PHE 67 1143 1143 PHE PHE A . n A 1 68 GLU 68 1144 1144 GLU GLU A . n A 1 69 ALA 69 1145 1145 ALA ALA A . n A 1 70 ILE 70 1146 1146 ILE ILE A . n A 1 71 SER 71 1147 1147 SER SER A . n A 1 72 PRO 72 1148 1148 PRO PRO A . n A 1 73 ASP 73 1149 1149 ASP ASP A . n A 1 74 VAL 74 1150 1150 VAL VAL A . n A 1 75 LEU 75 1151 1151 LEU LEU A . n A 1 76 ARG 76 1152 1152 ARG ARG A . n A 1 77 TYR 77 1153 1153 TYR TYR A . n A 1 78 VAL 78 1154 1154 VAL VAL A . n A 1 79 ILE 79 1155 1155 ILE ILE A . n A 1 80 ASN 80 1156 1156 ASN ASN A . n A 1 81 LEU 81 1157 1157 LEU LEU A . n A 1 82 ALA 82 1158 1158 ALA ALA A . n A 1 83 ASP 83 1159 1159 ASP ASP A . n A 1 84 GLY 84 1160 1160 GLY GLY A . n A 1 85 ASN 85 1161 1161 ASN ASN A . n A 1 86 GLY 86 1162 1162 GLY GLY A . n A 1 87 ASN 87 1163 1163 ASN ASN A . n A 1 88 THR 88 1164 1164 THR THR A . n A 1 89 ALA 89 1165 1165 ALA ALA A . n A 1 90 LEU 90 1166 1166 LEU LEU A . n A 1 91 HIS 91 1167 1167 HIS HIS A . n A 1 92 TYR 92 1168 1168 TYR TYR A . n A 1 93 SER 93 1169 1169 SER SER A . n A 1 94 VAL 94 1170 1170 VAL VAL A . n A 1 95 SER 95 1171 1171 SER SER A . n A 1 96 HIS 96 1172 1172 HIS HIS A . n A 1 97 SER 97 1173 1173 SER SER A . n A 1 98 ASN 98 1174 1174 ASN ASN A . n A 1 99 PHE 99 1175 1175 PHE PHE A . n A 1 100 GLU 100 1176 1176 GLU GLU A . n A 1 101 ILE 101 1177 1177 ILE ILE A . n A 1 102 VAL 102 1178 1178 VAL VAL A . n A 1 103 LYS 103 1179 1179 LYS LYS A . n A 1 104 LEU 104 1180 1180 LEU LEU A . n A 1 105 LEU 105 1181 1181 LEU LEU A . n A 1 106 LEU 106 1182 1182 LEU LEU A . n A 1 107 ASP 107 1183 1183 ASP ASP A . n A 1 108 ALA 108 1184 1184 ALA ALA A . n A 1 109 ASP 109 1185 1185 ASP ASP A . n A 1 110 VAL 110 1186 1186 VAL VAL A . n A 1 111 CYS 111 1187 1187 CYS CYS A . n A 1 112 ASN 112 1188 1188 ASN ASN A . n A 1 113 VAL 113 1189 1189 VAL VAL A . n A 1 114 ASP 114 1190 1190 ASP ASP A . n A 1 115 HIS 115 1191 1191 HIS HIS A . n A 1 116 GLN 116 1192 1192 GLN GLN A . n A 1 117 ASN 117 1193 1193 ASN ASN A . n A 1 118 LYS 118 1194 1194 LYS LYS A . n A 1 119 ALA 119 1195 1195 ALA ALA A . n A 1 120 GLY 120 1196 1196 GLY GLY A . n A 1 121 TYR 121 1197 1197 TYR TYR A . n A 1 122 THR 122 1198 1198 THR THR A . n A 1 123 PRO 123 1199 1199 PRO PRO A . n A 1 124 ILE 124 1200 1200 ILE ILE A . n A 1 125 MET 125 1201 1201 MET MET A . n A 1 126 LEU 126 1202 1202 LEU LEU A . n A 1 127 ALA 127 1203 1203 ALA ALA A . n A 1 128 ALA 128 1204 1204 ALA ALA A . n A 1 129 LEU 129 1205 1205 LEU LEU A . n A 1 130 ALA 130 1206 1206 ALA ALA A . n A 1 131 ALA 131 1207 1207 ALA ALA A . n A 1 132 VAL 132 1208 1208 VAL VAL A . n A 1 133 GLU 133 1209 1209 GLU GLU A . n A 1 134 ALA 134 1210 1210 ALA ALA A . n A 1 135 GLU 135 1211 1211 GLU GLU A . n A 1 136 LYS 136 1212 1212 LYS LYS A . n A 1 137 ASP 137 1213 1213 ASP ASP A . n A 1 138 MET 138 1214 1214 MET MET A . n A 1 139 ARG 139 1215 1215 ARG ARG A . n A 1 140 ILE 140 1216 1216 ILE ILE A . n A 1 141 VAL 141 1217 1217 VAL VAL A . n A 1 142 GLU 142 1218 1218 GLU GLU A . n A 1 143 GLU 143 1219 1219 GLU GLU A . n A 1 144 LEU 144 1220 1220 LEU LEU A . n A 1 145 PHE 145 1221 1221 PHE PHE A . n A 1 146 GLY 146 1222 1222 GLY GLY A . n A 1 147 CYS 147 1223 1223 CYS CYS A . n A 1 148 GLY 148 1224 1224 GLY GLY A . n A 1 149 ASP 149 1225 1225 ASP ASP A . n A 1 150 VAL 150 1226 1226 VAL VAL A . n A 1 151 ASN 151 1227 1227 ASN ASN A . n A 1 152 ALA 152 1228 1228 ALA ALA A . n A 1 153 LYS 153 1229 1229 LYS LYS A . n A 1 154 ALA 154 1230 1230 ALA ALA A . n A 1 155 SER 155 1231 1231 SER SER A . n A 1 156 GLN 156 1232 1232 GLN GLN A . n A 1 157 ALA 157 1233 1233 ALA ALA A . n A 1 158 GLY 158 1234 1234 GLY GLY A . n A 1 159 GLN 159 1235 1235 GLN GLN A . n A 1 160 THR 160 1236 1236 THR THR A . n A 1 161 ALA 161 1237 1237 ALA ALA A . n A 1 162 LEU 162 1238 1238 LEU LEU A . n A 1 163 MET 163 1239 1239 MET MET A . n A 1 164 LEU 164 1240 1240 LEU LEU A . n A 1 165 ALA 165 1241 1241 ALA ALA A . n A 1 166 VAL 166 1242 1242 VAL VAL A . n A 1 167 SER 167 1243 1243 SER SER A . n A 1 168 HIS 168 1244 1244 HIS HIS A . n A 1 169 GLY 169 1245 1245 GLY GLY A . n A 1 170 ARG 170 1246 1246 ARG ARG A . n A 1 171 ILE 171 1247 1247 ILE ILE A . n A 1 172 ASP 172 1248 1248 ASP ASP A . n A 1 173 MET 173 1249 1249 MET MET A . n A 1 174 VAL 174 1250 1250 VAL VAL A . n A 1 175 LYS 175 1251 1251 LYS LYS A . n A 1 176 GLY 176 1252 1252 GLY GLY A . n A 1 177 LEU 177 1253 1253 LEU LEU A . n A 1 178 LEU 178 1254 1254 LEU LEU A . n A 1 179 ALA 179 1255 1255 ALA ALA A . n A 1 180 CYS 180 1256 1256 CYS CYS A . n A 1 181 GLY 181 1257 1257 GLY GLY A . n A 1 182 ALA 182 1258 1258 ALA ALA A . n A 1 183 ASP 183 1259 1259 ASP ASP A . n A 1 184 VAL 184 1260 1260 VAL VAL A . n A 1 185 ASN 185 1261 1261 ASN ASN A . n A 1 186 ILE 186 1262 1262 ILE ILE A . n A 1 187 GLN 187 1263 1263 GLN GLN A . n A 1 188 ASP 188 1264 1264 ASP ASP A . n A 1 189 ASP 189 1265 1265 ASP ASP A . n A 1 190 GLU 190 1266 1266 GLU GLU A . n A 1 191 GLY 191 1267 1267 GLY GLY A . n A 1 192 SER 192 1268 1268 SER SER A . n A 1 193 THR 193 1269 1269 THR THR A . n A 1 194 ALA 194 1270 1270 ALA ALA A . n A 1 195 LEU 195 1271 1271 LEU LEU A . n A 1 196 MET 196 1272 1272 MET MET A . n A 1 197 CYS 197 1273 1273 CYS CYS A . n A 1 198 ALA 198 1274 1274 ALA ALA A . n A 1 199 SER 199 1275 1275 SER SER A . n A 1 200 GLU 200 1276 1276 GLU GLU A . n A 1 201 HIS 201 1277 1277 HIS HIS A . n A 1 202 GLY 202 1278 1278 GLY GLY A . n A 1 203 HIS 203 1279 1279 HIS HIS A . n A 1 204 VAL 204 1280 1280 VAL VAL A . n A 1 205 GLU 205 1281 1281 GLU GLU A . n A 1 206 ILE 206 1282 1282 ILE ILE A . n A 1 207 VAL 207 1283 1283 VAL VAL A . n A 1 208 LYS 208 1284 1284 LYS LYS A . n A 1 209 LEU 209 1285 1285 LEU LEU A . n A 1 210 LEU 210 1286 1286 LEU LEU A . n A 1 211 LEU 211 1287 1287 LEU LEU A . n A 1 212 ALA 212 1288 1288 ALA ALA A . n A 1 213 GLN 213 1289 1289 GLN GLN A . n A 1 214 PRO 214 1290 1290 PRO PRO A . n A 1 215 GLY 215 1291 1291 GLY GLY A . n A 1 216 CYS 216 1292 1292 CYS CYS A . n A 1 217 ASN 217 1293 1293 ASN ASN A . n A 1 218 GLY 218 1294 1294 GLY GLY A . n A 1 219 HIS 219 1295 1295 HIS HIS A . n A 1 220 LEU 220 1296 1296 LEU LEU A . n A 1 221 GLU 221 1297 1297 GLU GLU A . n A 1 222 ASP 222 1298 1298 ASP ASP A . n A 1 223 ASN 223 1299 1299 ASN ASN A . n A 1 224 ASP 224 1300 1300 ASP ASP A . n A 1 225 GLY 225 1301 1301 GLY GLY A . n A 1 226 SER 226 1302 1302 SER SER A . n A 1 227 THR 227 1303 1303 THR THR A . n A 1 228 ALA 228 1304 1304 ALA ALA A . n A 1 229 LEU 229 1305 1305 LEU LEU A . n A 1 230 SER 230 1306 1306 SER SER A . n A 1 231 ILE 231 1307 1307 ILE ILE A . n A 1 232 ALA 232 1308 1308 ALA ALA A . n A 1 233 LEU 233 1309 1309 LEU LEU A . n A 1 234 GLU 234 1310 1310 GLU GLU A . n A 1 235 ALA 235 1311 1311 ALA ALA A . n A 1 236 GLY 236 1312 1312 GLY GLY A . n A 1 237 HIS 237 1313 1313 HIS HIS A . n A 1 238 LYS 238 1314 1314 LYS LYS A . n A 1 239 ASP 239 1315 1315 ASP ASP A . n A 1 240 ILE 240 1316 1316 ILE ILE A . n A 1 241 ALA 241 1317 1317 ALA ALA A . n A 1 242 VAL 242 1318 1318 VAL VAL A . n A 1 243 LEU 243 1319 1319 LEU LEU A . n A 1 244 LEU 244 1320 1320 LEU LEU A . n A 1 245 TYR 245 1321 1321 TYR TYR A . n A 1 246 ALA 246 1322 1322 ALA ALA A . n A 1 247 HIS 247 1323 1323 HIS HIS A . n A 1 248 VAL 248 1324 1324 VAL VAL A . n A 1 249 ASN 249 1325 1325 ASN ASN A . n A 1 250 PHE 250 1326 ? ? ? A . n A 1 251 ALA 251 1327 ? ? ? A . n A 1 252 LYS 252 1328 ? ? ? A . n A 1 253 ALA 253 1329 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 1401 1 GOL GOL A . C 2 GOL 1 1402 2 GOL GOL A . D 2 GOL 1 1403 3 GOL GOL A . E 3 HOH 1 1501 10 HOH HOH A . E 3 HOH 2 1502 25 HOH HOH A . E 3 HOH 3 1503 18 HOH HOH A . E 3 HOH 4 1504 2 HOH HOH A . E 3 HOH 5 1505 1 HOH HOH A . E 3 HOH 6 1506 13 HOH HOH A . E 3 HOH 7 1507 6 HOH HOH A . E 3 HOH 8 1508 5 HOH HOH A . E 3 HOH 9 1509 24 HOH HOH A . E 3 HOH 10 1510 9 HOH HOH A . E 3 HOH 11 1511 21 HOH HOH A . E 3 HOH 12 1512 3 HOH HOH A . E 3 HOH 13 1513 23 HOH HOH A . E 3 HOH 14 1514 15 HOH HOH A . E 3 HOH 15 1515 22 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 260 ? 1 MORE -0 ? 1 'SSA (A^2)' 12010 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-06 2 'Structure model' 2 0 2017-12-13 3 'Structure model' 2 1 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Polymer sequence' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' entity_poly 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_entity_poly.pdbx_target_identifier' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_2722 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 1101 ? ? -98.55 49.71 2 1 ASP A 1102 ? ? -152.79 87.53 3 1 SER A 1130 ? ? -93.38 33.46 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 1078 ? CG ? A HIS 2 CG 2 1 Y 1 A HIS 1078 ? ND1 ? A HIS 2 ND1 3 1 Y 1 A HIS 1078 ? CD2 ? A HIS 2 CD2 4 1 Y 1 A HIS 1078 ? CE1 ? A HIS 2 CE1 5 1 Y 1 A HIS 1078 ? NE2 ? A HIS 2 NE2 6 1 Y 1 A LYS 1104 ? CD ? A LYS 28 CD 7 1 Y 1 A LYS 1104 ? CE ? A LYS 28 CE 8 1 Y 1 A LYS 1104 ? NZ ? A LYS 28 NZ 9 1 Y 1 A THR 1107 ? OG1 ? A THR 31 OG1 10 1 Y 1 A THR 1107 ? CG2 ? A THR 31 CG2 11 1 Y 1 A LYS 1109 ? CE ? A LYS 33 CE 12 1 Y 1 A LYS 1109 ? NZ ? A LYS 33 NZ 13 1 Y 1 A ARG 1112 ? CD ? A ARG 36 CD 14 1 Y 1 A ARG 1112 ? NE ? A ARG 36 NE 15 1 Y 1 A ARG 1112 ? CZ ? A ARG 36 CZ 16 1 Y 1 A ARG 1112 ? NH1 ? A ARG 36 NH1 17 1 Y 1 A ARG 1112 ? NH2 ? A ARG 36 NH2 18 1 Y 1 A PHE 1113 ? CG ? A PHE 37 CG 19 1 Y 1 A PHE 1113 ? CD1 ? A PHE 37 CD1 20 1 Y 1 A PHE 1113 ? CD2 ? A PHE 37 CD2 21 1 Y 1 A PHE 1113 ? CE1 ? A PHE 37 CE1 22 1 Y 1 A PHE 1113 ? CE2 ? A PHE 37 CE2 23 1 Y 1 A PHE 1113 ? CZ ? A PHE 37 CZ 24 1 Y 1 A LYS 1129 ? CG ? A LYS 53 CG 25 1 Y 1 A LYS 1129 ? CD ? A LYS 53 CD 26 1 Y 1 A LYS 1129 ? CE ? A LYS 53 CE 27 1 Y 1 A LYS 1129 ? NZ ? A LYS 53 NZ 28 1 Y 1 A LYS 1194 ? CE ? A LYS 118 CE 29 1 Y 1 A LYS 1194 ? NZ ? A LYS 118 NZ 30 1 Y 1 A GLU 1209 ? CG ? A GLU 133 CG 31 1 Y 1 A GLU 1209 ? CD ? A GLU 133 CD 32 1 Y 1 A GLU 1209 ? OE1 ? A GLU 133 OE1 33 1 Y 1 A GLU 1209 ? OE2 ? A GLU 133 OE2 34 1 Y 1 A GLU 1211 ? CD ? A GLU 135 CD 35 1 Y 1 A GLU 1211 ? OE1 ? A GLU 135 OE1 36 1 Y 1 A GLU 1211 ? OE2 ? A GLU 135 OE2 37 1 Y 1 A GLN 1232 ? CG ? A GLN 156 CG 38 1 Y 1 A GLN 1232 ? CD ? A GLN 156 CD 39 1 Y 1 A GLN 1232 ? OE1 ? A GLN 156 OE1 40 1 Y 1 A GLN 1232 ? NE2 ? A GLN 156 NE2 41 1 Y 1 A GLU 1266 ? CG ? A GLU 190 CG 42 1 Y 1 A GLU 1266 ? CD ? A GLU 190 CD 43 1 Y 1 A GLU 1266 ? OE1 ? A GLU 190 OE1 44 1 Y 1 A GLU 1266 ? OE2 ? A GLU 190 OE2 45 1 Y 1 A GLU 1310 ? CG ? A GLU 234 CG 46 1 Y 1 A GLU 1310 ? CD ? A GLU 234 CD 47 1 Y 1 A GLU 1310 ? OE1 ? A GLU 234 OE1 48 1 Y 1 A GLU 1310 ? OE2 ? A GLU 234 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1077 ? A GLY 1 2 1 Y 1 A PHE 1326 ? A PHE 250 3 1 Y 1 A ALA 1327 ? A ALA 251 4 1 Y 1 A LYS 1328 ? A LYS 252 5 1 Y 1 A ALA 1329 ? A ALA 253 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #