data_5YIS # _entry.id 5YIS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YIS pdb_00005yis 10.2210/pdb5yis/pdb WWPDB D_1300005361 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YIS _pdbx_database_status.recvd_initial_deposition_date 2017-10-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, J.' 1 0000-0002-8921-1626 'Zhu, R.' 2 ? 'Chen, K.' 3 0000-0003-0321-0604 'Zheng, H.' 4 ? 'Yuan, C.' 5 ? 'Zhang, H.' 6 ? 'Wang, C.' 7 ? 'Zhang, M.' 8 0000-0001-9404-0190 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat. Chem. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 778 _citation.page_last 787 _citation.title 'Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-018-0082-8 _citation.pdbx_database_id_PubMed 29867141 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, J.' 1 0000-0002-8921-1626 primary 'Zhu, R.' 2 0000-0002-5991-1365 primary 'Chen, K.' 3 ? primary 'Zheng, H.' 4 ? primary 'Zhao, H.' 5 ? primary 'Yuan, C.' 6 ? primary 'Zhang, H.' 7 ? primary 'Wang, C.' 8 ? primary 'Zhang, M.' 9 0000-0001-9404-0190 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5YIS _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.802 _cell.length_a_esd ? _cell.length_b 66.866 _cell.length_b_esd ? _cell.length_c 74.148 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YIS _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Microtubule-associated proteins 1A/1B light chain 3B' 14637.859 2 ? ? ? ? 2 polymer man Ankyrin-2 3236.489 2 ? ? 'UNP RESIDUES 1588-1614' ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 5 water nat water 18.015 36 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;Autophagy-related protein LC3 B,Autophagy-related ubiquitin-like modifier LC3 B,MAP1 light chain 3-like protein 2,MAP1A/MAP1B light chain 3 B,MAP1A/MAP1B LC3 B,Microtubule-associated protein 1 light chain 3 beta ; 2 'ANK-2,Ankyrin-B,Brain ankyrin,Non-erythroid ankyrin' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV ; ;MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV ; A,B ? 2 'polypeptide(L)' no no VEEEWVIVSDEEIEEARQKAPLEITEY VEEEWVIVSDEEIEEARQKAPLEITEY D,C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 SER n 1 4 GLU n 1 5 LYS n 1 6 THR n 1 7 PHE n 1 8 LYS n 1 9 GLN n 1 10 ARG n 1 11 ARG n 1 12 SER n 1 13 PHE n 1 14 GLU n 1 15 GLN n 1 16 ARG n 1 17 VAL n 1 18 GLU n 1 19 ASP n 1 20 VAL n 1 21 ARG n 1 22 LEU n 1 23 ILE n 1 24 ARG n 1 25 GLU n 1 26 GLN n 1 27 HIS n 1 28 PRO n 1 29 THR n 1 30 LYS n 1 31 ILE n 1 32 PRO n 1 33 VAL n 1 34 ILE n 1 35 ILE n 1 36 GLU n 1 37 ARG n 1 38 TYR n 1 39 LYS n 1 40 GLY n 1 41 GLU n 1 42 LYS n 1 43 GLN n 1 44 LEU n 1 45 PRO n 1 46 VAL n 1 47 LEU n 1 48 ASP n 1 49 LYS n 1 50 THR n 1 51 LYS n 1 52 PHE n 1 53 LEU n 1 54 VAL n 1 55 PRO n 1 56 ASP n 1 57 HIS n 1 58 VAL n 1 59 ASN n 1 60 MET n 1 61 SER n 1 62 GLU n 1 63 LEU n 1 64 ILE n 1 65 LYS n 1 66 ILE n 1 67 ILE n 1 68 ARG n 1 69 ARG n 1 70 ARG n 1 71 LEU n 1 72 GLN n 1 73 LEU n 1 74 ASN n 1 75 ALA n 1 76 ASN n 1 77 GLN n 1 78 ALA n 1 79 PHE n 1 80 PHE n 1 81 LEU n 1 82 LEU n 1 83 VAL n 1 84 ASN n 1 85 GLY n 1 86 HIS n 1 87 SER n 1 88 MET n 1 89 VAL n 1 90 SER n 1 91 VAL n 1 92 SER n 1 93 THR n 1 94 PRO n 1 95 ILE n 1 96 SER n 1 97 GLU n 1 98 VAL n 1 99 TYR n 1 100 GLU n 1 101 SER n 1 102 GLU n 1 103 ARG n 1 104 ASP n 1 105 GLU n 1 106 ASP n 1 107 GLY n 1 108 PHE n 1 109 LEU n 1 110 TYR n 1 111 MET n 1 112 VAL n 1 113 TYR n 1 114 ALA n 1 115 SER n 1 116 GLN n 1 117 GLU n 1 118 THR n 1 119 PHE n 1 120 GLY n 1 121 THR n 1 122 ALA n 1 123 MET n 1 124 ALA n 1 125 VAL n 2 1 VAL n 2 2 GLU n 2 3 GLU n 2 4 GLU n 2 5 TRP n 2 6 VAL n 2 7 ILE n 2 8 VAL n 2 9 SER n 2 10 ASP n 2 11 GLU n 2 12 GLU n 2 13 ILE n 2 14 GLU n 2 15 GLU n 2 16 ALA n 2 17 ARG n 2 18 GLN n 2 19 LYS n 2 20 ALA n 2 21 PRO n 2 22 LEU n 2 23 GLU n 2 24 ILE n 2 25 THR n 2 26 GLU n 2 27 TYR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 125 Mouse ? 'Map1lc3b, Map1alc3, Map1lc3' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 27 Human ? ANK2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MLP3B_MOUSE Q9CQV6 ? 1 ;MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV ; 1 2 UNP ANK2_HUMAN Q01484 ? 2 VEEEWVIVSDEEIEEARQKAPLEITEY 1588 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5YIS A 1 ? 125 ? Q9CQV6 1 ? 125 ? 1 125 2 1 5YIS B 1 ? 125 ? Q9CQV6 1 ? 125 ? 1 125 3 2 5YIS D 1 ? 27 ? Q01484 1588 ? 1614 ? 120 146 4 2 5YIS C 1 ? 27 ? Q01484 1588 ? 1614 ? 121 146 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YIS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.4 M ammonium phosphate dibasic, 0.1 M Tris buffer (pH 8.5)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-11 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 35.520 _reflns.entry_id 5YIS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16051 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.300 _reflns.pdbx_Rmerge_I_obs 0.111 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.791 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.122 _reflns.pdbx_Rpim_I_all 0.048 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.200 2.240 ? ? ? ? ? ? 778 100.000 ? ? ? ? 0.954 ? ? ? ? ? ? ? ? 6.400 ? 1.392 ? ? 1.040 0.407 ? 1 1 0.809 ? 2.240 2.280 ? ? ? ? ? ? 785 100.000 ? ? ? ? 0.866 ? ? ? ? ? ? ? ? 6.400 ? 1.433 ? ? 0.944 0.370 ? 2 1 0.794 ? 2.280 2.320 ? ? ? ? ? ? 795 100.000 ? ? ? ? 0.706 ? ? ? ? ? ? ? ? 6.400 ? 1.429 ? ? 0.769 0.301 ? 3 1 0.897 ? 2.320 2.370 ? ? ? ? ? ? 799 100.000 ? ? ? ? 0.697 ? ? ? ? ? ? ? ? 6.400 ? 1.486 ? ? 0.759 0.296 ? 4 1 0.884 ? 2.370 2.420 ? ? ? ? ? ? 784 100.000 ? ? ? ? 0.545 ? ? ? ? ? ? ? ? 6.400 ? 1.441 ? ? 0.594 0.232 ? 5 1 0.928 ? 2.420 2.480 ? ? ? ? ? ? 793 100.000 ? ? ? ? 0.497 ? ? ? ? ? ? ? ? 6.300 ? 1.444 ? ? 0.542 0.213 ? 6 1 0.936 ? 2.480 2.540 ? ? ? ? ? ? 802 100.000 ? ? ? ? 0.441 ? ? ? ? ? ? ? ? 6.400 ? 1.464 ? ? 0.480 0.188 ? 7 1 0.945 ? 2.540 2.610 ? ? ? ? ? ? 787 100.000 ? ? ? ? 0.401 ? ? ? ? ? ? ? ? 6.400 ? 1.404 ? ? 0.437 0.172 ? 8 1 0.958 ? 2.610 2.690 ? ? ? ? ? ? 799 100.000 ? ? ? ? 0.328 ? ? ? ? ? ? ? ? 6.400 ? 1.495 ? ? 0.358 0.140 ? 9 1 0.966 ? 2.690 2.770 ? ? ? ? ? ? 796 100.000 ? ? ? ? 0.263 ? ? ? ? ? ? ? ? 6.400 ? 1.511 ? ? 0.287 0.113 ? 10 1 0.976 ? 2.770 2.870 ? ? ? ? ? ? 788 100.000 ? ? ? ? 0.229 ? ? ? ? ? ? ? ? 6.400 ? 1.559 ? ? 0.249 0.097 ? 11 1 0.982 ? 2.870 2.990 ? ? ? ? ? ? 795 99.900 ? ? ? ? 0.181 ? ? ? ? ? ? ? ? 6.300 ? 1.635 ? ? 0.198 0.078 ? 12 1 0.981 ? 2.990 3.120 ? ? ? ? ? ? 822 99.900 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 6.300 ? 1.919 ? ? 0.164 0.065 ? 13 1 0.989 ? 3.120 3.290 ? ? ? ? ? ? 788 99.900 ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 6.200 ? 2.218 ? ? 0.134 0.053 ? 14 1 0.990 ? 3.290 3.490 ? ? ? ? ? ? 807 99.800 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 6.200 ? 2.530 ? ? 0.112 0.045 ? 15 1 0.993 ? 3.490 3.760 ? ? ? ? ? ? 798 99.500 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 5.900 ? 2.779 ? ? 0.086 0.035 ? 16 1 0.997 ? 3.760 4.140 ? ? ? ? ? ? 827 99.400 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 6.000 ? 2.909 ? ? 0.076 0.030 ? 17 1 0.996 ? 4.140 4.740 ? ? ? ? ? ? 814 99.300 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 5.900 ? 2.055 ? ? 0.048 0.019 ? 18 1 0.998 ? 4.740 5.970 ? ? ? ? ? ? 825 98.700 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 6.300 ? 1.791 ? ? 0.045 0.018 ? 19 1 0.998 ? 5.970 50.000 ? ? ? ? ? ? 869 95.400 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 5.800 ? 2.063 ? ? 0.047 0.019 ? 20 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 121.540 _refine.B_iso_mean 44.7684 _refine.B_iso_min 20.420 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YIS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2010 _refine.ls_d_res_low 28.7120 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16013 _refine.ls_number_reflns_R_free 763 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3600 _refine.ls_percent_reflns_R_free 4.7600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1997 _refine.ls_R_factor_R_free 0.2496 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1973 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1UGM _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.1200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2010 _refine_hist.d_res_low 28.7120 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 2214 _refine_hist.pdbx_number_residues_total 274 _refine_hist.pdbx_B_iso_mean_ligand 72.42 _refine_hist.pdbx_B_iso_mean_solvent 38.03 _refine_hist.pdbx_number_atoms_protein 2161 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 2233 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.016 ? 3027 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.063 ? 353 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 386 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 7.152 ? 1599 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_weight 1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 964 12.450 ? ? ? ? ? ? ? 2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 964 12.450 ? ? ? ? ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2013 2.3712 3108 . 153 2955 98.0000 . . . 0.3203 0.0000 0.2633 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.3712 2.6097 3178 . 170 3008 100.0000 . . . 0.3081 0.0000 0.2432 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.6097 2.9869 3180 . 147 3033 100.0000 . . . 0.2746 0.0000 0.2256 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.9869 3.7619 3221 . 130 3091 100.0000 . . . 0.2694 0.0000 0.1990 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.7619 28.7146 3326 . 163 3163 99.0000 . . . 0.2052 0.0000 0.1638 . . . . . . 5 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 5 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 26 and (name N or name CA or name C or name O or name CB )) or resid 27 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 71 through 81 or resid 83 through 111 or resid 113 through 115)) ; 1 2 ;(chain B and (resid 5 through 23 or (resid 24 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 25 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 69 or resid 71 through 73 or (resid 74 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 81 or resid 83 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 through 111 or resid 113 through 115)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A LYS 5 . A PHE 13 . A LYS 5 A PHE 13 ? ;(chain A and (resid 5 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 26 and (name N or name CA or name C or name O or name CB )) or resid 27 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 71 through 81 or resid 83 through 111 or resid 113 through 115)) ; 1 1 2 A GLU 14 . A GLN 15 . A GLU 14 A GLN 15 ? ;(chain A and (resid 5 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 26 and (name N or name CA or name C or name O or name CB )) or resid 27 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 71 through 81 or resid 83 through 111 or resid 113 through 115)) ; 1 1 3 A LYS 5 . A GLU 117 . A LYS 5 A GLU 117 ? ;(chain A and (resid 5 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 26 and (name N or name CA or name C or name O or name CB )) or resid 27 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 71 through 81 or resid 83 through 111 or resid 113 through 115)) ; 1 1 4 A LYS 5 . A GLU 117 . A LYS 5 A GLU 117 ? ;(chain A and (resid 5 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 26 and (name N or name CA or name C or name O or name CB )) or resid 27 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 71 through 81 or resid 83 through 111 or resid 113 through 115)) ; 1 1 5 A LYS 5 . A GLU 117 . A LYS 5 A GLU 117 ? ;(chain A and (resid 5 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 26 and (name N or name CA or name C or name O or name CB )) or resid 27 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 71 through 81 or resid 83 through 111 or resid 113 through 115)) ; 1 1 6 A LYS 5 . A GLU 117 . A LYS 5 A GLU 117 ? ;(chain A and (resid 5 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 26 and (name N or name CA or name C or name O or name CB )) or resid 27 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 71 through 81 or resid 83 through 111 or resid 113 through 115)) ; 1 2 1 B LYS 5 . B ILE 23 . B LYS 5 B ILE 23 ? ;(chain B and (resid 5 through 23 or (resid 24 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 25 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 69 or resid 71 through 73 or (resid 74 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 81 or resid 83 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 through 111 or resid 113 through 115)) ; 1 2 2 B ARG 24 . B ARG 24 . B ARG 24 B ARG 24 ? ;(chain B and (resid 5 through 23 or (resid 24 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 25 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 69 or resid 71 through 73 or (resid 74 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 81 or resid 83 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 through 111 or resid 113 through 115)) ; 1 2 3 B GLU 4 . B VAL 125 . B GLU 4 B VAL 125 ? ;(chain B and (resid 5 through 23 or (resid 24 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 25 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 69 or resid 71 through 73 or (resid 74 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 81 or resid 83 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 through 111 or resid 113 through 115)) ; 1 2 4 B GLU 4 . B VAL 125 . B GLU 4 B VAL 125 ? ;(chain B and (resid 5 through 23 or (resid 24 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 25 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 69 or resid 71 through 73 or (resid 74 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 81 or resid 83 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 through 111 or resid 113 through 115)) ; 1 2 5 B GLU 4 . B VAL 125 . B GLU 4 B VAL 125 ? ;(chain B and (resid 5 through 23 or (resid 24 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 25 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 69 or resid 71 through 73 or (resid 74 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 81 or resid 83 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 through 111 or resid 113 through 115)) ; 1 2 6 B GLU 4 . B VAL 125 . B GLU 4 B VAL 125 ? ;(chain B and (resid 5 through 23 or (resid 24 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 25 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 69 or resid 71 through 73 or (resid 74 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 81 or resid 83 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 through 111 or resid 113 through 115)) ; 1 2 7 B GLU 4 . B VAL 125 . B GLU 4 B VAL 125 ? ;(chain B and (resid 5 through 23 or (resid 24 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 25 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 69 or resid 71 through 73 or (resid 74 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 81 or resid 83 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 through 111 or resid 113 through 115)) ; 1 2 8 B GLU 4 . B VAL 125 . B GLU 4 B VAL 125 ? ;(chain B and (resid 5 through 23 or (resid 24 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 25 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 69 or resid 71 through 73 or (resid 74 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 81 or resid 83 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 through 111 or resid 113 through 115)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 5YIS _struct.title 'Crystal Structure of AnkB LIR/LC3B complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YIS _struct_keywords.text 'Autophagy, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 5 ? I N N 5 ? J N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? ARG A 11 ? THR A 6 ARG A 11 1 ? 6 HELX_P HELX_P2 AA2 SER A 12 ? HIS A 27 ? SER A 12 HIS A 27 1 ? 16 HELX_P HELX_P3 AA3 ASN A 59 ? LEU A 71 ? ASN A 59 LEU A 71 1 ? 13 HELX_P HELX_P4 AA4 PRO A 94 ? ARG A 103 ? PRO A 94 ARG A 103 1 ? 10 HELX_P HELX_P5 AA5 THR B 6 ? ARG B 11 ? THR B 6 ARG B 11 1 ? 6 HELX_P HELX_P6 AA6 SER B 12 ? HIS B 27 ? SER B 12 HIS B 27 1 ? 16 HELX_P HELX_P7 AA7 ASN B 59 ? GLN B 72 ? ASN B 59 GLN B 72 1 ? 14 HELX_P HELX_P8 AA8 PRO B 94 ? ARG B 103 ? PRO B 94 ARG B 103 1 ? 10 HELX_P HELX_P9 AA9 SER B 115 ? MET B 123 ? SER B 115 MET B 123 1 ? 9 HELX_P HELX_P10 AB1 SER C 9 ? GLU C 15 ? SER D 128 GLU D 134 1 ? 7 HELX_P HELX_P11 AB2 SER D 9 ? GLN D 18 ? SER C 128 GLN C 137 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 20 _struct_mon_prot_cis.label_asym_id D _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 139 _struct_mon_prot_cis.auth_asym_id C _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 21 _struct_mon_prot_cis.pdbx_label_asym_id_2 D _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 140 _struct_mon_prot_cis.pdbx_auth_asym_id_2 C _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.76 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 80 ? VAL A 83 ? PHE A 80 VAL A 83 AA1 2 LEU A 109 ? ALA A 114 ? LEU A 109 ALA A 114 AA1 3 ILE A 31 ? ARG A 37 ? ILE A 31 ARG A 37 AA1 4 LYS A 51 ? VAL A 54 ? LYS A 51 VAL A 54 AA1 5 VAL D 6 ? ILE D 7 ? VAL C 125 ILE C 126 AA2 1 PHE B 80 ? VAL B 83 ? PHE B 80 VAL B 83 AA2 2 LEU B 109 ? ALA B 114 ? LEU B 109 ALA B 114 AA2 3 LYS B 30 ? ARG B 37 ? LYS B 30 ARG B 37 AA2 4 LYS B 51 ? PRO B 55 ? LYS B 51 PRO B 55 AA2 5 TRP C 5 ? ILE C 7 ? TRP D 124 ILE D 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 82 ? N LEU A 82 O VAL A 112 ? O VAL A 112 AA1 2 3 O LEU A 109 ? O LEU A 109 N ILE A 34 ? N ILE A 34 AA1 3 4 N ILE A 31 ? N ILE A 31 O VAL A 54 ? O VAL A 54 AA1 4 5 N LEU A 53 ? N LEU A 53 O VAL D 6 ? O VAL C 125 AA2 1 2 N LEU B 82 ? N LEU B 82 O VAL B 112 ? O VAL B 112 AA2 2 3 O LEU B 109 ? O LEU B 109 N ILE B 34 ? N ILE B 34 AA2 3 4 N ILE B 31 ? N ILE B 31 O VAL B 54 ? O VAL B 54 AA2 4 5 N LEU B 53 ? N LEU B 53 O VAL C 6 ? O VAL D 125 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 201 ? 4 'binding site for residue GOL A 201' AC2 Software B GOL 201 ? 5 'binding site for residue GOL B 201' AC3 Software B PO4 202 ? 1 'binding site for residue PO4 B 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 MET A 60 ? MET A 60 . ? 1_555 ? 2 AC1 4 LEU A 81 ? LEU A 81 . ? 1_555 ? 3 AC1 4 MET A 88 ? MET A 88 . ? 1_555 ? 4 AC1 4 VAL A 89 ? VAL A 89 . ? 1_555 ? 5 AC2 5 ILE B 64 ? ILE B 64 . ? 1_555 ? 6 AC2 5 PHE B 80 ? PHE B 80 . ? 1_555 ? 7 AC2 5 LEU B 81 ? LEU B 81 . ? 1_555 ? 8 AC2 5 MET B 88 ? MET B 88 . ? 1_555 ? 9 AC2 5 VAL B 89 ? VAL B 89 . ? 1_555 ? 10 AC3 1 HIS B 27 ? HIS B 27 . ? 1_555 ? # _atom_sites.entry_id 5YIS _atom_sites.fract_transf_matrix[1][1] 0.016181 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014955 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013487 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 THR 118 118 ? ? ? A . n A 1 119 PHE 119 119 ? ? ? A . n A 1 120 GLY 120 120 ? ? ? A . n A 1 121 THR 121 121 ? ? ? A . n A 1 122 ALA 122 122 ? ? ? A . n A 1 123 MET 123 123 ? ? ? A . n A 1 124 ALA 124 124 ? ? ? A . n A 1 125 VAL 125 125 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 PRO 2 2 ? ? ? B . n B 1 3 SER 3 3 ? ? ? B . n B 1 4 GLU 4 4 4 GLU GLU B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 THR 6 6 6 THR THR B . n B 1 7 PHE 7 7 7 PHE PHE B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 GLN 9 9 9 GLN GLN B . n B 1 10 ARG 10 10 10 ARG ARG B . n B 1 11 ARG 11 11 11 ARG ARG B . n B 1 12 SER 12 12 12 SER SER B . n B 1 13 PHE 13 13 13 PHE PHE B . n B 1 14 GLU 14 14 14 GLU GLU B . n B 1 15 GLN 15 15 15 GLN GLN B . n B 1 16 ARG 16 16 16 ARG ARG B . n B 1 17 VAL 17 17 17 VAL VAL B . n B 1 18 GLU 18 18 18 GLU GLU B . n B 1 19 ASP 19 19 19 ASP ASP B . n B 1 20 VAL 20 20 20 VAL VAL B . n B 1 21 ARG 21 21 21 ARG ARG B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 ILE 23 23 23 ILE ILE B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 GLN 26 26 26 GLN GLN B . n B 1 27 HIS 27 27 27 HIS HIS B . n B 1 28 PRO 28 28 28 PRO PRO B . n B 1 29 THR 29 29 29 THR THR B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 ILE 31 31 31 ILE ILE B . n B 1 32 PRO 32 32 32 PRO PRO B . n B 1 33 VAL 33 33 33 VAL VAL B . n B 1 34 ILE 34 34 34 ILE ILE B . n B 1 35 ILE 35 35 35 ILE ILE B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 ARG 37 37 37 ARG ARG B . n B 1 38 TYR 38 38 38 TYR TYR B . n B 1 39 LYS 39 39 39 LYS LYS B . n B 1 40 GLY 40 40 40 GLY GLY B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 GLN 43 43 43 GLN GLN B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 PRO 45 45 45 PRO PRO B . n B 1 46 VAL 46 46 46 VAL VAL B . n B 1 47 LEU 47 47 47 LEU LEU B . n B 1 48 ASP 48 48 48 ASP ASP B . n B 1 49 LYS 49 49 49 LYS LYS B . n B 1 50 THR 50 50 50 THR THR B . n B 1 51 LYS 51 51 51 LYS LYS B . n B 1 52 PHE 52 52 52 PHE PHE B . n B 1 53 LEU 53 53 53 LEU LEU B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 PRO 55 55 55 PRO PRO B . n B 1 56 ASP 56 56 56 ASP ASP B . n B 1 57 HIS 57 57 57 HIS HIS B . n B 1 58 VAL 58 58 58 VAL VAL B . n B 1 59 ASN 59 59 59 ASN ASN B . n B 1 60 MET 60 60 60 MET MET B . n B 1 61 SER 61 61 61 SER SER B . n B 1 62 GLU 62 62 62 GLU GLU B . n B 1 63 LEU 63 63 63 LEU LEU B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 LYS 65 65 65 LYS LYS B . n B 1 66 ILE 66 66 66 ILE ILE B . n B 1 67 ILE 67 67 67 ILE ILE B . n B 1 68 ARG 68 68 68 ARG ARG B . n B 1 69 ARG 69 69 69 ARG ARG B . n B 1 70 ARG 70 70 70 ARG ARG B . n B 1 71 LEU 71 71 71 LEU LEU B . n B 1 72 GLN 72 72 72 GLN GLN B . n B 1 73 LEU 73 73 73 LEU LEU B . n B 1 74 ASN 74 74 74 ASN ASN B . n B 1 75 ALA 75 75 75 ALA ALA B . n B 1 76 ASN 76 76 76 ASN ASN B . n B 1 77 GLN 77 77 77 GLN GLN B . n B 1 78 ALA 78 78 78 ALA ALA B . n B 1 79 PHE 79 79 79 PHE PHE B . n B 1 80 PHE 80 80 80 PHE PHE B . n B 1 81 LEU 81 81 81 LEU LEU B . n B 1 82 LEU 82 82 82 LEU LEU B . n B 1 83 VAL 83 83 83 VAL VAL B . n B 1 84 ASN 84 84 84 ASN ASN B . n B 1 85 GLY 85 85 85 GLY GLY B . n B 1 86 HIS 86 86 86 HIS HIS B . n B 1 87 SER 87 87 87 SER SER B . n B 1 88 MET 88 88 88 MET MET B . n B 1 89 VAL 89 89 89 VAL VAL B . n B 1 90 SER 90 90 90 SER SER B . n B 1 91 VAL 91 91 91 VAL VAL B . n B 1 92 SER 92 92 92 SER SER B . n B 1 93 THR 93 93 93 THR THR B . n B 1 94 PRO 94 94 94 PRO PRO B . n B 1 95 ILE 95 95 95 ILE ILE B . n B 1 96 SER 96 96 96 SER SER B . n B 1 97 GLU 97 97 97 GLU GLU B . n B 1 98 VAL 98 98 98 VAL VAL B . n B 1 99 TYR 99 99 99 TYR TYR B . n B 1 100 GLU 100 100 100 GLU GLU B . n B 1 101 SER 101 101 101 SER SER B . n B 1 102 GLU 102 102 102 GLU GLU B . n B 1 103 ARG 103 103 103 ARG ARG B . n B 1 104 ASP 104 104 104 ASP ASP B . n B 1 105 GLU 105 105 105 GLU GLU B . n B 1 106 ASP 106 106 106 ASP ASP B . n B 1 107 GLY 107 107 107 GLY GLY B . n B 1 108 PHE 108 108 108 PHE PHE B . n B 1 109 LEU 109 109 109 LEU LEU B . n B 1 110 TYR 110 110 110 TYR TYR B . n B 1 111 MET 111 111 111 MET MET B . n B 1 112 VAL 112 112 112 VAL VAL B . n B 1 113 TYR 113 113 113 TYR TYR B . n B 1 114 ALA 114 114 114 ALA ALA B . n B 1 115 SER 115 115 115 SER SER B . n B 1 116 GLN 116 116 116 GLN GLN B . n B 1 117 GLU 117 117 117 GLU GLU B . n B 1 118 THR 118 118 118 THR THR B . n B 1 119 PHE 119 119 119 PHE PHE B . n B 1 120 GLY 120 120 120 GLY GLY B . n B 1 121 THR 121 121 121 THR THR B . n B 1 122 ALA 122 122 122 ALA ALA B . n B 1 123 MET 123 123 123 MET MET B . n B 1 124 ALA 124 124 124 ALA ALA B . n B 1 125 VAL 125 125 125 VAL VAL B . n C 2 1 VAL 1 120 ? ? ? D . n C 2 2 GLU 2 121 ? ? ? D . n C 2 3 GLU 3 122 122 GLU GLU D . n C 2 4 GLU 4 123 123 GLU GLU D . n C 2 5 TRP 5 124 124 TRP TRP D . n C 2 6 VAL 6 125 125 VAL VAL D . n C 2 7 ILE 7 126 126 ILE ILE D . n C 2 8 VAL 8 127 127 VAL VAL D . n C 2 9 SER 9 128 128 SER SER D . n C 2 10 ASP 10 129 129 ASP ASP D . n C 2 11 GLU 11 130 130 GLU GLU D . n C 2 12 GLU 12 131 131 GLU GLU D . n C 2 13 ILE 13 132 132 ILE ILE D . n C 2 14 GLU 14 133 133 GLU GLU D . n C 2 15 GLU 15 134 134 GLU GLU D . n C 2 16 ALA 16 135 ? ? ? D . n C 2 17 ARG 17 136 ? ? ? D . n C 2 18 GLN 18 137 ? ? ? D . n C 2 19 LYS 19 138 ? ? ? D . n C 2 20 ALA 20 139 ? ? ? D . n C 2 21 PRO 21 140 ? ? ? D . n C 2 22 LEU 22 141 ? ? ? D . n C 2 23 GLU 23 142 ? ? ? D . n C 2 24 ILE 24 143 ? ? ? D . n C 2 25 THR 25 144 ? ? ? D . n C 2 26 GLU 26 145 ? ? ? D . n C 2 27 TYR 27 146 ? ? ? D . n D 2 1 VAL 1 121 121 VAL VAL C . n D 2 2 GLU 2 121 121 GLU GLU C A n D 2 3 GLU 3 122 122 GLU GLU C . n D 2 4 GLU 4 123 123 GLU GLU C . n D 2 5 TRP 5 124 124 TRP TRP C . n D 2 6 VAL 6 125 125 VAL VAL C . n D 2 7 ILE 7 126 126 ILE ILE C . n D 2 8 VAL 8 127 127 VAL VAL C . n D 2 9 SER 9 128 128 SER SER C . n D 2 10 ASP 10 129 129 ASP ASP C . n D 2 11 GLU 11 130 130 GLU GLU C . n D 2 12 GLU 12 131 131 GLU GLU C . n D 2 13 ILE 13 132 132 ILE ILE C . n D 2 14 GLU 14 133 133 GLU GLU C . n D 2 15 GLU 15 134 134 GLU GLU C . n D 2 16 ALA 16 135 135 ALA ALA C . n D 2 17 ARG 17 136 136 ARG ARG C . n D 2 18 GLN 18 137 137 GLN GLN C . n D 2 19 LYS 19 138 138 LYS LYS C . n D 2 20 ALA 20 139 139 ALA ALA C . n D 2 21 PRO 21 140 140 PRO PRO C . n D 2 22 LEU 22 141 141 LEU LEU C . n D 2 23 GLU 23 142 142 GLU GLU C . n D 2 24 ILE 24 143 143 ILE ILE C . n D 2 25 THR 25 144 144 THR THR C . n D 2 26 GLU 26 145 145 GLU GLU C . n D 2 27 TYR 27 146 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 GOL 1 201 2 GOL GOL A . F 3 GOL 1 201 1 GOL GOL B . G 4 PO4 1 202 1 PO4 PO4 B . H 5 HOH 1 301 2 HOH HOH A . H 5 HOH 2 302 23 HOH HOH A . H 5 HOH 3 303 36 HOH HOH A . H 5 HOH 4 304 15 HOH HOH A . H 5 HOH 5 305 9 HOH HOH A . H 5 HOH 6 306 34 HOH HOH A . H 5 HOH 7 307 35 HOH HOH A . H 5 HOH 8 308 27 HOH HOH A . H 5 HOH 9 309 25 HOH HOH A . H 5 HOH 10 310 12 HOH HOH A . H 5 HOH 11 311 19 HOH HOH A . H 5 HOH 12 312 31 HOH HOH A . H 5 HOH 13 313 17 HOH HOH A . H 5 HOH 14 314 18 HOH HOH A . H 5 HOH 15 315 10 HOH HOH A . H 5 HOH 16 316 33 HOH HOH A . H 5 HOH 17 317 8 HOH HOH A . I 5 HOH 1 301 26 HOH HOH B . I 5 HOH 2 302 3 HOH HOH B . I 5 HOH 3 303 28 HOH HOH B . I 5 HOH 4 304 30 HOH HOH B . I 5 HOH 5 305 6 HOH HOH B . I 5 HOH 6 306 13 HOH HOH B . I 5 HOH 7 307 7 HOH HOH B . I 5 HOH 8 308 11 HOH HOH B . I 5 HOH 9 309 20 HOH HOH B . I 5 HOH 10 310 1 HOH HOH B . I 5 HOH 11 311 29 HOH HOH B . I 5 HOH 12 312 21 HOH HOH B . I 5 HOH 13 313 14 HOH HOH B . I 5 HOH 14 314 4 HOH HOH B . J 5 HOH 1 201 32 HOH HOH C . J 5 HOH 2 202 16 HOH HOH C . J 5 HOH 3 203 22 HOH HOH C . J 5 HOH 4 204 24 HOH HOH C . J 5 HOH 5 205 5 HOH HOH C . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D,E,H,J 2 1 B,C,F,G,I # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2070 ? 1 MORE -10 ? 1 'SSA (A^2)' 8090 ? 2 'ABSA (A^2)' 1570 ? 2 MORE -16 ? 2 'SSA (A^2)' 7720 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-23 2 'Structure model' 1 1 2018-07-04 3 'Structure model' 1 2 2018-08-01 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_DOI' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation_author.identifier_ORCID' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' 11 4 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 12 4 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 13 4 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 14 4 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 15 4 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 16 4 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 17 4 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 18 4 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 4.1481 74.2643 12.5927 0.2633 0.2323 0.2988 0.0304 0.0163 0.0062 4.3975 2.2454 4.4503 -0.1162 1.5238 -2.0168 0.0509 -0.0886 -0.0445 0.3293 -0.0742 0.1522 -0.1591 -0.2605 -0.0703 'X-RAY DIFFRACTION' 2 ? refined 9.5625 83.9985 29.3438 0.9325 0.1831 0.5945 0.1399 -0.0987 -0.1212 3.9484 2.9498 4.4889 1.0912 3.0038 0.1254 -0.0507 0.4005 0.1251 -1.3373 0.8600 0.0303 1.2015 -1.5826 -0.6968 'X-RAY DIFFRACTION' 3 ? refined 14.6568 71.3711 27.9700 0.3310 0.3036 0.3423 0.0590 0.0083 -0.0157 5.0747 2.8029 4.2444 -2.0426 -0.9907 -0.4546 -0.2467 0.4409 -0.1919 -0.5359 0.2800 -0.2218 0.3645 -0.4908 0.1775 'X-RAY DIFFRACTION' 4 ? refined 2.7667 67.1971 28.1873 0.3696 0.3707 0.3776 0.0770 0.1005 0.0341 2.6981 2.9592 4.8276 0.2920 2.5686 -0.2156 -0.3337 0.2250 0.1138 -0.6893 -0.2621 0.5450 0.6921 -0.0934 -0.8507 'X-RAY DIFFRACTION' 5 ? refined 1.8636 73.8686 23.5434 0.3186 0.2892 0.2475 0.0817 0.0347 -0.0067 3.0121 3.2333 6.0055 -0.7759 0.6977 0.5675 -0.2433 0.3855 -0.0278 -0.4695 -0.0179 0.1896 0.5233 0.0567 -0.1669 'X-RAY DIFFRACTION' 6 ? refined 31.0362 58.5789 20.5149 0.4365 0.3744 0.4594 -0.0176 0.0487 0.0031 5.9745 7.1386 8.6117 -0.0307 1.4511 -1.3661 -0.7632 -0.0278 0.7231 0.0180 -0.2130 -0.6679 -0.3119 -0.0512 0.8664 'X-RAY DIFFRACTION' 7 ? refined 25.1976 51.5629 9.5528 0.7475 0.6676 0.3616 -0.0515 0.1637 -0.0708 3.7055 4.4514 2.7321 0.8453 1.5399 0.3810 -0.0658 0.5873 -0.3844 1.4426 -0.2822 -0.6274 -1.5667 -0.0783 0.6527 'X-RAY DIFFRACTION' 8 ? refined 27.5346 49.1049 27.2504 0.2217 0.3833 0.2686 0.0553 -0.0195 -0.0608 1.7339 2.7474 4.5201 0.7818 1.2442 0.6345 -0.0662 0.2503 -0.2095 0.0353 -0.2185 -0.3867 -0.1022 0.1190 0.3654 'X-RAY DIFFRACTION' 9 ? refined 20.9471 40.7190 20.1803 0.3529 0.3563 0.3627 0.0613 -0.0472 -0.0948 7.3847 3.9153 4.8763 0.2592 -1.7268 -1.2584 0.6620 -0.0909 -0.5211 0.8870 0.0246 0.2739 -0.2494 0.8719 0.4452 'X-RAY DIFFRACTION' 10 ? refined 24.3124 40.2109 30.0414 0.3998 0.3337 0.3673 0.0449 -0.0784 0.0184 5.6394 4.6415 3.3037 2.5411 1.3567 1.0375 0.5724 -0.3057 -0.1214 -0.2956 0.1857 -0.0154 0.4061 0.9493 0.2606 'X-RAY DIFFRACTION' 11 ? refined 23.3872 45.9718 36.0909 0.4528 0.4798 0.3620 -0.0693 -0.0765 0.0520 4.6938 4.1990 2.7841 -1.8336 0.0507 -0.5697 -0.1655 -0.1160 0.2338 -0.2985 -0.3024 -0.3384 1.0678 0.1247 0.4948 'X-RAY DIFFRACTION' 12 ? refined 12.3709 47.4157 25.2685 0.2348 0.2910 0.3237 0.0072 -0.0087 -0.0193 1.7142 3.3929 0.9396 1.0163 -0.8211 -0.1145 -0.1274 0.0238 -0.0173 0.0241 0.3148 0.2780 0.1807 -0.0239 -0.2260 'X-RAY DIFFRACTION' 13 ? refined 19.0312 55.1546 16.0384 0.4463 0.3961 0.3422 -0.0561 0.0200 0.0288 4.1134 3.3202 3.4674 -3.1121 -2.9607 1.8103 0.0370 0.3415 -0.4215 -0.3595 0.5426 -0.2253 -1.2708 -0.6021 0.5474 'X-RAY DIFFRACTION' 14 ? refined 20.7027 54.0253 36.4359 0.2620 0.3938 0.2858 0.0435 -0.0247 -0.0176 1.3610 3.0578 4.6339 0.6426 1.3575 -0.3283 0.0032 0.0480 -0.0290 -0.2711 0.0869 0.1072 0.4180 -0.0301 -0.6735 'X-RAY DIFFRACTION' 15 ? refined 29.6515 42.0431 17.9791 0.4100 0.4878 0.7753 0.2284 0.1154 -0.1666 2.8132 1.3570 6.1548 -0.9668 -0.0798 -2.4938 0.1771 -0.3423 -0.2041 0.8754 -0.6936 0.1529 0.1530 -0.2214 -0.0017 'X-RAY DIFFRACTION' 16 ? refined 23.8109 31.2281 23.4502 0.7069 0.6024 1.9072 0.0916 0.1369 0.0205 6.9216 4.2883 6.0054 -0.3020 3.4602 1.6197 0.6119 0.5469 -0.8739 -0.2893 -2.0042 1.4493 0.7908 1.3140 0.2416 'X-RAY DIFFRACTION' 17 ? refined 15.6659 75.8851 12.7860 0.3022 0.4044 0.3844 0.0090 -0.0444 0.0746 1.1409 1.9984 4.2501 -0.7846 1.0287 -1.6846 -0.1233 -0.1711 0.2245 0.1678 0.6690 -0.1797 -0.3378 -0.0205 0.5998 'X-RAY DIFFRACTION' 18 ? refined 21.7368 64.8851 25.4081 0.2654 0.4590 0.4436 0.0258 0.0240 0.0706 5.4328 7.3624 7.5792 3.1522 -0.4968 -4.4111 -0.6398 -0.1823 0.7255 0.0849 -0.4242 -1.0843 -0.2865 0.3581 0.7101 'X-RAY DIFFRACTION' 19 ? refined 15.8332 59.7660 34.9026 0.5430 0.7581 0.4148 0.1789 0.0314 -0.0691 4.3389 4.4086 3.1887 -1.3239 1.6417 -3.2116 -1.0216 0.5078 0.5204 -0.2057 -0.2022 -0.1952 0.4514 -0.6622 -0.8830 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 5 A 37 ;chain 'A' and (resid 5 through 37 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 38 A 50 ;chain 'A' and (resid 38 through 50 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 51 A 79 ;chain 'A' and (resid 51 through 79 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 80 A 102 ;chain 'A' and (resid 80 through 102 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 103 A 117 ;chain 'A' and (resid 103 through 117 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 B 4 B 12 ;chain 'B' and (resid 4 through 12 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 B 13 B 26 ;chain 'B' and (resid 13 through 26 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 B 27 B 50 ;chain 'B' and (resid 27 through 50 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 B 51 B 59 ;chain 'B' and (resid 51 through 59 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 B 60 B 71 ;chain 'B' and (resid 60 through 71 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 11 11 B 72 B 85 ;chain 'B' and (resid 72 through 85 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 12 12 B 86 B 102 ;chain 'B' and (resid 86 through 102 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 13 13 B 103 B 108 ;chain 'B' and (resid 103 through 108 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 14 14 B 109 B 125 ;chain 'B' and (resid 109 through 125 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 15 15 D 122 D 128 ;chain 'D' and (resid 122 through 128 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 16 16 D 129 D 134 ;chain 'D' and (resid 129 through 134 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 17 17 C 121 C 128 ;chain 'C' and (resid 121 through 128 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 18 18 C 129 C 136 ;chain 'C' and (resid 129 through 136 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 19 19 C 137 C 145 ;chain 'C' and (resid 137 through 145 ) ; ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 104 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.05 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 82 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 B _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 82 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 B _pdbx_validate_rmsd_angle.auth_atom_id_3 CD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 82 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 B _pdbx_validate_rmsd_angle.angle_value 99.73 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -11.27 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 86 ? ? -137.22 -45.23 2 1 PHE B 79 ? ? -167.47 119.30 3 1 HIS B 86 ? ? -149.02 -16.17 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 5 ? CG ? A LYS 5 CG 2 1 Y 1 A LYS 5 ? CD ? A LYS 5 CD 3 1 Y 1 A LYS 5 ? CE ? A LYS 5 CE 4 1 Y 1 A LYS 5 ? NZ ? A LYS 5 NZ 5 1 Y 1 A ARG 24 ? NE ? A ARG 24 NE 6 1 Y 1 A ARG 24 ? CZ ? A ARG 24 CZ 7 1 Y 1 A ARG 24 ? NH1 ? A ARG 24 NH1 8 1 Y 1 A ARG 24 ? NH2 ? A ARG 24 NH2 9 1 Y 1 A LYS 39 ? CG ? A LYS 39 CG 10 1 Y 1 A LYS 39 ? CD ? A LYS 39 CD 11 1 Y 1 A LYS 39 ? CE ? A LYS 39 CE 12 1 Y 1 A LYS 39 ? NZ ? A LYS 39 NZ 13 1 Y 1 A LYS 42 ? CG ? A LYS 42 CG 14 1 Y 1 A LYS 42 ? CD ? A LYS 42 CD 15 1 Y 1 A LYS 42 ? CE ? A LYS 42 CE 16 1 Y 1 A LYS 42 ? NZ ? A LYS 42 NZ 17 1 Y 1 A ASP 48 ? CG ? A ASP 48 CG 18 1 Y 1 A ASP 48 ? OD1 ? A ASP 48 OD1 19 1 Y 1 A ASP 48 ? OD2 ? A ASP 48 OD2 20 1 Y 1 A LYS 49 ? CG ? A LYS 49 CG 21 1 Y 1 A LYS 49 ? CD ? A LYS 49 CD 22 1 Y 1 A LYS 49 ? CE ? A LYS 49 CE 23 1 Y 1 A LYS 49 ? NZ ? A LYS 49 NZ 24 1 Y 1 A ARG 69 ? NE ? A ARG 69 NE 25 1 Y 1 A ARG 69 ? CZ ? A ARG 69 CZ 26 1 Y 1 A ARG 69 ? NH1 ? A ARG 69 NH1 27 1 Y 1 A ARG 69 ? NH2 ? A ARG 69 NH2 28 1 Y 1 A ASN 74 ? CG ? A ASN 74 CG 29 1 Y 1 A ASN 74 ? OD1 ? A ASN 74 OD1 30 1 Y 1 A ASN 74 ? ND2 ? A ASN 74 ND2 31 1 Y 1 A ASN 76 ? CG ? A ASN 76 CG 32 1 Y 1 A ASN 76 ? OD1 ? A ASN 76 OD1 33 1 Y 1 A ASN 76 ? ND2 ? A ASN 76 ND2 34 1 Y 1 A GLN 77 ? CG ? A GLN 77 CG 35 1 Y 1 A GLN 77 ? CD ? A GLN 77 CD 36 1 Y 1 A GLN 77 ? OE1 ? A GLN 77 OE1 37 1 Y 1 A GLN 77 ? NE2 ? A GLN 77 NE2 38 1 Y 1 A GLU 97 ? CG ? A GLU 97 CG 39 1 Y 1 A GLU 97 ? CD ? A GLU 97 CD 40 1 Y 1 A GLU 97 ? OE1 ? A GLU 97 OE1 41 1 Y 1 A GLU 97 ? OE2 ? A GLU 97 OE2 42 1 Y 1 A GLU 100 ? CG ? A GLU 100 CG 43 1 Y 1 A GLU 100 ? CD ? A GLU 100 CD 44 1 Y 1 A GLU 100 ? OE1 ? A GLU 100 OE1 45 1 Y 1 A GLU 100 ? OE2 ? A GLU 100 OE2 46 1 Y 1 A GLU 117 ? CG ? A GLU 117 CG 47 1 Y 1 A GLU 117 ? CD ? A GLU 117 CD 48 1 Y 1 A GLU 117 ? OE1 ? A GLU 117 OE1 49 1 Y 1 A GLU 117 ? OE2 ? A GLU 117 OE2 50 1 Y 1 B GLU 4 ? CG ? B GLU 4 CG 51 1 Y 1 B GLU 4 ? CD ? B GLU 4 CD 52 1 Y 1 B GLU 4 ? OE1 ? B GLU 4 OE1 53 1 Y 1 B GLU 4 ? OE2 ? B GLU 4 OE2 54 1 Y 1 B LYS 5 ? CG ? B LYS 5 CG 55 1 Y 1 B LYS 5 ? CD ? B LYS 5 CD 56 1 Y 1 B LYS 5 ? CE ? B LYS 5 CE 57 1 Y 1 B LYS 5 ? NZ ? B LYS 5 NZ 58 1 Y 1 B GLU 14 ? CG ? B GLU 14 CG 59 1 Y 1 B GLU 14 ? CD ? B GLU 14 CD 60 1 Y 1 B GLU 14 ? OE1 ? B GLU 14 OE1 61 1 Y 1 B GLU 14 ? OE2 ? B GLU 14 OE2 62 1 Y 1 B GLN 15 ? CG ? B GLN 15 CG 63 1 Y 1 B GLN 15 ? CD ? B GLN 15 CD 64 1 Y 1 B GLN 15 ? OE1 ? B GLN 15 OE1 65 1 Y 1 B GLN 15 ? NE2 ? B GLN 15 NE2 66 1 Y 1 B GLN 26 ? CG ? B GLN 26 CG 67 1 Y 1 B GLN 26 ? CD ? B GLN 26 CD 68 1 Y 1 B GLN 26 ? OE1 ? B GLN 26 OE1 69 1 Y 1 B GLN 26 ? NE2 ? B GLN 26 NE2 70 1 Y 1 B LYS 49 ? CE ? B LYS 49 CE 71 1 Y 1 B LYS 49 ? NZ ? B LYS 49 NZ 72 1 Y 1 B LYS 65 ? CE ? B LYS 65 CE 73 1 Y 1 B LYS 65 ? NZ ? B LYS 65 NZ 74 1 Y 1 B ARG 69 ? CG ? B ARG 69 CG 75 1 Y 1 B ARG 69 ? CD ? B ARG 69 CD 76 1 Y 1 B ARG 69 ? NE ? B ARG 69 NE 77 1 Y 1 B ARG 69 ? CZ ? B ARG 69 CZ 78 1 Y 1 B ARG 69 ? NH1 ? B ARG 69 NH1 79 1 Y 1 B ARG 69 ? NH2 ? B ARG 69 NH2 80 1 Y 1 B GLU 100 ? CG ? B GLU 100 CG 81 1 Y 1 B GLU 100 ? CD ? B GLU 100 CD 82 1 Y 1 B GLU 100 ? OE1 ? B GLU 100 OE1 83 1 Y 1 B GLU 100 ? OE2 ? B GLU 100 OE2 84 1 Y 1 D GLU 122 ? CG ? C GLU 3 CG 85 1 Y 1 D GLU 122 ? CD ? C GLU 3 CD 86 1 Y 1 D GLU 122 ? OE1 ? C GLU 3 OE1 87 1 Y 1 D GLU 122 ? OE2 ? C GLU 3 OE2 88 1 Y 1 D GLU 123 ? CG ? C GLU 4 CG 89 1 Y 1 D GLU 123 ? CD ? C GLU 4 CD 90 1 Y 1 D GLU 123 ? OE1 ? C GLU 4 OE1 91 1 Y 1 D GLU 123 ? OE2 ? C GLU 4 OE2 92 1 Y 1 D ASP 129 ? CG ? C ASP 10 CG 93 1 Y 1 D ASP 129 ? OD1 ? C ASP 10 OD1 94 1 Y 1 D ASP 129 ? OD2 ? C ASP 10 OD2 95 1 Y 1 D GLU 130 ? CG ? C GLU 11 CG 96 1 Y 1 D GLU 130 ? CD ? C GLU 11 CD 97 1 Y 1 D GLU 130 ? OE1 ? C GLU 11 OE1 98 1 Y 1 D GLU 130 ? OE2 ? C GLU 11 OE2 99 1 Y 1 D GLU 133 ? CG ? C GLU 14 CG 100 1 Y 1 D GLU 133 ? CD ? C GLU 14 CD 101 1 Y 1 D GLU 133 ? OE1 ? C GLU 14 OE1 102 1 Y 1 D GLU 133 ? OE2 ? C GLU 14 OE2 103 1 Y 1 D GLU 134 ? CG ? C GLU 15 CG 104 1 Y 1 D GLU 134 ? CD ? C GLU 15 CD 105 1 Y 1 D GLU 134 ? OE1 ? C GLU 15 OE1 106 1 Y 1 D GLU 134 ? OE2 ? C GLU 15 OE2 107 1 Y 1 C GLU 130 ? CG ? D GLU 11 CG 108 1 Y 1 C GLU 130 ? CD ? D GLU 11 CD 109 1 Y 1 C GLU 130 ? OE1 ? D GLU 11 OE1 110 1 Y 1 C GLU 130 ? OE2 ? D GLU 11 OE2 111 1 Y 1 C GLU 134 ? CG ? D GLU 15 CG 112 1 Y 1 C GLU 134 ? CD ? D GLU 15 CD 113 1 Y 1 C GLU 134 ? OE1 ? D GLU 15 OE1 114 1 Y 1 C GLU 134 ? OE2 ? D GLU 15 OE2 115 1 Y 1 C LYS 138 ? CE ? D LYS 19 CE 116 1 Y 1 C LYS 138 ? NZ ? D LYS 19 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A THR 118 ? A THR 118 6 1 Y 1 A PHE 119 ? A PHE 119 7 1 Y 1 A GLY 120 ? A GLY 120 8 1 Y 1 A THR 121 ? A THR 121 9 1 Y 1 A ALA 122 ? A ALA 122 10 1 Y 1 A MET 123 ? A MET 123 11 1 Y 1 A ALA 124 ? A ALA 124 12 1 Y 1 A VAL 125 ? A VAL 125 13 1 Y 1 B MET 1 ? B MET 1 14 1 Y 1 B PRO 2 ? B PRO 2 15 1 Y 1 B SER 3 ? B SER 3 16 1 Y 1 D VAL 120 ? C VAL 1 17 1 Y 1 D GLU 121 ? C GLU 2 18 1 Y 1 D ALA 135 ? C ALA 16 19 1 Y 1 D ARG 136 ? C ARG 17 20 1 Y 1 D GLN 137 ? C GLN 18 21 1 Y 1 D LYS 138 ? C LYS 19 22 1 Y 1 D ALA 139 ? C ALA 20 23 1 Y 1 D PRO 140 ? C PRO 21 24 1 Y 1 D LEU 141 ? C LEU 22 25 1 Y 1 D GLU 142 ? C GLU 23 26 1 Y 1 D ILE 143 ? C ILE 24 27 1 Y 1 D THR 144 ? C THR 25 28 1 Y 1 D GLU 145 ? C GLU 26 29 1 Y 1 D TYR 146 ? C TYR 27 30 1 Y 1 C TYR 146 ? D TYR 27 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PO4 P P N N 273 PO4 O1 O N N 274 PO4 O2 O N N 275 PO4 O3 O N N 276 PO4 O4 O N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PO4 P O1 doub N N 260 PO4 P O2 sing N N 261 PO4 P O3 sing N N 262 PO4 P O4 sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_audit_support.funding_organization 'Research Grants Council (RGC)' _pdbx_audit_support.country 'Hong Kong' _pdbx_audit_support.grant_number AoE-M09-12 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 'PHOSPHATE ION' PO4 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1UGM _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? #