data_5YJM # _entry.id 5YJM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5YJM WWPDB D_1300005403 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YJM _pdbx_database_status.recvd_initial_deposition_date 2017-10-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Sugawara, H.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Bioorg. Med. Chem. Lett.' _citation.journal_id_ASTM BMCLE8 _citation.journal_id_CSD 1127 _citation.journal_id_ISSN 1464-3405 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 28 _citation.language ? _citation.page_first 188 _citation.page_last 192 _citation.title 'Structure-based design, synthesis, and binding mode analysis of novel and potent chymase inhibitors' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2017.11.031 _citation.pdbx_database_id_PubMed 29191554 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Futamura-Takahashi, J.' 1 ? primary 'Tanaka, T.' 2 ? primary 'Sugawara, H.' 3 ? primary 'Iwashita, S.' 4 ? primary 'Imajo, S.' 5 ? primary 'Oyama, Y.' 6 ? primary 'Muto, T.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5YJM _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.089 _cell.length_a_esd ? _cell.length_b 75.089 _cell.length_b_esd ? _cell.length_c 49.750 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YJM _symmetry.cell_setting ? _symmetry.Int_Tables_number 78 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'human chymase' 25032.910 1 ? ? ? ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn '2-amino-4-((R)-1-((R,Z)-6-(5-chloro-2-methoxybenzyl)-7-oxo-3-(phenoxyimino)-1,4-diazepane-1-carboxamido)propyl)benzoic acid' 594.058 1 ? ? ? ? 5 water nat water 18.015 88 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IIGGTESKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPK YNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDF DHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN ; _entity_poly.pdbx_seq_one_letter_code_can ;IIGGTESKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPK YNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDF DHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 ILE n 1 3 GLY n 1 4 GLY n 1 5 THR n 1 6 GLU n 1 7 SER n 1 8 LYS n 1 9 PRO n 1 10 HIS n 1 11 SER n 1 12 ARG n 1 13 PRO n 1 14 TYR n 1 15 MET n 1 16 ALA n 1 17 TYR n 1 18 LEU n 1 19 GLU n 1 20 ILE n 1 21 VAL n 1 22 THR n 1 23 SER n 1 24 ASN n 1 25 GLY n 1 26 PRO n 1 27 SER n 1 28 LYS n 1 29 PHE n 1 30 CYS n 1 31 GLY n 1 32 GLY n 1 33 PHE n 1 34 LEU n 1 35 ILE n 1 36 ARG n 1 37 ARG n 1 38 ASN n 1 39 PHE n 1 40 VAL n 1 41 LEU n 1 42 THR n 1 43 ALA n 1 44 ALA n 1 45 HIS n 1 46 CYS n 1 47 ALA n 1 48 GLY n 1 49 ARG n 1 50 SER n 1 51 ILE n 1 52 THR n 1 53 VAL n 1 54 THR n 1 55 LEU n 1 56 GLY n 1 57 ALA n 1 58 HIS n 1 59 ASN n 1 60 ILE n 1 61 THR n 1 62 GLU n 1 63 GLU n 1 64 GLU n 1 65 ASP n 1 66 THR n 1 67 TRP n 1 68 GLN n 1 69 LYS n 1 70 LEU n 1 71 GLU n 1 72 VAL n 1 73 ILE n 1 74 LYS n 1 75 GLN n 1 76 PHE n 1 77 ARG n 1 78 HIS n 1 79 PRO n 1 80 LYS n 1 81 TYR n 1 82 ASN n 1 83 THR n 1 84 SER n 1 85 THR n 1 86 LEU n 1 87 HIS n 1 88 HIS n 1 89 ASP n 1 90 ILE n 1 91 MET n 1 92 LEU n 1 93 LEU n 1 94 LYS n 1 95 LEU n 1 96 LYS n 1 97 GLU n 1 98 LYS n 1 99 ALA n 1 100 SER n 1 101 LEU n 1 102 THR n 1 103 LEU n 1 104 ALA n 1 105 VAL n 1 106 GLY n 1 107 THR n 1 108 LEU n 1 109 PRO n 1 110 PHE n 1 111 PRO n 1 112 SER n 1 113 GLN n 1 114 LYS n 1 115 ASN n 1 116 PHE n 1 117 VAL n 1 118 PRO n 1 119 PRO n 1 120 GLY n 1 121 ARG n 1 122 MET n 1 123 CYS n 1 124 ARG n 1 125 VAL n 1 126 ALA n 1 127 GLY n 1 128 TRP n 1 129 GLY n 1 130 ARG n 1 131 THR n 1 132 GLY n 1 133 VAL n 1 134 LEU n 1 135 LYS n 1 136 PRO n 1 137 GLY n 1 138 SER n 1 139 ASP n 1 140 THR n 1 141 LEU n 1 142 GLN n 1 143 GLU n 1 144 VAL n 1 145 LYS n 1 146 LEU n 1 147 ARG n 1 148 LEU n 1 149 MET n 1 150 ASP n 1 151 PRO n 1 152 GLN n 1 153 ALA n 1 154 CYS n 1 155 SER n 1 156 HIS n 1 157 PHE n 1 158 ARG n 1 159 ASP n 1 160 PHE n 1 161 ASP n 1 162 HIS n 1 163 ASN n 1 164 LEU n 1 165 GLN n 1 166 LEU n 1 167 CYS n 1 168 VAL n 1 169 GLY n 1 170 ASN n 1 171 PRO n 1 172 ARG n 1 173 LYS n 1 174 THR n 1 175 LYS n 1 176 SER n 1 177 ALA n 1 178 PHE n 1 179 LYS n 1 180 GLY n 1 181 ASP n 1 182 SER n 1 183 GLY n 1 184 GLY n 1 185 PRO n 1 186 LEU n 1 187 LEU n 1 188 CYS n 1 189 ALA n 1 190 GLY n 1 191 VAL n 1 192 ALA n 1 193 GLN n 1 194 GLY n 1 195 ILE n 1 196 VAL n 1 197 SER n 1 198 TYR n 1 199 GLY n 1 200 ARG n 1 201 SER n 1 202 ASP n 1 203 ALA n 1 204 LYS n 1 205 PRO n 1 206 PRO n 1 207 ALA n 1 208 VAL n 1 209 PHE n 1 210 THR n 1 211 ARG n 1 212 ILE n 1 213 SER n 1 214 HIS n 1 215 TYR n 1 216 ARG n 1 217 PRO n 1 218 TRP n 1 219 ILE n 1 220 ASN n 1 221 GLN n 1 222 ILE n 1 223 LEU n 1 224 GLN n 1 225 ALA n 1 226 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 226 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5YJM _struct_ref.pdbx_db_accession 5YJM _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5YJM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 226 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5YJM _struct_ref_seq.db_align_beg 16 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 245 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8W3 non-polymer . '2-amino-4-((R)-1-((R,Z)-6-(5-chloro-2-methoxybenzyl)-7-oxo-3-(phenoxyimino)-1,4-diazepane-1-carboxamido)propyl)benzoic acid' ;2-azanyl-4-[(1R)-1-[[(3Z,6R)-6-[(5-chloranyl-2-methoxy-phenyl)methyl]-7-oxidanylidene-3-phenoxyimino-1,4-diazepan-1-yl] carbonylamino]propyl]benzoic acid ; 'C30 H32 Cl N5 O6' 594.058 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YJM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.80 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '22% PEG8000, 5mM zinc chloride, 100mM MES buffer' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2007-05-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-002' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5YJM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 100 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21174 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.22 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.22 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.44 _refine.B_iso_max ? _refine.B_iso_mean 26.745 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.970 _refine.correlation_coeff_Fo_to_Fc_free 0.956 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YJM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.90 _refine.ls_d_res_low 29.97 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20076 _refine.ls_number_reflns_R_free 1090 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.98 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.14899 _refine.ls_R_factor_R_free 0.18562 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.14701 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.023 _refine.pdbx_overall_ESU_R_Free 0.023 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.633 _refine.overall_SU_ML 0.070 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1695 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 71 _refine_hist.number_atoms_solvent 88 _refine_hist.number_atoms_total 1854 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 29.97 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.026 0.019 1817 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1692 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.494 1.997 2463 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 2.836 3.000 3924 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.618 5.000 218 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.611 22.500 72 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.488 15.000 298 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.206 15.000 14 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.164 0.200 269 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.014 0.021 1982 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 379 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.605 1.670 872 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.606 1.667 871 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.457 2.488 1087 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.457 2.492 1088 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.704 2.162 945 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.672 2.154 942 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.306 3.085 1373 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.078 20.486 1950 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 6.074 20.332 1939 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.900 _refine_ls_shell.d_res_low 1.949 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 76 _refine_ls_shell.number_reflns_R_work 1395 _refine_ls_shell.percent_reflns_obs 90.30 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.286 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.234 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5YJM _struct.title 'Human chymase in complex with 7-oxo-3-(phenoxyimino)-1,4-diazepane derivative' _struct.pdbx_descriptor 'human chymase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YJM _struct_keywords.text 'protease, inhibitor, complex, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 43 ? ALA A 47 ? ALA A 55 ALA A 59 5 ? 5 HELX_P HELX_P2 AA2 ASP A 150 ? SER A 155 ? ASP A 164 SER A 169 5 ? 6 HELX_P HELX_P3 AA3 TYR A 215 ? ALA A 225 ? TYR A 234 ALA A 244 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.048 ? ? disulf2 disulf ? ? A CYS 123 SG ? ? ? 1_555 A CYS 188 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 1.990 ? ? disulf3 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 167 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.009 ? ? covale1 covale one ? A ASN 59 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 72 A NAG 301 1_555 ? ? ? ? ? ? ? 1.413 ? N-Glycosylation covale2 covale one ? A ASN 82 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 95 A NAG 302 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation metalc1 metalc ? ? A HIS 10 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 25 A ZN 303 1_555 ? ? ? ? ? ? ? 2.049 ? ? metalc2 metalc ? ? A GLU 64 OE2 ? ? ? 1_555 D ZN . ZN ? ? A GLU 77 A ZN 303 1_555 ? ? ? ? ? ? ? 1.847 ? ? metalc3 metalc ? ? A GLU 71 OE2 ? ? ? 1_555 D ZN . ZN ? ? A GLU 84 A ZN 303 2_544 ? ? ? ? ? ? ? 2.039 ? ? metalc4 metalc ? ? A LYS 96 NZ ? ? ? 1_555 D ZN . ZN ? ? A LYS 109 A ZN 303 2_544 ? ? ? ? ? ? ? 1.746 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 205 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 224 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 206 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 225 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.96 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 5 ? GLU A 6 ? THR A 20 GLU A 21 AA1 2 GLN A 142 ? ARG A 147 ? GLN A 156 ARG A 161 AA1 3 MET A 122 ? GLY A 127 ? MET A 135 GLY A 140 AA1 4 PRO A 185 ? CYS A 188 ? PRO A 198 CYS A 201 AA1 5 VAL A 191 ? TYR A 198 ? VAL A 208 TYR A 215 AA1 6 ALA A 207 ? ARG A 211 ? ALA A 226 ARG A 230 AA1 7 GLN A 165 ? VAL A 168 ? GLN A 180 VAL A 183 AA2 1 MET A 15 ? VAL A 21 ? MET A 30 VAL A 36 AA2 2 LYS A 28 ? ARG A 36 ? LYS A 40 ARG A 48 AA2 3 PHE A 39 ? THR A 42 ? PHE A 51 THR A 54 AA2 4 MET A 91 ? LEU A 95 ? MET A 104 LEU A 108 AA2 5 GLN A 68 ? ARG A 77 ? GLN A 81 ARG A 90 AA2 6 SER A 50 ? LEU A 55 ? SER A 63 LEU A 68 AA2 7 MET A 15 ? VAL A 21 ? MET A 30 VAL A 36 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 5 ? N THR A 20 O GLU A 143 ? O GLU A 157 AA1 2 3 O LEU A 146 ? O LEU A 160 N CYS A 123 ? N CYS A 136 AA1 3 4 N ARG A 124 ? N ARG A 137 O LEU A 187 ? O LEU A 200 AA1 4 5 N LEU A 186 ? N LEU A 199 O GLN A 193 ? O GLN A 210 AA1 5 6 N TYR A 198 ? N TYR A 215 O VAL A 208 ? O VAL A 227 AA1 6 7 O ALA A 207 ? O ALA A 226 N VAL A 168 ? N VAL A 183 AA2 1 2 N LEU A 18 ? N LEU A 33 O CYS A 30 ? O CYS A 42 AA2 2 3 N PHE A 33 ? N PHE A 45 O LEU A 41 ? O LEU A 53 AA2 3 4 N VAL A 40 ? N VAL A 52 O LEU A 93 ? O LEU A 106 AA2 4 5 O LEU A 92 ? O LEU A 105 N PHE A 76 ? N PHE A 89 AA2 5 6 O LEU A 70 ? O LEU A 83 N VAL A 53 ? N VAL A 66 AA2 6 7 O THR A 54 ? O THR A 67 N TYR A 17 ? N TYR A 32 # _atom_sites.entry_id 5YJM _atom_sites.fract_transf_matrix[1][1] 0.013318 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013318 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020101 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 ILE 2 17 17 ILE ILE A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 THR 5 20 20 THR THR A . n A 1 6 GLU 6 21 21 GLU GLU A . n A 1 7 SER 7 22 22 SER SER A . n A 1 8 LYS 8 23 23 LYS LYS A . n A 1 9 PRO 9 24 24 PRO PRO A . n A 1 10 HIS 10 25 25 HIS HIS A . n A 1 11 SER 11 26 26 SER SER A . n A 1 12 ARG 12 27 27 ARG ARG A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TYR 14 29 29 TYR TYR A . n A 1 15 MET 15 30 30 MET MET A . n A 1 16 ALA 16 31 31 ALA ALA A . n A 1 17 TYR 17 32 32 TYR TYR A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 GLU 19 34 34 GLU GLU A . n A 1 20 ILE 20 35 35 ILE ILE A . n A 1 21 VAL 21 36 36 VAL VAL A . n A 1 22 THR 22 37 37 THR THR A . n A 1 23 SER 23 37 37 SER SER A A n A 1 24 ASN 24 37 37 ASN ASN A B n A 1 25 GLY 25 37 37 GLY GLY A C n A 1 26 PRO 26 38 38 PRO PRO A . n A 1 27 SER 27 39 39 SER SER A . n A 1 28 LYS 28 40 40 LYS LYS A . n A 1 29 PHE 29 41 41 PHE PHE A . n A 1 30 CYS 30 42 42 CYS CYS A . n A 1 31 GLY 31 43 43 GLY GLY A . n A 1 32 GLY 32 44 44 GLY GLY A . n A 1 33 PHE 33 45 45 PHE PHE A . n A 1 34 LEU 34 46 46 LEU LEU A . n A 1 35 ILE 35 47 47 ILE ILE A . n A 1 36 ARG 36 48 48 ARG ARG A . n A 1 37 ARG 37 49 49 ARG ARG A . n A 1 38 ASN 38 50 50 ASN ASN A . n A 1 39 PHE 39 51 51 PHE PHE A . n A 1 40 VAL 40 52 52 VAL VAL A . n A 1 41 LEU 41 53 53 LEU LEU A . n A 1 42 THR 42 54 54 THR THR A . n A 1 43 ALA 43 55 55 ALA ALA A . n A 1 44 ALA 44 56 56 ALA ALA A . n A 1 45 HIS 45 57 57 HIS HIS A . n A 1 46 CYS 46 58 58 CYS CYS A . n A 1 47 ALA 47 59 59 ALA ALA A . n A 1 48 GLY 48 60 60 GLY GLY A . n A 1 49 ARG 49 61 61 ARG ARG A . n A 1 50 SER 50 63 63 SER SER A . n A 1 51 ILE 51 64 64 ILE ILE A . n A 1 52 THR 52 65 65 THR THR A . n A 1 53 VAL 53 66 66 VAL VAL A . n A 1 54 THR 54 67 67 THR THR A . n A 1 55 LEU 55 68 68 LEU LEU A . n A 1 56 GLY 56 69 69 GLY GLY A . n A 1 57 ALA 57 70 70 ALA ALA A . n A 1 58 HIS 58 71 71 HIS HIS A . n A 1 59 ASN 59 72 72 ASN ASN A . n A 1 60 ILE 60 73 73 ILE ILE A . n A 1 61 THR 61 74 74 THR THR A . n A 1 62 GLU 62 75 75 GLU GLU A . n A 1 63 GLU 63 76 76 GLU GLU A . n A 1 64 GLU 64 77 77 GLU GLU A . n A 1 65 ASP 65 78 78 ASP ASP A . n A 1 66 THR 66 79 79 THR THR A . n A 1 67 TRP 67 80 80 TRP TRP A . n A 1 68 GLN 68 81 81 GLN GLN A . n A 1 69 LYS 69 82 82 LYS LYS A . n A 1 70 LEU 70 83 83 LEU LEU A . n A 1 71 GLU 71 84 84 GLU GLU A . n A 1 72 VAL 72 85 85 VAL VAL A . n A 1 73 ILE 73 86 86 ILE ILE A . n A 1 74 LYS 74 87 87 LYS LYS A . n A 1 75 GLN 75 88 88 GLN GLN A . n A 1 76 PHE 76 89 89 PHE PHE A . n A 1 77 ARG 77 90 90 ARG ARG A . n A 1 78 HIS 78 91 91 HIS HIS A . n A 1 79 PRO 79 92 92 PRO PRO A . n A 1 80 LYS 80 93 93 LYS LYS A . n A 1 81 TYR 81 94 94 TYR TYR A . n A 1 82 ASN 82 95 95 ASN ASN A . n A 1 83 THR 83 96 96 THR THR A . n A 1 84 SER 84 97 97 SER SER A . n A 1 85 THR 85 98 98 THR THR A . n A 1 86 LEU 86 99 99 LEU LEU A . n A 1 87 HIS 87 100 100 HIS HIS A . n A 1 88 HIS 88 101 101 HIS HIS A . n A 1 89 ASP 89 102 102 ASP ASP A . n A 1 90 ILE 90 103 103 ILE ILE A . n A 1 91 MET 91 104 104 MET MET A . n A 1 92 LEU 92 105 105 LEU LEU A . n A 1 93 LEU 93 106 106 LEU LEU A . n A 1 94 LYS 94 107 107 LYS LYS A . n A 1 95 LEU 95 108 108 LEU LEU A . n A 1 96 LYS 96 109 109 LYS LYS A . n A 1 97 GLU 97 110 110 GLU GLU A . n A 1 98 LYS 98 111 111 LYS LYS A . n A 1 99 ALA 99 112 112 ALA ALA A . n A 1 100 SER 100 113 113 SER SER A . n A 1 101 LEU 101 114 114 LEU LEU A . n A 1 102 THR 102 115 115 THR THR A . n A 1 103 LEU 103 116 116 LEU LEU A . n A 1 104 ALA 104 117 117 ALA ALA A . n A 1 105 VAL 105 118 118 VAL VAL A . n A 1 106 GLY 106 119 119 GLY GLY A . n A 1 107 THR 107 120 120 THR THR A . n A 1 108 LEU 108 121 121 LEU LEU A . n A 1 109 PRO 109 122 122 PRO PRO A . n A 1 110 PHE 110 123 123 PHE PHE A . n A 1 111 PRO 111 124 ? ? ? A . n A 1 112 SER 112 125 ? ? ? A . n A 1 113 GLN 113 126 ? ? ? A . n A 1 114 LYS 114 127 ? ? ? A . n A 1 115 ASN 115 128 ? ? ? A . n A 1 116 PHE 116 129 ? ? ? A . n A 1 117 VAL 117 130 ? ? ? A . n A 1 118 PRO 118 131 ? ? ? A . n A 1 119 PRO 119 132 132 PRO PRO A . n A 1 120 GLY 120 133 133 GLY GLY A . n A 1 121 ARG 121 134 134 ARG ARG A . n A 1 122 MET 122 135 135 MET MET A . n A 1 123 CYS 123 136 136 CYS CYS A . n A 1 124 ARG 124 137 137 ARG ARG A . n A 1 125 VAL 125 138 138 VAL VAL A . n A 1 126 ALA 126 139 139 ALA ALA A . n A 1 127 GLY 127 140 140 GLY GLY A . n A 1 128 TRP 128 141 141 TRP TRP A . n A 1 129 GLY 129 142 142 GLY GLY A . n A 1 130 ARG 130 143 143 ARG ARG A . n A 1 131 THR 131 144 144 THR THR A . n A 1 132 GLY 132 145 145 GLY GLY A . n A 1 133 VAL 133 146 146 VAL VAL A . n A 1 134 LEU 134 147 147 LEU LEU A . n A 1 135 LYS 135 148 148 LYS LYS A . n A 1 136 PRO 136 150 150 PRO PRO A . n A 1 137 GLY 137 151 151 GLY GLY A . n A 1 138 SER 138 152 152 SER SER A . n A 1 139 ASP 139 153 153 ASP ASP A . n A 1 140 THR 140 154 154 THR THR A . n A 1 141 LEU 141 155 155 LEU LEU A . n A 1 142 GLN 142 156 156 GLN GLN A . n A 1 143 GLU 143 157 157 GLU GLU A . n A 1 144 VAL 144 158 158 VAL VAL A . n A 1 145 LYS 145 159 159 LYS LYS A . n A 1 146 LEU 146 160 160 LEU LEU A . n A 1 147 ARG 147 161 161 ARG ARG A . n A 1 148 LEU 148 162 162 LEU LEU A . n A 1 149 MET 149 163 163 MET MET A . n A 1 150 ASP 150 164 164 ASP ASP A . n A 1 151 PRO 151 165 165 PRO PRO A . n A 1 152 GLN 152 166 166 GLN GLN A . n A 1 153 ALA 153 167 167 ALA ALA A . n A 1 154 CYS 154 168 168 CYS CYS A . n A 1 155 SER 155 169 169 SER SER A . n A 1 156 HIS 156 172 172 HIS HIS A . n A 1 157 PHE 157 173 173 PHE PHE A . n A 1 158 ARG 158 174 174 ARG ARG A . n A 1 159 ASP 159 175 175 ASP ASP A . n A 1 160 PHE 160 176 176 PHE PHE A . n A 1 161 ASP 161 177 177 ASP ASP A . n A 1 162 HIS 162 177 177 HIS HIS A A n A 1 163 ASN 163 178 178 ASN ASN A . n A 1 164 LEU 164 179 179 LEU LEU A . n A 1 165 GLN 165 180 180 GLN GLN A . n A 1 166 LEU 166 181 181 LEU LEU A . n A 1 167 CYS 167 182 182 CYS CYS A . n A 1 168 VAL 168 183 183 VAL VAL A . n A 1 169 GLY 169 184 184 GLY GLY A . n A 1 170 ASN 170 185 185 ASN ASN A . n A 1 171 PRO 171 185 185 PRO PRO A A n A 1 172 ARG 172 185 185 ARG ARG A B n A 1 173 LYS 173 186 186 LYS LYS A . n A 1 174 THR 174 187 187 THR THR A . n A 1 175 LYS 175 188 188 LYS LYS A . n A 1 176 SER 176 189 189 SER SER A . n A 1 177 ALA 177 190 190 ALA ALA A . n A 1 178 PHE 178 191 191 PHE PHE A . n A 1 179 LYS 179 192 192 LYS LYS A . n A 1 180 GLY 180 193 193 GLY GLY A . n A 1 181 ASP 181 194 194 ASP ASP A . n A 1 182 SER 182 195 195 SER SER A . n A 1 183 GLY 183 196 196 GLY GLY A . n A 1 184 GLY 184 197 197 GLY GLY A . n A 1 185 PRO 185 198 198 PRO PRO A . n A 1 186 LEU 186 199 199 LEU LEU A . n A 1 187 LEU 187 200 200 LEU LEU A . n A 1 188 CYS 188 201 201 CYS CYS A . n A 1 189 ALA 189 202 202 ALA ALA A . n A 1 190 GLY 190 207 207 GLY GLY A . n A 1 191 VAL 191 208 208 VAL VAL A . n A 1 192 ALA 192 209 209 ALA ALA A . n A 1 193 GLN 193 210 210 GLN GLN A . n A 1 194 GLY 194 211 211 GLY GLY A . n A 1 195 ILE 195 212 212 ILE ILE A . n A 1 196 VAL 196 213 213 VAL VAL A . n A 1 197 SER 197 214 214 SER SER A . n A 1 198 TYR 198 215 215 TYR TYR A . n A 1 199 GLY 199 216 216 GLY GLY A . n A 1 200 ARG 200 217 217 ARG ARG A . n A 1 201 SER 201 218 218 SER SER A . n A 1 202 ASP 202 219 219 ASP ASP A . n A 1 203 ALA 203 220 220 ALA ALA A . n A 1 204 LYS 204 221 221 LYS LYS A . n A 1 205 PRO 205 224 224 PRO PRO A . n A 1 206 PRO 206 225 225 PRO PRO A . n A 1 207 ALA 207 226 226 ALA ALA A . n A 1 208 VAL 208 227 227 VAL VAL A . n A 1 209 PHE 209 228 228 PHE PHE A . n A 1 210 THR 210 229 229 THR THR A . n A 1 211 ARG 211 230 230 ARG ARG A . n A 1 212 ILE 212 231 231 ILE ILE A . n A 1 213 SER 213 232 232 SER SER A . n A 1 214 HIS 214 233 233 HIS HIS A . n A 1 215 TYR 215 234 234 TYR TYR A . n A 1 216 ARG 216 235 235 ARG ARG A . n A 1 217 PRO 217 236 236 PRO PRO A . n A 1 218 TRP 218 237 237 TRP TRP A . n A 1 219 ILE 219 238 238 ILE ILE A . n A 1 220 ASN 220 239 239 ASN ASN A . n A 1 221 GLN 221 240 240 GLN GLN A . n A 1 222 ILE 222 241 241 ILE ILE A . n A 1 223 LEU 223 242 242 LEU LEU A . n A 1 224 GLN 224 243 243 GLN GLN A . n A 1 225 ALA 225 244 244 ALA ALA A . n A 1 226 ASN 226 245 245 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 301 301 NAG NAG A . C 2 NAG 1 302 302 NAG NAG A . D 3 ZN 1 303 303 ZN ZN A . E 4 8W3 1 304 401 8W3 ASB A . F 5 HOH 1 401 34 HOH HOH A . F 5 HOH 2 402 78 HOH HOH A . F 5 HOH 3 403 52 HOH HOH A . F 5 HOH 4 404 45 HOH HOH A . F 5 HOH 5 405 16 HOH HOH A . F 5 HOH 6 406 59 HOH HOH A . F 5 HOH 7 407 4 HOH HOH A . F 5 HOH 8 408 56 HOH HOH A . F 5 HOH 9 409 17 HOH HOH A . F 5 HOH 10 410 20 HOH HOH A . F 5 HOH 11 411 42 HOH HOH A . F 5 HOH 12 412 67 HOH HOH A . F 5 HOH 13 413 3 HOH HOH A . F 5 HOH 14 414 60 HOH HOH A . F 5 HOH 15 415 77 HOH HOH A . F 5 HOH 16 416 68 HOH HOH A . F 5 HOH 17 417 24 HOH HOH A . F 5 HOH 18 418 43 HOH HOH A . F 5 HOH 19 419 27 HOH HOH A . F 5 HOH 20 420 30 HOH HOH A . F 5 HOH 21 421 10 HOH HOH A . F 5 HOH 22 422 9 HOH HOH A . F 5 HOH 23 423 35 HOH HOH A . F 5 HOH 24 424 6 HOH HOH A . F 5 HOH 25 425 11 HOH HOH A . F 5 HOH 26 426 47 HOH HOH A . F 5 HOH 27 427 8 HOH HOH A . F 5 HOH 28 428 19 HOH HOH A . F 5 HOH 29 429 50 HOH HOH A . F 5 HOH 30 430 53 HOH HOH A . F 5 HOH 31 431 84 HOH HOH A . F 5 HOH 32 432 15 HOH HOH A . F 5 HOH 33 433 29 HOH HOH A . F 5 HOH 34 434 1 HOH HOH A . F 5 HOH 35 435 87 HOH HOH A . F 5 HOH 36 436 58 HOH HOH A . F 5 HOH 37 437 51 HOH HOH A . F 5 HOH 38 438 70 HOH HOH A . F 5 HOH 39 439 12 HOH HOH A . F 5 HOH 40 440 44 HOH HOH A . F 5 HOH 41 441 49 HOH HOH A . F 5 HOH 42 442 55 HOH HOH A . F 5 HOH 43 443 14 HOH HOH A . F 5 HOH 44 444 48 HOH HOH A . F 5 HOH 45 445 2 HOH HOH A . F 5 HOH 46 446 25 HOH HOH A . F 5 HOH 47 447 64 HOH HOH A . F 5 HOH 48 448 40 HOH HOH A . F 5 HOH 49 449 37 HOH HOH A . F 5 HOH 50 450 13 HOH HOH A . F 5 HOH 51 451 32 HOH HOH A . F 5 HOH 52 452 33 HOH HOH A . F 5 HOH 53 453 7 HOH HOH A . F 5 HOH 54 454 23 HOH HOH A . F 5 HOH 55 455 63 HOH HOH A . F 5 HOH 56 456 71 HOH HOH A . F 5 HOH 57 457 5 HOH HOH A . F 5 HOH 58 458 36 HOH HOH A . F 5 HOH 59 459 31 HOH HOH A . F 5 HOH 60 460 21 HOH HOH A . F 5 HOH 61 461 81 HOH HOH A . F 5 HOH 62 462 65 HOH HOH A . F 5 HOH 63 463 74 HOH HOH A . F 5 HOH 64 464 38 HOH HOH A . F 5 HOH 65 465 86 HOH HOH A . F 5 HOH 66 466 88 HOH HOH A . F 5 HOH 67 467 66 HOH HOH A . F 5 HOH 68 468 28 HOH HOH A . F 5 HOH 69 469 73 HOH HOH A . F 5 HOH 70 470 18 HOH HOH A . F 5 HOH 71 471 57 HOH HOH A . F 5 HOH 72 472 72 HOH HOH A . F 5 HOH 73 473 22 HOH HOH A . F 5 HOH 74 474 80 HOH HOH A . F 5 HOH 75 475 76 HOH HOH A . F 5 HOH 76 476 39 HOH HOH A . F 5 HOH 77 477 26 HOH HOH A . F 5 HOH 78 478 83 HOH HOH A . F 5 HOH 79 479 79 HOH HOH A . F 5 HOH 80 480 75 HOH HOH A . F 5 HOH 81 481 46 HOH HOH A . F 5 HOH 82 482 69 HOH HOH A . F 5 HOH 83 483 41 HOH HOH A . F 5 HOH 84 484 54 HOH HOH A . F 5 HOH 85 485 62 HOH HOH A . F 5 HOH 86 486 85 HOH HOH A . F 5 HOH 87 487 61 HOH HOH A . F 5 HOH 88 488 82 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B NAG ? A NAG 301 ? NAG -D 2 C NAG ? A NAG 302 ? NAG -D # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 520 ? 1 MORE -15 ? 1 'SSA (A^2)' 10650 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 10 ? A HIS 25 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 OE2 ? A GLU 64 ? A GLU 77 ? 1_555 122.9 ? 2 NE2 ? A HIS 10 ? A HIS 25 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 OE2 ? A GLU 71 ? A GLU 84 ? 1_555 70.3 ? 3 OE2 ? A GLU 64 ? A GLU 77 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 OE2 ? A GLU 71 ? A GLU 84 ? 1_555 54.3 ? 4 NE2 ? A HIS 10 ? A HIS 25 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 NZ ? A LYS 96 ? A LYS 109 ? 1_555 71.7 ? 5 OE2 ? A GLU 64 ? A GLU 77 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 NZ ? A LYS 96 ? A LYS 109 ? 1_555 54.9 ? 6 OE2 ? A GLU 71 ? A GLU 84 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 NZ ? A LYS 96 ? A LYS 109 ? 1_555 6.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-27 2 'Structure model' 1 1 2018-01-17 3 'Structure model' 1 2 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp 3 3 'Structure model' entity 4 3 'Structure model' pdbx_chem_comp_identifier 5 3 'Structure model' pdbx_entity_nonpoly 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_conn_type 8 3 'Structure model' struct_site 9 3 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation.year' 6 3 'Structure model' '_chem_comp.name' 7 3 'Structure model' '_chem_comp.pdbx_synonyms' 8 3 'Structure model' '_chem_comp.type' 9 3 'Structure model' '_entity.pdbx_description' 10 3 'Structure model' '_pdbx_entity_nonpoly.name' 11 3 'Structure model' '_struct_conn.conn_type_id' 12 3 'Structure model' '_struct_conn.id' 13 3 'Structure model' '_struct_conn.pdbx_dist_value' 14 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 15 3 'Structure model' '_struct_conn.pdbx_role' 16 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 3 'Structure model' '_struct_conn_type.id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -13.2980 _pdbx_refine_tls.origin_y -24.7760 _pdbx_refine_tls.origin_z -0.2570 _pdbx_refine_tls.T[1][1] 0.0050 _pdbx_refine_tls.T[2][2] 0.0341 _pdbx_refine_tls.T[3][3] 0.0036 _pdbx_refine_tls.T[1][2] -0.0065 _pdbx_refine_tls.T[1][3] -0.0007 _pdbx_refine_tls.T[2][3] -0.0016 _pdbx_refine_tls.L[1][1] 1.4559 _pdbx_refine_tls.L[2][2] 2.3767 _pdbx_refine_tls.L[3][3] 0.7857 _pdbx_refine_tls.L[1][2] -1.1702 _pdbx_refine_tls.L[1][3] 0.2560 _pdbx_refine_tls.L[2][3] -0.2735 _pdbx_refine_tls.S[1][1] -0.0321 _pdbx_refine_tls.S[1][2] -0.0503 _pdbx_refine_tls.S[1][3] -0.0065 _pdbx_refine_tls.S[2][1] 0.0295 _pdbx_refine_tls.S[2][2] 0.0109 _pdbx_refine_tls.S[2][3] 0.0610 _pdbx_refine_tls.S[3][1] -0.0272 _pdbx_refine_tls.S[3][2] -0.0712 _pdbx_refine_tls.S[3][3] 0.0212 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 16 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 245 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AMoRE ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 449 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 463 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.08 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 153 ? ? CG A ASP 153 ? ? OD2 A ASP 153 ? ? 110.97 118.30 -7.33 0.90 N 2 1 NE A ARG 161 ? ? CZ A ARG 161 ? ? NH1 A ARG 161 ? ? 124.50 120.30 4.20 0.50 N 3 1 NE A ARG 174 ? ? CZ A ARG 174 ? ? NH2 A ARG 174 ? ? 116.92 120.30 -3.38 0.50 N 4 1 CB A ASP 219 ? ? CG A ASP 219 ? ? OD1 A ASP 219 ? ? 123.84 118.30 5.54 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 71 ? ? -121.15 -72.75 2 1 SER A 195 ? ? -34.64 135.34 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 124 ? A PRO 111 2 1 Y 1 A SER 125 ? A SER 112 3 1 Y 1 A GLN 126 ? A GLN 113 4 1 Y 1 A LYS 127 ? A LYS 114 5 1 Y 1 A ASN 128 ? A ASN 115 6 1 Y 1 A PHE 129 ? A PHE 116 7 1 Y 1 A VAL 130 ? A VAL 117 8 1 Y 1 A PRO 131 ? A PRO 118 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 8W3 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 8W3 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 'ZINC ION' ZN 4 '2-amino-4-((R)-1-((R,Z)-6-(5-chloro-2-methoxybenzyl)-7-oxo-3-(phenoxyimino)-1,4-diazepane-1-carboxamido)propyl)benzoic acid' 8W3 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #