data_5YIQ # _entry.id 5YIQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YIQ pdb_00005yiq 10.2210/pdb5yiq/pdb WWPDB D_1300005359 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YIQ _pdbx_database_status.recvd_initial_deposition_date 2017-10-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, J.' 1 0000-0002-8921-1626 'Zhu, R.' 2 ? 'Chen, K.' 3 0000-0003-0321-0604 'Zheng, H.' 4 ? 'Yuan, C.' 5 ? 'Zhang, H.' 6 ? 'Wang, C.' 7 ? 'Zhang, M.' 8 0000-0001-9404-0190 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat. Chem. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 778 _citation.page_last 787 _citation.title 'Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-018-0082-8 _citation.pdbx_database_id_PubMed 29867141 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, J.' 1 0000-0002-8921-1626 primary 'Zhu, R.' 2 0000-0002-5991-1365 primary 'Chen, K.' 3 ? primary 'Zheng, H.' 4 ? primary 'Zhao, H.' 5 ? primary 'Yuan, C.' 6 ? primary 'Zhang, H.' 7 ? primary 'Wang, C.' 8 ? primary 'Zhang, M.' 9 0000-0001-9404-0190 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5YIQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.553 _cell.length_a_esd ? _cell.length_b 64.553 _cell.length_b_esd ? _cell.length_c 155.461 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YIQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Microtubule-associated proteins 1A/1B light chain 3B' 14637.859 1 ? ? ? ? 2 polymer man Ankyrin-3 2919.998 1 ? ? 'UNP RESIDUES 1985-2010' ? 3 non-polymer syn 'ZINC ION' 65.409 4 ? ? ? ? 4 water nat water 18.015 9 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;Autophagy-related protein LC3 B,Autophagy-related ubiquitin-like modifier LC3 B,MAP1 light chain 3-like protein 2,MAP1A/MAP1B light chain 3 B,MAP1A/MAP1B LC3 B,Microtubule-associated protein 1 light chain 3 beta ; 2 ANK-3,Ankyrin-G # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV ; ;MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV ; A ? 2 'polypeptide(L)' no no PEDDWTEFSSEEIREARQAAASHAPS PEDDWTEFSSEEIREARQAAASHAPS D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 SER n 1 4 GLU n 1 5 LYS n 1 6 THR n 1 7 PHE n 1 8 LYS n 1 9 GLN n 1 10 ARG n 1 11 ARG n 1 12 SER n 1 13 PHE n 1 14 GLU n 1 15 GLN n 1 16 ARG n 1 17 VAL n 1 18 GLU n 1 19 ASP n 1 20 VAL n 1 21 ARG n 1 22 LEU n 1 23 ILE n 1 24 ARG n 1 25 GLU n 1 26 GLN n 1 27 HIS n 1 28 PRO n 1 29 THR n 1 30 LYS n 1 31 ILE n 1 32 PRO n 1 33 VAL n 1 34 ILE n 1 35 ILE n 1 36 GLU n 1 37 ARG n 1 38 TYR n 1 39 LYS n 1 40 GLY n 1 41 GLU n 1 42 LYS n 1 43 GLN n 1 44 LEU n 1 45 PRO n 1 46 VAL n 1 47 LEU n 1 48 ASP n 1 49 LYS n 1 50 THR n 1 51 LYS n 1 52 PHE n 1 53 LEU n 1 54 VAL n 1 55 PRO n 1 56 ASP n 1 57 HIS n 1 58 VAL n 1 59 ASN n 1 60 MET n 1 61 SER n 1 62 GLU n 1 63 LEU n 1 64 ILE n 1 65 LYS n 1 66 ILE n 1 67 ILE n 1 68 ARG n 1 69 ARG n 1 70 ARG n 1 71 LEU n 1 72 GLN n 1 73 LEU n 1 74 ASN n 1 75 ALA n 1 76 ASN n 1 77 GLN n 1 78 ALA n 1 79 PHE n 1 80 PHE n 1 81 LEU n 1 82 LEU n 1 83 VAL n 1 84 ASN n 1 85 GLY n 1 86 HIS n 1 87 SER n 1 88 MET n 1 89 VAL n 1 90 SER n 1 91 VAL n 1 92 SER n 1 93 THR n 1 94 PRO n 1 95 ILE n 1 96 SER n 1 97 GLU n 1 98 VAL n 1 99 TYR n 1 100 GLU n 1 101 SER n 1 102 GLU n 1 103 ARG n 1 104 ASP n 1 105 GLU n 1 106 ASP n 1 107 GLY n 1 108 PHE n 1 109 LEU n 1 110 TYR n 1 111 MET n 1 112 VAL n 1 113 TYR n 1 114 ALA n 1 115 SER n 1 116 GLN n 1 117 GLU n 1 118 THR n 1 119 PHE n 1 120 GLY n 1 121 THR n 1 122 ALA n 1 123 MET n 1 124 ALA n 1 125 VAL n 2 1 PRO n 2 2 GLU n 2 3 ASP n 2 4 ASP n 2 5 TRP n 2 6 THR n 2 7 GLU n 2 8 PHE n 2 9 SER n 2 10 SER n 2 11 GLU n 2 12 GLU n 2 13 ILE n 2 14 ARG n 2 15 GLU n 2 16 ALA n 2 17 ARG n 2 18 GLN n 2 19 ALA n 2 20 ALA n 2 21 ALA n 2 22 SER n 2 23 HIS n 2 24 ALA n 2 25 PRO n 2 26 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 125 Mouse ? 'Map1lc3b, Map1alc3, Map1lc3' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 26 Rat ? Ank3 ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MLP3B_MOUSE Q9CQV6 ? 1 ;MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV ; 1 2 UNP ANK3_RAT O70511 ? 2 PEDDWTEFSSEEIREARQAAASHAPS 1985 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5YIQ A 1 ? 125 ? Q9CQV6 1 ? 125 ? 1 125 2 2 5YIQ D 1 ? 26 ? O70511 1985 ? 2010 ? 120 145 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YIQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10% v/v 2-propanol, 0.2 M zinc acetate, 0.1 M MES buffer (pH 6.5)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5YIQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6417 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.300 _reflns.pdbx_Rmerge_I_obs 0.134 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.959 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.149 _reflns.pdbx_Rpim_I_all 0.064 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.600 2.640 ? 1.9 ? ? ? ? 310 100.000 ? ? ? ? 1.210 ? ? ? ? ? ? ? ? 5.600 ? 1.344 ? ? 1.338 0.563 ? 1 1 0.547 ? 2.640 2.690 ? ? ? ? ? ? 319 100.000 ? ? ? ? 1.000 ? ? ? ? ? ? ? ? 5.300 ? 1.517 ? ? 1.108 0.471 ? 2 1 0.706 ? 2.690 2.740 ? ? ? ? ? ? 295 100.000 ? ? ? ? 1.078 ? ? ? ? ? ? ? ? 5.600 ? 1.452 ? ? 1.189 0.496 ? 3 1 0.667 ? 2.740 2.800 ? ? ? ? ? ? 317 100.000 ? ? ? ? 0.769 ? ? ? ? ? ? ? ? 5.400 ? 1.418 ? ? 0.853 0.362 ? 4 1 0.780 ? 2.800 2.860 ? ? ? ? ? ? 302 100.000 ? ? ? ? 0.725 ? ? ? ? ? ? ? ? 5.600 ? 1.561 ? ? 0.802 0.338 ? 5 1 0.817 ? 2.860 2.930 ? ? ? ? ? ? 322 100.000 ? ? ? ? 0.644 ? ? ? ? ? ? ? ? 5.400 ? 1.474 ? ? 0.714 0.303 ? 6 1 0.858 ? 2.930 3.000 ? ? ? ? ? ? 304 99.700 ? ? ? ? 0.476 ? ? ? ? ? ? ? ? 5.500 ? 1.584 ? ? 0.526 0.222 ? 7 1 0.924 ? 3.000 3.080 ? ? ? ? ? ? 313 100.000 ? ? ? ? 0.414 ? ? ? ? ? ? ? ? 5.500 ? 1.527 ? ? 0.458 0.193 ? 8 1 0.929 ? 3.080 3.170 ? ? ? ? ? ? 311 100.000 ? ? ? ? 0.320 ? ? ? ? ? ? ? ? 5.400 ? 1.577 ? ? 0.355 0.150 ? 9 1 0.957 ? 3.170 3.280 ? ? ? ? ? ? 308 100.000 ? ? ? ? 0.295 ? ? ? ? ? ? ? ? 5.400 ? 1.870 ? ? 0.326 0.139 ? 10 1 0.952 ? 3.280 3.390 ? ? ? ? ? ? 314 100.000 ? ? ? ? 0.210 ? ? ? ? ? ? ? ? 5.400 ? 1.912 ? ? 0.233 0.099 ? 11 1 0.982 ? 3.390 3.530 ? ? ? ? ? ? 316 100.000 ? ? ? ? 0.182 ? ? ? ? ? ? ? ? 5.400 ? 2.098 ? ? 0.202 0.087 ? 12 1 0.979 ? 3.530 3.690 ? ? ? ? ? ? 317 100.000 ? ? ? ? 0.144 ? ? ? ? ? ? ? ? 5.200 ? 2.358 ? ? 0.160 0.068 ? 13 1 0.988 ? 3.690 3.880 ? ? ? ? ? ? 321 100.000 ? ? ? ? 0.131 ? ? ? ? ? ? ? ? 5.200 ? 2.340 ? ? 0.146 0.063 ? 14 1 0.985 ? 3.880 4.130 ? ? ? ? ? ? 324 99.700 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 5.100 ? 2.480 ? ? 0.105 0.045 ? 15 1 0.993 ? 4.130 4.450 ? ? ? ? ? ? 323 99.700 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? 5.100 ? 2.488 ? ? 0.086 0.037 ? 16 1 0.993 ? 4.450 4.890 ? ? ? ? ? ? 330 100.000 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 4.900 ? 2.511 ? ? 0.071 0.031 ? 17 1 0.995 ? 4.890 5.600 ? ? ? ? ? ? 339 99.700 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 5.100 ? 2.398 ? ? 0.078 0.033 ? 18 1 0.996 ? 5.600 7.050 ? ? ? ? ? ? 347 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 5.000 ? 2.685 ? ? 0.087 0.038 ? 19 1 0.994 ? 7.050 50.000 ? ? ? ? ? ? 385 96.000 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 4.300 ? 2.776 ? ? 0.055 0.025 ? 20 1 0.998 ? # _refine.aniso_B[1][1] 0.6100 _refine.aniso_B[1][2] 0.3000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.6100 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -1.9700 _refine.B_iso_max 148.880 _refine.B_iso_mean 53.8550 _refine.B_iso_min 28.600 _refine.correlation_coeff_Fo_to_Fc 0.9460 _refine.correlation_coeff_Fo_to_Fc_free 0.9250 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YIQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6000 _refine.ls_d_res_low 50 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6052 _refine.ls_number_reflns_R_free 314 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.2200 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2194 _refine.ls_R_factor_R_free 0.2589 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2174 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1UGM _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.4430 _refine.pdbx_overall_ESU_R_Free 0.2880 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 12.7670 _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.6000 _refine_hist.d_res_low 50 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 1063 _refine_hist.pdbx_number_residues_total 131 _refine_hist.pdbx_B_iso_mean_ligand 84.06 _refine_hist.pdbx_B_iso_mean_solvent 45.08 _refine_hist.pdbx_number_atoms_protein 1050 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.019 1070 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 980 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.265 1.951 1447 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.950 3.000 2253 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.608 5.000 129 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.059 23.208 53 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.765 15.000 184 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.192 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.075 0.200 164 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.021 1182 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 232 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.6000 _refine_ls_shell.d_res_low 2.6680 _refine_ls_shell.number_reflns_all 438 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 17 _refine_ls_shell.number_reflns_R_work 421 _refine_ls_shell.percent_reflns_obs 94.6000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4420 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3290 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5YIQ _struct.title 'Crystal structure of AnkG LIR/LC3B complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YIQ _struct_keywords.text 'Autophagy, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? ARG A 11 ? THR A 6 ARG A 11 1 ? 6 HELX_P HELX_P2 AA2 SER A 12 ? HIS A 27 ? SER A 12 HIS A 27 1 ? 16 HELX_P HELX_P3 AA3 ASN A 59 ? GLN A 72 ? ASN A 59 GLN A 72 1 ? 14 HELX_P HELX_P4 AA4 PRO A 94 ? ARG A 103 ? PRO A 94 ARG A 103 1 ? 10 HELX_P HELX_P5 AA5 SER B 9 ? ARG B 17 ? SER D 128 ARG D 136 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 27 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 27 A ZN 201 6_554 ? ? ? ? ? ? ? 2.092 ? ? metalc2 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 E ZN . ZN ? ? A ASP 56 A ZN 203 12_554 ? ? ? ? ? ? ? 1.978 ? ? metalc3 metalc ? ? A HIS 57 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 57 A ZN 203 12_554 ? ? ? ? ? ? ? 2.131 ? ? metalc4 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 86 A ZN 201 1_555 ? ? ? ? ? ? ? 1.889 ? ? metalc5 metalc ? ? A GLU 97 OE1 ? ? ? 1_555 E ZN . ZN ? ? A GLU 97 A ZN 203 1_555 ? ? ? ? ? ? ? 2.396 ? ? metalc6 metalc ? ? A GLU 97 OE2 ? ? ? 1_555 E ZN . ZN ? ? A GLU 97 A ZN 203 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc7 metalc ? ? A GLU 100 OE2 ? ? ? 1_555 E ZN . ZN ? ? A GLU 100 A ZN 203 1_555 ? ? ? ? ? ? ? 1.848 ? ? metalc8 metalc ? ? A GLU 102 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 102 A ZN 201 1_555 ? ? ? ? ? ? ? 2.138 ? ? metalc9 metalc ? ? A GLU 105 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 105 A ZN 202 5_555 ? ? ? ? ? ? ? 2.044 ? ? metalc10 metalc ? ? C ZN . ZN ? ? ? 6_554 B GLU 7 OE1 ? ? A ZN 201 D GLU 126 1_555 ? ? ? ? ? ? ? 2.673 ? ? metalc11 metalc ? ? C ZN . ZN ? ? ? 6_554 B GLU 7 OE2 ? ? A ZN 201 D GLU 126 1_555 ? ? ? ? ? ? ? 2.210 ? ? metalc12 metalc ? ? D ZN . ZN ? ? ? 1_555 G HOH . O ? ? A ZN 202 A HOH 301 1_555 ? ? ? ? ? ? ? 1.993 ? ? metalc13 metalc ? ? D ZN . ZN ? ? ? 1_555 G HOH . O ? ? A ZN 202 A HOH 306 6_554 ? ? ? ? ? ? ? 2.237 ? ? metalc14 metalc ? ? B GLU 11 OE1 ? ? ? 1_555 F ZN . ZN ? ? D GLU 130 D ZN 201 1_555 ? ? ? ? ? ? ? 2.454 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 80 ? VAL A 83 ? PHE A 80 VAL A 83 AA1 2 LEU A 109 ? ALA A 114 ? LEU A 109 ALA A 114 AA1 3 ILE A 31 ? ARG A 37 ? ILE A 31 ARG A 37 AA1 4 LYS A 51 ? VAL A 54 ? LYS A 51 VAL A 54 AA1 5 TRP B 5 ? GLU B 7 ? TRP D 124 GLU D 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 80 ? N PHE A 80 O ALA A 114 ? O ALA A 114 AA1 2 3 O LEU A 109 ? O LEU A 109 N ILE A 34 ? N ILE A 34 AA1 3 4 N ILE A 31 ? N ILE A 31 O VAL A 54 ? O VAL A 54 AA1 4 5 N LYS A 51 ? N LYS A 51 O THR B 6 ? O THR D 125 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 6 'binding site for residue ZN A 202' AC3 Software A ZN 203 ? 4 'binding site for residue ZN A 203' AC4 Software D ZN 201 ? 2 'binding site for residue ZN D 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 27 ? HIS A 27 . ? 5_555 ? 2 AC1 4 HIS A 86 ? HIS A 86 . ? 1_555 ? 3 AC1 4 GLU A 102 ? GLU A 102 . ? 1_555 ? 4 AC1 4 GLU B 7 ? GLU D 126 . ? 5_555 ? 5 AC2 6 GLN A 26 ? GLN A 26 . ? 1_555 ? 6 AC2 6 ASP A 104 ? ASP A 104 . ? 6_554 ? 7 AC2 6 GLU A 105 ? GLU A 105 . ? 6_554 ? 8 AC2 6 HOH G . ? HOH A 301 . ? 1_555 ? 9 AC2 6 HOH G . ? HOH A 304 . ? 6_554 ? 10 AC2 6 HOH G . ? HOH A 306 . ? 6_554 ? 11 AC3 4 ASP A 56 ? ASP A 56 . ? 12_554 ? 12 AC3 4 HIS A 57 ? HIS A 57 . ? 12_554 ? 13 AC3 4 GLU A 97 ? GLU A 97 . ? 1_555 ? 14 AC3 4 GLU A 100 ? GLU A 100 . ? 1_555 ? 15 AC4 2 GLU B 11 ? GLU D 130 . ? 1_555 ? 16 AC4 2 GLU B 15 ? GLU D 134 . ? 1_555 ? # _atom_sites.entry_id 5YIQ _atom_sites.fract_transf_matrix[1][1] 0.015491 _atom_sites.fract_transf_matrix[1][2] 0.008944 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017888 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006432 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 GLY 120 120 ? ? ? A . n A 1 121 THR 121 121 ? ? ? A . n A 1 122 ALA 122 122 ? ? ? A . n A 1 123 MET 123 123 ? ? ? A . n A 1 124 ALA 124 124 ? ? ? A . n A 1 125 VAL 125 125 ? ? ? A . n B 2 1 PRO 1 120 ? ? ? D . n B 2 2 GLU 2 121 121 GLU GLU D . n B 2 3 ASP 3 122 122 ASP ASP D . n B 2 4 ASP 4 123 123 ASP ASP D . n B 2 5 TRP 5 124 124 TRP TRP D . n B 2 6 THR 6 125 125 THR THR D . n B 2 7 GLU 7 126 126 GLU GLU D . n B 2 8 PHE 8 127 127 PHE PHE D . n B 2 9 SER 9 128 128 SER SER D . n B 2 10 SER 10 129 129 SER SER D . n B 2 11 GLU 11 130 130 GLU GLU D . n B 2 12 GLU 12 131 131 GLU GLU D . n B 2 13 ILE 13 132 132 ILE ILE D . n B 2 14 ARG 14 133 133 ARG ARG D . n B 2 15 GLU 15 134 134 GLU GLU D . n B 2 16 ALA 16 135 135 ALA ALA D . n B 2 17 ARG 17 136 136 ARG ARG D . n B 2 18 GLN 18 137 ? ? ? D . n B 2 19 ALA 19 138 ? ? ? D . n B 2 20 ALA 20 139 ? ? ? D . n B 2 21 ALA 21 140 ? ? ? D . n B 2 22 SER 22 141 ? ? ? D . n B 2 23 HIS 23 142 ? ? ? D . n B 2 24 ALA 24 143 ? ? ? D . n B 2 25 PRO 25 144 ? ? ? D . n B 2 26 SER 26 145 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 201 1 ZN ZN A . D 3 ZN 1 202 2 ZN ZN A . E 3 ZN 1 203 3 ZN ZN A . F 3 ZN 1 201 4 ZN ZN D . G 4 HOH 1 301 7 HOH HOH A . G 4 HOH 2 302 8 HOH HOH A . G 4 HOH 3 303 2 HOH HOH A . G 4 HOH 4 304 6 HOH HOH A . G 4 HOH 5 305 9 HOH HOH A . G 4 HOH 6 306 5 HOH HOH A . G 4 HOH 7 307 1 HOH HOH A . G 4 HOH 8 308 3 HOH HOH A . G 4 HOH 9 309 4 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1740 ? 1 MORE -86 ? 1 'SSA (A^2)' 7390 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 307 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 6_554 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 79.5 ? 2 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 6_554 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 74.6 ? 3 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 6_554 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 6.2 ? 4 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 6_554 OE1 ? B GLU 7 ? D GLU 126 ? 1_555 156.7 ? 5 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 6_554 OE1 ? B GLU 7 ? D GLU 126 ? 1_555 79.6 ? 6 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 6_554 OE1 ? B GLU 7 ? D GLU 126 ? 1_555 83.8 ? 7 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 6_554 OE2 ? B GLU 7 ? D GLU 126 ? 1_555 106.9 ? 8 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 6_554 OE2 ? B GLU 7 ? D GLU 126 ? 1_555 59.3 ? 9 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 6_554 OE2 ? B GLU 7 ? D GLU 126 ? 1_555 58.3 ? 10 OE1 ? B GLU 7 ? D GLU 126 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 6_554 OE2 ? B GLU 7 ? D GLU 126 ? 1_555 52.6 ? 11 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 12_554 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 95.5 ? 12 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 12_554 OE1 ? A GLU 97 ? A GLU 97 ? 1_555 54.6 ? 13 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 12_554 OE1 ? A GLU 97 ? A GLU 97 ? 1_555 113.5 ? 14 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 12_554 OE2 ? A GLU 97 ? A GLU 97 ? 1_555 55.3 ? 15 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 12_554 OE2 ? A GLU 97 ? A GLU 97 ? 1_555 116.9 ? 16 OE1 ? A GLU 97 ? A GLU 97 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 12_554 OE2 ? A GLU 97 ? A GLU 97 ? 1_555 3.4 ? 17 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 12_554 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 46.7 ? 18 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 12_554 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 122.6 ? 19 OE1 ? A GLU 97 ? A GLU 97 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 12_554 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 14.5 ? 20 OE2 ? A GLU 97 ? A GLU 97 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 12_554 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 12.6 ? 21 OE1 ? A GLU 105 ? A GLU 105 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 5_555 O ? G HOH . ? A HOH 301 ? 1_555 40.8 ? 22 OE1 ? A GLU 105 ? A GLU 105 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 5_555 O ? G HOH . ? A HOH 306 ? 6_554 42.2 ? 23 O ? G HOH . ? A HOH 301 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 5_555 O ? G HOH . ? A HOH 306 ? 6_554 6.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-23 2 'Structure model' 1 1 2018-07-04 3 'Structure model' 1 2 2018-08-01 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Derived calculations' 9 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_struct_special_symmetry 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' pdbx_struct_conn_angle 10 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_DOI' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation_author.identifier_ORCID' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.value' 25 4 'Structure model' '_struct_conn.pdbx_dist_value' 26 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 27 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 28 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 29 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 30 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 31 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 32 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 33 4 'Structure model' '_struct_conn.ptnr1_symmetry' 34 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 35 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 36 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 37 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 38 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 39 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 40 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 41 4 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 68 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 77 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 86 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -160.69 _pdbx_validate_torsion.psi -19.54 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 5 ? CG ? A LYS 5 CG 2 1 Y 1 A LYS 5 ? CD ? A LYS 5 CD 3 1 Y 1 A LYS 5 ? CE ? A LYS 5 CE 4 1 Y 1 A LYS 5 ? NZ ? A LYS 5 NZ 5 1 Y 1 A GLU 14 ? CG ? A GLU 14 CG 6 1 Y 1 A GLU 14 ? CD ? A GLU 14 CD 7 1 Y 1 A GLU 14 ? OE1 ? A GLU 14 OE1 8 1 Y 1 A GLU 14 ? OE2 ? A GLU 14 OE2 9 1 Y 1 A GLN 15 ? CG ? A GLN 15 CG 10 1 Y 1 A GLN 15 ? CD ? A GLN 15 CD 11 1 Y 1 A GLN 15 ? OE1 ? A GLN 15 OE1 12 1 Y 1 A GLN 15 ? NE2 ? A GLN 15 NE2 13 1 Y 1 A ARG 21 ? CG ? A ARG 21 CG 14 1 Y 1 A ARG 21 ? CD ? A ARG 21 CD 15 1 Y 1 A ARG 21 ? NE ? A ARG 21 NE 16 1 Y 1 A ARG 21 ? CZ ? A ARG 21 CZ 17 1 Y 1 A ARG 21 ? NH1 ? A ARG 21 NH1 18 1 Y 1 A ARG 21 ? NH2 ? A ARG 21 NH2 19 1 Y 1 A GLU 25 ? CG ? A GLU 25 CG 20 1 Y 1 A GLU 25 ? CD ? A GLU 25 CD 21 1 Y 1 A GLU 25 ? OE1 ? A GLU 25 OE1 22 1 Y 1 A GLU 25 ? OE2 ? A GLU 25 OE2 23 1 Y 1 A LYS 39 ? CE ? A LYS 39 CE 24 1 Y 1 A LYS 39 ? NZ ? A LYS 39 NZ 25 1 Y 1 A LYS 42 ? CE ? A LYS 42 CE 26 1 Y 1 A LYS 42 ? NZ ? A LYS 42 NZ 27 1 Y 1 A LYS 49 ? CE ? A LYS 49 CE 28 1 Y 1 A LYS 49 ? NZ ? A LYS 49 NZ 29 1 Y 1 A LYS 65 ? CE ? A LYS 65 CE 30 1 Y 1 A LYS 65 ? NZ ? A LYS 65 NZ 31 1 Y 1 A ARG 69 ? CG ? A ARG 69 CG 32 1 Y 1 A ARG 69 ? CD ? A ARG 69 CD 33 1 Y 1 A ARG 69 ? NE ? A ARG 69 NE 34 1 Y 1 A ARG 69 ? CZ ? A ARG 69 CZ 35 1 Y 1 A ARG 69 ? NH1 ? A ARG 69 NH1 36 1 Y 1 A ARG 69 ? NH2 ? A ARG 69 NH2 37 1 Y 1 A GLN 116 ? CG ? A GLN 116 CG 38 1 Y 1 A GLN 116 ? CD ? A GLN 116 CD 39 1 Y 1 A GLN 116 ? OE1 ? A GLN 116 OE1 40 1 Y 1 A GLN 116 ? NE2 ? A GLN 116 NE2 41 1 Y 1 A GLU 117 ? CG ? A GLU 117 CG 42 1 Y 1 A GLU 117 ? CD ? A GLU 117 CD 43 1 Y 1 A GLU 117 ? OE1 ? A GLU 117 OE1 44 1 Y 1 A GLU 117 ? OE2 ? A GLU 117 OE2 45 1 Y 1 D GLU 121 ? CG ? B GLU 2 CG 46 1 Y 1 D GLU 121 ? CD ? B GLU 2 CD 47 1 Y 1 D GLU 121 ? OE1 ? B GLU 2 OE1 48 1 Y 1 D GLU 121 ? OE2 ? B GLU 2 OE2 49 1 Y 1 D ASP 122 ? CG ? B ASP 3 CG 50 1 Y 1 D ASP 122 ? OD1 ? B ASP 3 OD1 51 1 Y 1 D ASP 122 ? OD2 ? B ASP 3 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A GLY 120 ? A GLY 120 6 1 Y 1 A THR 121 ? A THR 121 7 1 Y 1 A ALA 122 ? A ALA 122 8 1 Y 1 A MET 123 ? A MET 123 9 1 Y 1 A ALA 124 ? A ALA 124 10 1 Y 1 A VAL 125 ? A VAL 125 11 1 Y 1 D PRO 120 ? B PRO 1 12 1 Y 1 D GLN 137 ? B GLN 18 13 1 Y 1 D ALA 138 ? B ALA 19 14 1 Y 1 D ALA 139 ? B ALA 20 15 1 Y 1 D ALA 140 ? B ALA 21 16 1 Y 1 D SER 141 ? B SER 22 17 1 Y 1 D HIS 142 ? B HIS 23 18 1 Y 1 D ALA 143 ? B ALA 24 19 1 Y 1 D PRO 144 ? B PRO 25 20 1 Y 1 D SER 145 ? B SER 26 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 ZN ZN ZN N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'Research Grants Council (RGC)' _pdbx_audit_support.country 'Hong Kong' _pdbx_audit_support.grant_number AoE-M09-12 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1UGM _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? #