data_5YCE # _entry.id 5YCE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.299 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5YCE WWPDB D_1300004995 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YCE _pdbx_database_status.recvd_initial_deposition_date 2017-09-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Isogai, Y.' 1 ? 'Imamura, H.' 2 ? 'Nakae, S.' 3 ? 'Sumi, T.' 4 ? 'Takahashi, K.' 5 ? 'Nakagawa, T.' 6 ? 'Tsuneshige, A.' 7 ? 'Shirai, T.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 16883 _citation.page_last 16883 _citation.title 'Tracing whale myoglobin evolution by resurrecting ancient proteins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-018-34984-6 _citation.pdbx_database_id_PubMed 30442991 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Isogai, Y.' 1 ? primary 'Imamura, H.' 2 0000-0001-8924-747X primary 'Nakae, S.' 3 ? primary 'Sumi, T.' 4 ? primary 'Takahashi, K.I.' 5 ? primary 'Nakagawa, T.' 6 ? primary 'Tsuneshige, A.' 7 ? primary 'Shirai, T.' 8 ? # _cell.entry_id 5YCE _cell.length_a 34.180 _cell.length_b 30.660 _cell.length_c 63.570 _cell.angle_alpha 90.00 _cell.angle_beta 105.49 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YCE _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Myoglobin 17366.148 1 ? ? ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 water nat water 18.015 295 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_seq_one_letter_code_can ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LEU n 1 4 SER n 1 5 GLU n 1 6 GLY n 1 7 GLU n 1 8 TRP n 1 9 GLN n 1 10 LEU n 1 11 VAL n 1 12 LEU n 1 13 HIS n 1 14 VAL n 1 15 TRP n 1 16 ALA n 1 17 LYS n 1 18 VAL n 1 19 GLU n 1 20 ALA n 1 21 ASP n 1 22 VAL n 1 23 ALA n 1 24 GLY n 1 25 HIS n 1 26 GLY n 1 27 GLN n 1 28 ASP n 1 29 ILE n 1 30 LEU n 1 31 ILE n 1 32 ARG n 1 33 LEU n 1 34 PHE n 1 35 LYS n 1 36 SER n 1 37 HIS n 1 38 PRO n 1 39 GLU n 1 40 THR n 1 41 LEU n 1 42 GLU n 1 43 LYS n 1 44 PHE n 1 45 ASP n 1 46 ARG n 1 47 PHE n 1 48 LYS n 1 49 HIS n 1 50 LEU n 1 51 LYS n 1 52 THR n 1 53 GLU n 1 54 ALA n 1 55 GLU n 1 56 MET n 1 57 LYS n 1 58 ALA n 1 59 SER n 1 60 GLU n 1 61 ASP n 1 62 LEU n 1 63 LYS n 1 64 LYS n 1 65 HIS n 1 66 GLY n 1 67 VAL n 1 68 THR n 1 69 VAL n 1 70 LEU n 1 71 THR n 1 72 ALA n 1 73 LEU n 1 74 GLY n 1 75 ALA n 1 76 ILE n 1 77 LEU n 1 78 LYS n 1 79 LYS n 1 80 LYS n 1 81 GLY n 1 82 HIS n 1 83 HIS n 1 84 GLU n 1 85 ALA n 1 86 GLU n 1 87 LEU n 1 88 LYS n 1 89 PRO n 1 90 LEU n 1 91 ALA n 1 92 GLN n 1 93 SER n 1 94 HIS n 1 95 ALA n 1 96 THR n 1 97 LYS n 1 98 HIS n 1 99 LYS n 1 100 ILE n 1 101 PRO n 1 102 ILE n 1 103 LYS n 1 104 TYR n 1 105 LEU n 1 106 GLU n 1 107 PHE n 1 108 ILE n 1 109 SER n 1 110 GLU n 1 111 ALA n 1 112 ILE n 1 113 ILE n 1 114 HIS n 1 115 VAL n 1 116 LEU n 1 117 HIS n 1 118 SER n 1 119 ARG n 1 120 HIS n 1 121 PRO n 1 122 GLY n 1 123 ASP n 1 124 PHE n 1 125 GLY n 1 126 ALA n 1 127 ASP n 1 128 ALA n 1 129 GLN n 1 130 GLY n 1 131 ALA n 1 132 MET n 1 133 ASN n 1 134 LYS n 1 135 ALA n 1 136 LEU n 1 137 GLU n 1 138 LEU n 1 139 PHE n 1 140 ARG n 1 141 LYS n 1 142 ASP n 1 143 ILE n 1 144 ALA n 1 145 ALA n 1 146 LYS n 1 147 TYR n 1 148 LYS n 1 149 GLU n 1 150 LEU n 1 151 GLY n 1 152 TYR n 1 153 GLN n 1 154 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 154 _entity_src_gen.gene_src_common_name 'Sperm whale' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Physeter catodon' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9755 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYG_PHYCD _struct_ref.pdbx_db_accession P02185 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5YCE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02185 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YCE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '76% saturated ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL38B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL38B1 _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5YCE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 0.77 _reflns.d_resolution_low 10.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 148979 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 0.77 _reflns_shell.d_res_low 0.81 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 98.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.138 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5YCE _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 148914 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 9.949 _refine.ls_d_res_high 0.770 _refine.ls_percent_reflns_obs 99.30 _refine.ls_R_factor_obs 0.1448 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1439 _refine.ls_R_factor_R_free 0.1615 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.01 _refine.ls_number_reflns_R_free 7467 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 3RGK _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.11 _refine.pdbx_overall_phase_error 21.16 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1203 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 58 _refine_hist.number_atoms_solvent 295 _refine_hist.number_atoms_total 1556 _refine_hist.d_res_high 0.770 _refine_hist.d_res_low 9.949 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.013 ? ? 1926 'X-RAY DIFFRACTION' ? f_angle_d 1.529 ? ? 2629 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 22.078 ? ? 721 'X-RAY DIFFRACTION' ? f_chiral_restr 0.091 ? ? 264 'X-RAY DIFFRACTION' ? f_plane_restr 0.009 ? ? 332 'X-RAY DIFFRACTION' ? # _struct.entry_id 5YCE _struct.title 'Sperm whale myoglobin swMb' _struct.pdbx_descriptor Myoglobin _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YCE _struct_keywords.text 'Globin, Molecular Archaeology, Ancient protein, Protein evolution, Deep-sea adaptation, OXYGEN STORAGE' _struct_keywords.pdbx_keywords 'OXYGEN STORAGE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? GLU A 19 ? SER A 3 GLU A 18 1 ? 16 HELX_P HELX_P2 AA2 ASP A 21 ? HIS A 37 ? ASP A 20 HIS A 36 1 ? 17 HELX_P HELX_P3 AA3 HIS A 37 ? LYS A 43 ? HIS A 36 LYS A 42 1 ? 7 HELX_P HELX_P4 AA4 THR A 52 ? ALA A 58 ? THR A 51 ALA A 57 1 ? 7 HELX_P HELX_P5 AA5 SER A 59 ? LYS A 78 ? SER A 58 LYS A 77 1 ? 20 HELX_P HELX_P6 AA6 HIS A 83 ? LYS A 97 ? HIS A 82 LYS A 96 1 ? 15 HELX_P HELX_P7 AA7 PRO A 101 ? HIS A 120 ? PRO A 100 HIS A 119 1 ? 20 HELX_P HELX_P8 AA8 GLY A 125 ? LEU A 150 ? GLY A 124 LEU A 149 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 94 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 93 A HEM 201 1_555 ? ? ? ? ? ? ? 2.116 ? metalc2 metalc ? ? B HEM . FE ? ? ? 1_555 F HOH . O ? ? A HEM 201 A HOH 365 1_555 ? ? ? ? ? ? ? 2.110 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HEM 201 ? 23 'binding site for residue HEM A 201' AC2 Software A SO4 202 ? 4 'binding site for residue SO4 A 202' AC3 Software A SO4 203 ? 7 'binding site for residue SO4 A 203' AC4 Software A SO4 204 ? 13 'binding site for residue SO4 A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 23 THR A 40 ? THR A 39 . ? 1_555 ? 2 AC1 23 LYS A 43 ? LYS A 42 . ? 1_555 ? 3 AC1 23 PHE A 44 ? PHE A 43 . ? 1_555 ? 4 AC1 23 ARG A 46 ? ARG A 45 . ? 1_555 ? 5 AC1 23 HIS A 65 ? HIS A 64 . ? 1_555 ? 6 AC1 23 THR A 68 ? THR A 67 . ? 1_555 ? 7 AC1 23 VAL A 69 ? VAL A 68 . ? 1_555 ? 8 AC1 23 LEU A 90 ? LEU A 89 . ? 1_555 ? 9 AC1 23 SER A 93 ? SER A 92 . ? 1_555 ? 10 AC1 23 HIS A 94 ? HIS A 93 . ? 1_555 ? 11 AC1 23 HIS A 98 ? HIS A 97 . ? 1_555 ? 12 AC1 23 ILE A 100 ? ILE A 99 . ? 1_555 ? 13 AC1 23 TYR A 104 ? TYR A 103 . ? 1_555 ? 14 AC1 23 LEU A 105 ? LEU A 104 . ? 1_555 ? 15 AC1 23 PHE A 139 ? PHE A 138 . ? 1_555 ? 16 AC1 23 HOH F . ? HOH A 318 . ? 1_555 ? 17 AC1 23 HOH F . ? HOH A 320 . ? 1_555 ? 18 AC1 23 HOH F . ? HOH A 353 . ? 1_555 ? 19 AC1 23 HOH F . ? HOH A 357 . ? 1_555 ? 20 AC1 23 HOH F . ? HOH A 365 . ? 1_555 ? 21 AC1 23 HOH F . ? HOH A 410 . ? 1_555 ? 22 AC1 23 HOH F . ? HOH A 428 . ? 1_565 ? 23 AC1 23 HOH F . ? HOH A 445 . ? 1_555 ? 24 AC2 4 ALA A 58 ? ALA A 57 . ? 1_555 ? 25 AC2 4 SER A 59 ? SER A 58 . ? 1_555 ? 26 AC2 4 GLU A 60 ? GLU A 59 . ? 1_555 ? 27 AC2 4 ASP A 61 ? ASP A 60 . ? 1_555 ? 28 AC3 7 GLN A 27 ? GLN A 26 . ? 1_555 ? 29 AC3 7 LYS A 57 ? LYS A 56 . ? 1_555 ? 30 AC3 7 LYS A 63 ? LYS A 62 . ? 1_555 ? 31 AC3 7 HOH F . ? HOH A 336 . ? 1_555 ? 32 AC3 7 HOH F . ? HOH A 378 . ? 1_555 ? 33 AC3 7 HOH F . ? HOH A 383 . ? 1_555 ? 34 AC3 7 HOH F . ? HOH A 439 . ? 1_555 ? 35 AC4 13 ARG A 46 ? ARG A 45 . ? 1_555 ? 36 AC4 13 LYS A 64 ? LYS A 63 . ? 1_555 ? 37 AC4 13 HIS A 65 ? HIS A 64 . ? 1_555 ? 38 AC4 13 THR A 68 ? THR A 67 . ? 1_555 ? 39 AC4 13 HIS A 117 ? HIS A 116 . ? 1_565 ? 40 AC4 13 HOH F . ? HOH A 327 . ? 1_555 ? 41 AC4 13 HOH F . ? HOH A 337 . ? 1_555 ? 42 AC4 13 HOH F . ? HOH A 340 . ? 1_555 ? 43 AC4 13 HOH F . ? HOH A 343 . ? 1_555 ? 44 AC4 13 HOH F . ? HOH A 352 . ? 1_555 ? 45 AC4 13 HOH F . ? HOH A 357 . ? 1_555 ? 46 AC4 13 HOH F . ? HOH A 491 . ? 1_555 ? 47 AC4 13 HOH F . ? HOH A 530 . ? 1_555 ? # _atom_sites.entry_id 5YCE _atom_sites.fract_transf_matrix[1][1] 0.029257 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008108 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.032616 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016324 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 GLY 6 5 5 GLY GLY A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 TRP 8 7 7 TRP TRP A . n A 1 9 GLN 9 8 8 GLN GLN A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 VAL 11 10 10 VAL VAL A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 HIS 13 12 12 HIS HIS A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 TRP 15 14 14 TRP TRP A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ASP 21 20 20 ASP ASP A . n A 1 22 VAL 22 21 21 VAL VAL A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 HIS 25 24 24 HIS HIS A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 GLN 27 26 26 GLN GLN A . n A 1 28 ASP 28 27 27 ASP ASP A . n A 1 29 ILE 29 28 28 ILE ILE A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 ILE 31 30 30 ILE ILE A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 PHE 34 33 33 PHE PHE A . n A 1 35 LYS 35 34 34 LYS LYS A . n A 1 36 SER 36 35 35 SER SER A . n A 1 37 HIS 37 36 36 HIS HIS A . n A 1 38 PRO 38 37 37 PRO PRO A . n A 1 39 GLU 39 38 38 GLU GLU A . n A 1 40 THR 40 39 39 THR THR A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 PHE 47 46 46 PHE PHE A . n A 1 48 LYS 48 47 47 LYS LYS A . n A 1 49 HIS 49 48 48 HIS HIS A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 GLU 53 52 52 GLU GLU A . n A 1 54 ALA 54 53 53 ALA ALA A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 MET 56 55 55 MET MET A . n A 1 57 LYS 57 56 56 LYS LYS A . n A 1 58 ALA 58 57 57 ALA ALA A . n A 1 59 SER 59 58 58 SER SER A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 HIS 65 64 64 HIS HIS A . n A 1 66 GLY 66 65 65 GLY GLY A . n A 1 67 VAL 67 66 66 VAL VAL A . n A 1 68 THR 68 67 67 THR THR A . n A 1 69 VAL 69 68 68 VAL VAL A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 THR 71 70 70 THR THR A . n A 1 72 ALA 72 71 71 ALA ALA A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 ALA 75 74 74 ALA ALA A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 LYS 79 78 78 LYS LYS A . n A 1 80 LYS 80 79 79 LYS LYS A . n A 1 81 GLY 81 80 80 GLY GLY A . n A 1 82 HIS 82 81 81 HIS HIS A . n A 1 83 HIS 83 82 82 HIS HIS A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 GLU 86 85 85 GLU GLU A . n A 1 87 LEU 87 86 86 LEU LEU A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 ALA 91 90 90 ALA ALA A . n A 1 92 GLN 92 91 91 GLN GLN A . n A 1 93 SER 93 92 92 SER SER A . n A 1 94 HIS 94 93 93 HIS HIS A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 THR 96 95 95 THR THR A . n A 1 97 LYS 97 96 96 LYS LYS A . n A 1 98 HIS 98 97 97 HIS HIS A . n A 1 99 LYS 99 98 98 LYS LYS A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 PRO 101 100 100 PRO PRO A . n A 1 102 ILE 102 101 101 ILE ILE A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 TYR 104 103 103 TYR TYR A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 GLU 106 105 105 GLU GLU A . n A 1 107 PHE 107 106 106 PHE PHE A . n A 1 108 ILE 108 107 107 ILE ILE A . n A 1 109 SER 109 108 108 SER SER A . n A 1 110 GLU 110 109 109 GLU GLU A . n A 1 111 ALA 111 110 110 ALA ALA A . n A 1 112 ILE 112 111 111 ILE ILE A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 HIS 114 113 113 HIS HIS A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 HIS 117 116 116 HIS HIS A . n A 1 118 SER 118 117 117 SER SER A . n A 1 119 ARG 119 118 118 ARG ARG A . n A 1 120 HIS 120 119 119 HIS HIS A . n A 1 121 PRO 121 120 120 PRO PRO A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 ASP 123 122 122 ASP ASP A . n A 1 124 PHE 124 123 123 PHE PHE A . n A 1 125 GLY 125 124 124 GLY GLY A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 ALA 128 127 127 ALA ALA A . n A 1 129 GLN 129 128 128 GLN GLN A . n A 1 130 GLY 130 129 129 GLY GLY A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 MET 132 131 131 MET MET A . n A 1 133 ASN 133 132 132 ASN ASN A . n A 1 134 LYS 134 133 133 LYS LYS A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 LEU 136 135 135 LEU LEU A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 PHE 139 138 138 PHE PHE A . n A 1 140 ARG 140 139 139 ARG ARG A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 ILE 143 142 142 ILE ILE A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 GLU 149 148 148 GLU GLU A . n A 1 150 LEU 150 149 149 LEU LEU A . n A 1 151 GLY 151 150 150 GLY GLY A . n A 1 152 TYR 152 151 151 TYR TYR A . n A 1 153 GLN 153 152 ? ? ? A . n A 1 154 GLY 154 153 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 201 154 HEM HEM A . C 3 SO4 1 202 1 SO4 SO4 A . D 3 SO4 1 203 2 SO4 SO4 A . E 3 SO4 1 204 3 SO4 SO4 A . F 4 HOH 1 301 128 HOH HOH A . F 4 HOH 2 302 245 HOH HOH A . F 4 HOH 3 303 146 HOH HOH A . F 4 HOH 4 304 177 HOH HOH A . F 4 HOH 5 305 93 HOH HOH A . F 4 HOH 6 306 260 HOH HOH A . F 4 HOH 7 307 152 HOH HOH A . F 4 HOH 8 308 292 HOH HOH A . F 4 HOH 9 309 79 HOH HOH A . F 4 HOH 10 310 148 HOH HOH A . F 4 HOH 11 311 291 HOH HOH A . F 4 HOH 12 312 203 HOH HOH A . F 4 HOH 13 313 248 HOH HOH A . F 4 HOH 14 314 251 HOH HOH A . F 4 HOH 15 315 134 HOH HOH A . F 4 HOH 16 316 173 HOH HOH A . F 4 HOH 17 317 217 HOH HOH A . F 4 HOH 18 318 84 HOH HOH A . F 4 HOH 19 319 212 HOH HOH A . F 4 HOH 20 320 56 HOH HOH A . F 4 HOH 21 321 295 HOH HOH A . F 4 HOH 22 322 162 HOH HOH A . F 4 HOH 23 323 276 HOH HOH A . F 4 HOH 24 324 286 HOH HOH A . F 4 HOH 25 325 10 HOH HOH A . F 4 HOH 26 326 5 HOH HOH A . F 4 HOH 27 327 274 HOH HOH A . F 4 HOH 28 328 184 HOH HOH A . F 4 HOH 29 329 24 HOH HOH A . F 4 HOH 30 330 263 HOH HOH A . F 4 HOH 31 331 89 HOH HOH A . F 4 HOH 32 332 80 HOH HOH A . F 4 HOH 33 333 92 HOH HOH A . F 4 HOH 34 334 62 HOH HOH A . F 4 HOH 35 335 101 HOH HOH A . F 4 HOH 36 336 216 HOH HOH A . F 4 HOH 37 337 237 HOH HOH A . F 4 HOH 38 338 97 HOH HOH A . F 4 HOH 39 339 183 HOH HOH A . F 4 HOH 40 340 36 HOH HOH A . F 4 HOH 41 341 135 HOH HOH A . F 4 HOH 42 342 264 HOH HOH A . F 4 HOH 43 343 168 HOH HOH A . F 4 HOH 44 344 22 HOH HOH A . F 4 HOH 45 345 118 HOH HOH A . F 4 HOH 46 346 82 HOH HOH A . F 4 HOH 47 347 185 HOH HOH A . F 4 HOH 48 348 38 HOH HOH A . F 4 HOH 49 349 170 HOH HOH A . F 4 HOH 50 350 136 HOH HOH A . F 4 HOH 51 351 258 HOH HOH A . F 4 HOH 52 352 239 HOH HOH A . F 4 HOH 53 353 47 HOH HOH A . F 4 HOH 54 354 273 HOH HOH A . F 4 HOH 55 355 142 HOH HOH A . F 4 HOH 56 356 151 HOH HOH A . F 4 HOH 57 357 28 HOH HOH A . F 4 HOH 58 358 94 HOH HOH A . F 4 HOH 59 359 57 HOH HOH A . F 4 HOH 60 360 165 HOH HOH A . F 4 HOH 61 361 121 HOH HOH A . F 4 HOH 62 362 259 HOH HOH A . F 4 HOH 63 363 210 HOH HOH A . F 4 HOH 64 364 95 HOH HOH A . F 4 HOH 65 365 241 HOH HOH A . F 4 HOH 66 366 289 HOH HOH A . F 4 HOH 67 367 7 HOH HOH A . F 4 HOH 68 368 294 HOH HOH A . F 4 HOH 69 369 126 HOH HOH A . F 4 HOH 70 370 287 HOH HOH A . F 4 HOH 71 371 15 HOH HOH A . F 4 HOH 72 372 81 HOH HOH A . F 4 HOH 73 373 50 HOH HOH A . F 4 HOH 74 374 11 HOH HOH A . F 4 HOH 75 375 178 HOH HOH A . F 4 HOH 76 376 66 HOH HOH A . F 4 HOH 77 377 60 HOH HOH A . F 4 HOH 78 378 31 HOH HOH A . F 4 HOH 79 379 116 HOH HOH A . F 4 HOH 80 380 17 HOH HOH A . F 4 HOH 81 381 243 HOH HOH A . F 4 HOH 82 382 236 HOH HOH A . F 4 HOH 83 383 113 HOH HOH A . F 4 HOH 84 384 30 HOH HOH A . F 4 HOH 85 385 33 HOH HOH A . F 4 HOH 86 386 108 HOH HOH A . F 4 HOH 87 387 78 HOH HOH A . F 4 HOH 88 388 67 HOH HOH A . F 4 HOH 89 389 46 HOH HOH A . F 4 HOH 90 390 107 HOH HOH A . F 4 HOH 91 391 139 HOH HOH A . F 4 HOH 92 392 70 HOH HOH A . F 4 HOH 93 393 145 HOH HOH A . F 4 HOH 94 394 191 HOH HOH A . F 4 HOH 95 395 208 HOH HOH A . F 4 HOH 96 396 201 HOH HOH A . F 4 HOH 97 397 247 HOH HOH A . F 4 HOH 98 398 140 HOH HOH A . F 4 HOH 99 399 21 HOH HOH A . F 4 HOH 100 400 288 HOH HOH A . F 4 HOH 101 401 23 HOH HOH A . F 4 HOH 102 402 214 HOH HOH A . F 4 HOH 103 403 220 HOH HOH A . F 4 HOH 104 404 192 HOH HOH A . F 4 HOH 105 405 51 HOH HOH A . F 4 HOH 106 406 166 HOH HOH A . F 4 HOH 107 407 224 HOH HOH A . F 4 HOH 108 408 130 HOH HOH A . F 4 HOH 109 409 85 HOH HOH A . F 4 HOH 110 410 18 HOH HOH A . F 4 HOH 111 411 63 HOH HOH A . F 4 HOH 112 412 100 HOH HOH A . F 4 HOH 113 413 215 HOH HOH A . F 4 HOH 114 414 233 HOH HOH A . F 4 HOH 115 415 3 HOH HOH A . F 4 HOH 116 416 40 HOH HOH A . F 4 HOH 117 417 200 HOH HOH A . F 4 HOH 118 418 1 HOH HOH A . F 4 HOH 119 419 6 HOH HOH A . F 4 HOH 120 420 284 HOH HOH A . F 4 HOH 121 421 48 HOH HOH A . F 4 HOH 122 422 98 HOH HOH A . F 4 HOH 123 423 87 HOH HOH A . F 4 HOH 124 424 14 HOH HOH A . F 4 HOH 125 425 180 HOH HOH A . F 4 HOH 126 426 42 HOH HOH A . F 4 HOH 127 427 41 HOH HOH A . F 4 HOH 128 428 43 HOH HOH A . F 4 HOH 129 429 52 HOH HOH A . F 4 HOH 130 430 20 HOH HOH A . F 4 HOH 131 431 29 HOH HOH A . F 4 HOH 132 432 77 HOH HOH A . F 4 HOH 133 433 25 HOH HOH A . F 4 HOH 134 434 271 HOH HOH A . F 4 HOH 135 435 88 HOH HOH A . F 4 HOH 136 436 8 HOH HOH A . F 4 HOH 137 437 176 HOH HOH A . F 4 HOH 138 438 53 HOH HOH A . F 4 HOH 139 439 174 HOH HOH A . F 4 HOH 140 440 4 HOH HOH A . F 4 HOH 141 441 188 HOH HOH A . F 4 HOH 142 442 219 HOH HOH A . F 4 HOH 143 443 205 HOH HOH A . F 4 HOH 144 444 99 HOH HOH A . F 4 HOH 145 445 37 HOH HOH A . F 4 HOH 146 446 9 HOH HOH A . F 4 HOH 147 447 150 HOH HOH A . F 4 HOH 148 448 197 HOH HOH A . F 4 HOH 149 449 68 HOH HOH A . F 4 HOH 150 450 262 HOH HOH A . F 4 HOH 151 451 169 HOH HOH A . F 4 HOH 152 452 13 HOH HOH A . F 4 HOH 153 453 195 HOH HOH A . F 4 HOH 154 454 120 HOH HOH A . F 4 HOH 155 455 49 HOH HOH A . F 4 HOH 156 456 69 HOH HOH A . F 4 HOH 157 457 244 HOH HOH A . F 4 HOH 158 458 160 HOH HOH A . F 4 HOH 159 459 96 HOH HOH A . F 4 HOH 160 460 196 HOH HOH A . F 4 HOH 161 461 27 HOH HOH A . F 4 HOH 162 462 2 HOH HOH A . F 4 HOH 163 463 123 HOH HOH A . F 4 HOH 164 464 198 HOH HOH A . F 4 HOH 165 465 55 HOH HOH A . F 4 HOH 166 466 290 HOH HOH A . F 4 HOH 167 467 133 HOH HOH A . F 4 HOH 168 468 161 HOH HOH A . F 4 HOH 169 469 119 HOH HOH A . F 4 HOH 170 470 35 HOH HOH A . F 4 HOH 171 471 167 HOH HOH A . F 4 HOH 172 472 16 HOH HOH A . F 4 HOH 173 473 104 HOH HOH A . F 4 HOH 174 474 45 HOH HOH A . F 4 HOH 175 475 157 HOH HOH A . F 4 HOH 176 476 59 HOH HOH A . F 4 HOH 177 477 90 HOH HOH A . F 4 HOH 178 478 117 HOH HOH A . F 4 HOH 179 479 194 HOH HOH A . F 4 HOH 180 480 110 HOH HOH A . F 4 HOH 181 481 189 HOH HOH A . F 4 HOH 182 482 75 HOH HOH A . F 4 HOH 183 483 293 HOH HOH A . F 4 HOH 184 484 137 HOH HOH A . F 4 HOH 185 485 127 HOH HOH A . F 4 HOH 186 486 254 HOH HOH A . F 4 HOH 187 487 272 HOH HOH A . F 4 HOH 188 488 114 HOH HOH A . F 4 HOH 189 489 270 HOH HOH A . F 4 HOH 190 490 207 HOH HOH A . F 4 HOH 191 491 64 HOH HOH A . F 4 HOH 192 492 223 HOH HOH A . F 4 HOH 193 493 39 HOH HOH A . F 4 HOH 194 494 111 HOH HOH A . F 4 HOH 195 495 61 HOH HOH A . F 4 HOH 196 496 149 HOH HOH A . F 4 HOH 197 497 76 HOH HOH A . F 4 HOH 198 498 229 HOH HOH A . F 4 HOH 199 499 83 HOH HOH A . F 4 HOH 200 500 112 HOH HOH A . F 4 HOH 201 501 227 HOH HOH A . F 4 HOH 202 502 249 HOH HOH A . F 4 HOH 203 503 132 HOH HOH A . F 4 HOH 204 504 190 HOH HOH A . F 4 HOH 205 505 129 HOH HOH A . F 4 HOH 206 506 235 HOH HOH A . F 4 HOH 207 507 102 HOH HOH A . F 4 HOH 208 508 12 HOH HOH A . F 4 HOH 209 509 246 HOH HOH A . F 4 HOH 210 510 32 HOH HOH A . F 4 HOH 211 511 26 HOH HOH A . F 4 HOH 212 512 281 HOH HOH A . F 4 HOH 213 513 153 HOH HOH A . F 4 HOH 214 514 163 HOH HOH A . F 4 HOH 215 515 115 HOH HOH A . F 4 HOH 216 516 230 HOH HOH A . F 4 HOH 217 517 211 HOH HOH A . F 4 HOH 218 518 204 HOH HOH A . F 4 HOH 219 519 232 HOH HOH A . F 4 HOH 220 520 138 HOH HOH A . F 4 HOH 221 521 171 HOH HOH A . F 4 HOH 222 522 156 HOH HOH A . F 4 HOH 223 523 225 HOH HOH A . F 4 HOH 224 524 265 HOH HOH A . F 4 HOH 225 525 186 HOH HOH A . F 4 HOH 226 526 144 HOH HOH A . F 4 HOH 227 527 155 HOH HOH A . F 4 HOH 228 528 285 HOH HOH A . F 4 HOH 229 529 278 HOH HOH A . F 4 HOH 230 530 19 HOH HOH A . F 4 HOH 231 531 182 HOH HOH A . F 4 HOH 232 532 103 HOH HOH A . F 4 HOH 233 533 280 HOH HOH A . F 4 HOH 234 534 143 HOH HOH A . F 4 HOH 235 535 228 HOH HOH A . F 4 HOH 236 536 261 HOH HOH A . F 4 HOH 237 537 277 HOH HOH A . F 4 HOH 238 538 154 HOH HOH A . F 4 HOH 239 539 164 HOH HOH A . F 4 HOH 240 540 240 HOH HOH A . F 4 HOH 241 541 147 HOH HOH A . F 4 HOH 242 542 234 HOH HOH A . F 4 HOH 243 543 141 HOH HOH A . F 4 HOH 244 544 65 HOH HOH A . F 4 HOH 245 545 175 HOH HOH A . F 4 HOH 246 546 256 HOH HOH A . F 4 HOH 247 547 221 HOH HOH A . F 4 HOH 248 548 252 HOH HOH A . F 4 HOH 249 549 222 HOH HOH A . F 4 HOH 250 550 218 HOH HOH A . F 4 HOH 251 551 131 HOH HOH A . F 4 HOH 252 552 206 HOH HOH A . F 4 HOH 253 553 44 HOH HOH A . F 4 HOH 254 554 255 HOH HOH A . F 4 HOH 255 555 159 HOH HOH A . F 4 HOH 256 556 282 HOH HOH A . F 4 HOH 257 557 158 HOH HOH A . F 4 HOH 258 558 86 HOH HOH A . F 4 HOH 259 559 122 HOH HOH A . F 4 HOH 260 560 71 HOH HOH A . F 4 HOH 261 561 242 HOH HOH A . F 4 HOH 262 562 199 HOH HOH A . F 4 HOH 263 563 34 HOH HOH A . F 4 HOH 264 564 193 HOH HOH A . F 4 HOH 265 565 226 HOH HOH A . F 4 HOH 266 566 253 HOH HOH A . F 4 HOH 267 567 181 HOH HOH A . F 4 HOH 268 568 231 HOH HOH A . F 4 HOH 269 569 213 HOH HOH A . F 4 HOH 270 570 283 HOH HOH A . F 4 HOH 271 571 279 HOH HOH A . F 4 HOH 272 572 74 HOH HOH A . F 4 HOH 273 573 73 HOH HOH A . F 4 HOH 274 574 105 HOH HOH A . F 4 HOH 275 575 238 HOH HOH A . F 4 HOH 276 576 202 HOH HOH A . F 4 HOH 277 577 257 HOH HOH A . F 4 HOH 278 578 269 HOH HOH A . F 4 HOH 279 579 209 HOH HOH A . F 4 HOH 280 580 124 HOH HOH A . F 4 HOH 281 581 125 HOH HOH A . F 4 HOH 282 582 72 HOH HOH A . F 4 HOH 283 583 266 HOH HOH A . F 4 HOH 284 584 58 HOH HOH A . F 4 HOH 285 585 250 HOH HOH A . F 4 HOH 286 586 106 HOH HOH A . F 4 HOH 287 587 268 HOH HOH A . F 4 HOH 288 588 275 HOH HOH A . F 4 HOH 289 589 187 HOH HOH A . F 4 HOH 290 590 172 HOH HOH A . F 4 HOH 291 591 109 HOH HOH A . F 4 HOH 292 592 179 HOH HOH A . F 4 HOH 293 593 54 HOH HOH A . F 4 HOH 294 594 267 HOH HOH A . F 4 HOH 295 595 91 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1350 ? 1 MORE -37 ? 1 'SSA (A^2)' 7590 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NA ? B HEM . ? A HEM 201 ? 1_555 91.1 ? 2 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NB ? B HEM . ? A HEM 201 ? 1_555 92.7 ? 3 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NB ? B HEM . ? A HEM 201 ? 1_555 89.9 ? 4 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 92.3 ? 5 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 176.5 ? 6 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 89.2 ? 7 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 90.9 ? 8 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 89.8 ? 9 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 176.4 ? 10 NC ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 90.9 ? 11 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 O ? F HOH . ? A HOH 365 ? 1_555 176.3 ? 12 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 O ? F HOH . ? A HOH 365 ? 1_555 91.4 ? 13 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 O ? F HOH . ? A HOH 365 ? 1_555 90.0 ? 14 NC ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 O ? F HOH . ? A HOH 365 ? 1_555 85.2 ? 15 ND ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 O ? F HOH . ? A HOH 365 ? 1_555 86.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-19 2 'Structure model' 1 1 2018-12-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLN 8 ? B O A HOH 306 ? ? 2.10 2 1 NH1 A ARG 118 ? A O A HOH 308 ? ? 2.14 3 1 OE2 A GLU 109 ? B O A HOH 311 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 324 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 589 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_545 _pdbx_validate_symm_contact.dist 2.18 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 126 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 B _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 126 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 B _pdbx_validate_rmsd_angle.auth_atom_id_3 OD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 126 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 B _pdbx_validate_rmsd_angle.angle_value 124.15 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation 5.85 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? A -151.59 64.30 2 1 ASP A 20 ? B -150.79 62.40 3 1 HIS A 119 ? A -146.78 59.28 4 1 PHE A 123 ? A -141.89 58.35 5 1 PHE A 123 ? B -148.42 43.61 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O A A HOH 591 ? 5.89 . 2 1 O ? A HOH 592 ? 5.93 . 3 1 O ? A HOH 593 ? 6.03 . 4 1 O ? A HOH 594 ? 6.58 . 5 1 O ? A HOH 595 ? 6.95 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A GLN 152 ? A GLN 153 3 1 Y 1 A GLY 153 ? A GLY 154 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Education, Culture, Sports, Science and Technology (Japan)' Japan JP17H01818 1 'Japan Agency for Medical Research and Development' Japan 17am0101069j0001 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 'SULFATE ION' SO4 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? #