data_5YR0 # _entry.id 5YR0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YR0 pdb_00005yr0 10.2210/pdb5yr0/pdb WWPDB D_1300005762 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-06-13 2 'Structure model' 1 1 2018-06-20 3 'Structure model' 1 2 2018-07-04 4 'Structure model' 1 3 2024-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YR0 _pdbx_database_status.recvd_initial_deposition_date 2017-11-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pan, X.' 1 ? 'Zhao, Y.' 2 ? 'He, Y.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 115 _citation.language ? _citation.page_first E5669 _citation.page_last E5678 _citation.title ;Targeting the potent Beclin 1-UVRAG coiled-coil interaction with designed peptides enhances autophagy and endolysosomal trafficking. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1721173115 _citation.pdbx_database_id_PubMed 29866835 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, S.' 1 ? primary 'He, Y.' 2 ? primary 'Qiu, X.' 3 ? primary 'Yang, W.' 4 ? primary 'Liu, W.' 5 ? primary 'Li, X.' 6 ? primary 'Li, Y.' 7 ? primary 'Shen, H.M.' 8 ? primary 'Wang, R.' 9 ? primary 'Yue, Z.' 10 ? primary 'Zhao, Y.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Beclin-1 5971.546 1 ? ? ? ? 2 polymer man 'UV radiation resistance associated protein' 5617.569 1 ? C238S ? ? 3 water nat water 18.015 164 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Coiled-coil myosin-like BCL2-interacting protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no DSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQE DSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQE A ? 2 'polypeptide(L)' no no TSNELKKESESLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKG TSNELKKESESLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKG B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 SER n 1 3 GLU n 1 4 GLN n 1 5 LEU n 1 6 GLN n 1 7 ARG n 1 8 GLU n 1 9 LEU n 1 10 LYS n 1 11 GLU n 1 12 LEU n 1 13 ALA n 1 14 LEU n 1 15 GLU n 1 16 GLU n 1 17 GLU n 1 18 ARG n 1 19 LEU n 1 20 ILE n 1 21 GLN n 1 22 GLU n 1 23 LEU n 1 24 GLU n 1 25 ASP n 1 26 VAL n 1 27 GLU n 1 28 LYS n 1 29 ASN n 1 30 ARG n 1 31 LYS n 1 32 VAL n 1 33 VAL n 1 34 ALA n 1 35 GLU n 1 36 ASN n 1 37 LEU n 1 38 GLU n 1 39 LYS n 1 40 VAL n 1 41 GLN n 1 42 ALA n 1 43 GLU n 1 44 ALA n 1 45 GLU n 1 46 ARG n 1 47 LEU n 1 48 ASP n 1 49 GLN n 1 50 GLU n 2 1 THR n 2 2 SER n 2 3 ASN n 2 4 GLU n 2 5 LEU n 2 6 LYS n 2 7 LYS n 2 8 GLU n 2 9 SER n 2 10 GLU n 2 11 SER n 2 12 LEU n 2 13 ARG n 2 14 LEU n 2 15 LYS n 2 16 ILE n 2 17 LEU n 2 18 VAL n 2 19 LEU n 2 20 ARG n 2 21 ASN n 2 22 GLU n 2 23 LEU n 2 24 GLU n 2 25 ARG n 2 26 GLN n 2 27 LYS n 2 28 LYS n 2 29 ALA n 2 30 LEU n 2 31 GLY n 2 32 ARG n 2 33 GLU n 2 34 VAL n 2 35 ALA n 2 36 PHE n 2 37 LEU n 2 38 HIS n 2 39 LYS n 2 40 GLN n 2 41 GLN n 2 42 MET n 2 43 ALA n 2 44 LEU n 2 45 GLN n 2 46 ASP n 2 47 LYS n 2 48 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 50 Mouse ? Becn1 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; 866768 ? ? ? ? ? ? 'BL21-Gold(DE3)pLysS AG' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 48 Mouse ? 'Uvrag, Uvrag1' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; 866768 ? ? ? ? ? ? 'BL21-Gold(DE3)pLysS AG' ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 174 ? ? ? A . n A 1 2 SER 2 175 175 SER SER A . n A 1 3 GLU 3 176 176 GLU GLU A . n A 1 4 GLN 4 177 177 GLN GLN A . n A 1 5 LEU 5 178 178 LEU LEU A . n A 1 6 GLN 6 179 179 GLN GLN A . n A 1 7 ARG 7 180 180 ARG ARG A . n A 1 8 GLU 8 181 181 GLU GLU A . n A 1 9 LEU 9 182 182 LEU LEU A . n A 1 10 LYS 10 183 183 LYS LYS A . n A 1 11 GLU 11 184 184 GLU GLU A . n A 1 12 LEU 12 185 185 LEU LEU A . n A 1 13 ALA 13 186 186 ALA ALA A . n A 1 14 LEU 14 187 187 LEU LEU A . n A 1 15 GLU 15 188 188 GLU GLU A . n A 1 16 GLU 16 189 189 GLU GLU A . n A 1 17 GLU 17 190 190 GLU GLU A . n A 1 18 ARG 18 191 191 ARG ARG A . n A 1 19 LEU 19 192 192 LEU LEU A . n A 1 20 ILE 20 193 193 ILE ILE A . n A 1 21 GLN 21 194 194 GLN GLN A . n A 1 22 GLU 22 195 195 GLU GLU A . n A 1 23 LEU 23 196 196 LEU LEU A . n A 1 24 GLU 24 197 197 GLU GLU A . n A 1 25 ASP 25 198 198 ASP ASP A . n A 1 26 VAL 26 199 199 VAL VAL A . n A 1 27 GLU 27 200 200 GLU GLU A . n A 1 28 LYS 28 201 201 LYS LYS A . n A 1 29 ASN 29 202 202 ASN ASN A . n A 1 30 ARG 30 203 203 ARG ARG A . n A 1 31 LYS 31 204 204 LYS LYS A . n A 1 32 VAL 32 205 205 VAL VAL A . n A 1 33 VAL 33 206 206 VAL VAL A . n A 1 34 ALA 34 207 207 ALA ALA A . n A 1 35 GLU 35 208 208 GLU GLU A . n A 1 36 ASN 36 209 209 ASN ASN A . n A 1 37 LEU 37 210 210 LEU LEU A . n A 1 38 GLU 38 211 211 GLU GLU A . n A 1 39 LYS 39 212 212 LYS LYS A . n A 1 40 VAL 40 213 213 VAL VAL A . n A 1 41 GLN 41 214 214 GLN GLN A . n A 1 42 ALA 42 215 215 ALA ALA A . n A 1 43 GLU 43 216 216 GLU GLU A . n A 1 44 ALA 44 217 217 ALA ALA A . n A 1 45 GLU 45 218 218 GLU GLU A . n A 1 46 ARG 46 219 219 ARG ARG A . n A 1 47 LEU 47 220 220 LEU LEU A . n A 1 48 ASP 48 221 221 ASP ASP A . n A 1 49 GLN 49 222 222 GLN GLN A . n A 1 50 GLU 50 223 ? ? ? A . n B 2 1 THR 1 228 ? ? ? B . n B 2 2 SER 2 229 ? ? ? B . n B 2 3 ASN 3 230 ? ? ? B . n B 2 4 GLU 4 231 231 GLU GLU B . n B 2 5 LEU 5 232 232 LEU LEU B . n B 2 6 LYS 6 233 233 LYS LYS B . n B 2 7 LYS 7 234 234 LYS LYS B . n B 2 8 GLU 8 235 235 GLU GLU B . n B 2 9 SER 9 236 236 SER SER B . n B 2 10 GLU 10 237 237 GLU GLU B . n B 2 11 SER 11 238 238 SER SER B . n B 2 12 LEU 12 239 239 LEU LEU B . n B 2 13 ARG 13 240 240 ARG ARG B . n B 2 14 LEU 14 241 241 LEU LEU B . n B 2 15 LYS 15 242 242 LYS LYS B . n B 2 16 ILE 16 243 243 ILE ILE B . n B 2 17 LEU 17 244 244 LEU LEU B . n B 2 18 VAL 18 245 245 VAL VAL B . n B 2 19 LEU 19 246 246 LEU LEU B . n B 2 20 ARG 20 247 247 ARG ARG B . n B 2 21 ASN 21 248 248 ASN ASN B . n B 2 22 GLU 22 249 249 GLU GLU B . n B 2 23 LEU 23 250 250 LEU LEU B . n B 2 24 GLU 24 251 251 GLU GLU B . n B 2 25 ARG 25 252 252 ARG ARG B . n B 2 26 GLN 26 253 253 GLN GLN B . n B 2 27 LYS 27 254 254 LYS LYS B . n B 2 28 LYS 28 255 255 LYS LYS B . n B 2 29 ALA 29 256 256 ALA ALA B . n B 2 30 LEU 30 257 257 LEU LEU B . n B 2 31 GLY 31 258 258 GLY GLY B . n B 2 32 ARG 32 259 259 ARG ARG B . n B 2 33 GLU 33 260 260 GLU GLU B . n B 2 34 VAL 34 261 261 VAL VAL B . n B 2 35 ALA 35 262 262 ALA ALA B . n B 2 36 PHE 36 263 263 PHE PHE B . n B 2 37 LEU 37 264 264 LEU LEU B . n B 2 38 HIS 38 265 265 HIS HIS B . n B 2 39 LYS 39 266 266 LYS LYS B . n B 2 40 GLN 40 267 267 GLN GLN B . n B 2 41 GLN 41 268 268 GLN GLN B . n B 2 42 MET 42 269 269 MET MET B . n B 2 43 ALA 43 270 270 ALA ALA B . n B 2 44 LEU 44 271 271 LEU LEU B . n B 2 45 GLN 45 272 272 GLN GLN B . n B 2 46 ASP 46 273 273 ASP ASP B . n B 2 47 LYS 47 274 274 LYS LYS B . n B 2 48 GLY 48 275 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 301 137 HOH HOH A . C 3 HOH 2 302 240 HOH HOH A . C 3 HOH 3 303 225 HOH HOH A . C 3 HOH 4 304 23 HOH HOH A . C 3 HOH 5 305 244 HOH HOH A . C 3 HOH 6 306 138 HOH HOH A . C 3 HOH 7 307 52 HOH HOH A . C 3 HOH 8 308 210 HOH HOH A . C 3 HOH 9 309 29 HOH HOH A . C 3 HOH 10 310 168 HOH HOH A . C 3 HOH 11 311 28 HOH HOH A . C 3 HOH 12 312 170 HOH HOH A . C 3 HOH 13 313 214 HOH HOH A . C 3 HOH 14 314 63 HOH HOH A . C 3 HOH 15 315 60 HOH HOH A . C 3 HOH 16 316 47 HOH HOH A . C 3 HOH 17 317 106 HOH HOH A . C 3 HOH 18 318 71 HOH HOH A . C 3 HOH 19 319 11 HOH HOH A . C 3 HOH 20 320 165 HOH HOH A . C 3 HOH 21 321 174 HOH HOH A . C 3 HOH 22 322 226 HOH HOH A . C 3 HOH 23 323 41 HOH HOH A . C 3 HOH 24 324 213 HOH HOH A . C 3 HOH 25 325 65 HOH HOH A . C 3 HOH 26 326 18 HOH HOH A . C 3 HOH 27 327 98 HOH HOH A . C 3 HOH 28 328 51 HOH HOH A . C 3 HOH 29 329 218 HOH HOH A . C 3 HOH 30 330 20 HOH HOH A . C 3 HOH 31 331 134 HOH HOH A . C 3 HOH 32 332 35 HOH HOH A . C 3 HOH 33 333 70 HOH HOH A . C 3 HOH 34 334 73 HOH HOH A . C 3 HOH 35 335 108 HOH HOH A . C 3 HOH 36 336 55 HOH HOH A . C 3 HOH 37 337 243 HOH HOH A . C 3 HOH 38 338 8 HOH HOH A . C 3 HOH 39 339 111 HOH HOH A . C 3 HOH 40 340 74 HOH HOH A . C 3 HOH 41 341 241 HOH HOH A . C 3 HOH 42 342 37 HOH HOH A . C 3 HOH 43 343 209 HOH HOH A . C 3 HOH 44 344 172 HOH HOH A . C 3 HOH 45 345 220 HOH HOH A . C 3 HOH 46 346 43 HOH HOH A . C 3 HOH 47 347 221 HOH HOH A . C 3 HOH 48 348 237 HOH HOH A . C 3 HOH 49 349 229 HOH HOH A . C 3 HOH 50 350 222 HOH HOH A . C 3 HOH 51 351 13 HOH HOH A . C 3 HOH 52 352 21 HOH HOH A . C 3 HOH 53 353 50 HOH HOH A . C 3 HOH 54 354 164 HOH HOH A . C 3 HOH 55 355 166 HOH HOH A . C 3 HOH 56 356 145 HOH HOH A . C 3 HOH 57 357 94 HOH HOH A . C 3 HOH 58 358 239 HOH HOH A . C 3 HOH 59 359 171 HOH HOH A . C 3 HOH 60 360 67 HOH HOH A . C 3 HOH 61 361 149 HOH HOH A . C 3 HOH 62 362 233 HOH HOH A . C 3 HOH 63 363 58 HOH HOH A . C 3 HOH 64 364 223 HOH HOH A . C 3 HOH 65 365 231 HOH HOH A . D 3 HOH 1 301 54 HOH HOH B . D 3 HOH 2 302 144 HOH HOH B . D 3 HOH 3 303 6 HOH HOH B . D 3 HOH 4 304 242 HOH HOH B . D 3 HOH 5 305 201 HOH HOH B . D 3 HOH 6 306 158 HOH HOH B . D 3 HOH 7 307 107 HOH HOH B . D 3 HOH 8 308 234 HOH HOH B . D 3 HOH 9 309 34 HOH HOH B . D 3 HOH 10 310 36 HOH HOH B . D 3 HOH 11 311 66 HOH HOH B . D 3 HOH 12 312 77 HOH HOH B . D 3 HOH 13 313 1 HOH HOH B . D 3 HOH 14 314 22 HOH HOH B . D 3 HOH 15 315 140 HOH HOH B . D 3 HOH 16 316 30 HOH HOH B . D 3 HOH 17 317 19 HOH HOH B . D 3 HOH 18 318 150 HOH HOH B . D 3 HOH 19 319 3 HOH HOH B . D 3 HOH 20 320 136 HOH HOH B . D 3 HOH 21 321 91 HOH HOH B . D 3 HOH 22 322 68 HOH HOH B . D 3 HOH 23 323 14 HOH HOH B . D 3 HOH 24 324 230 HOH HOH B . D 3 HOH 25 325 72 HOH HOH B . D 3 HOH 26 326 15 HOH HOH B . D 3 HOH 27 327 2 HOH HOH B . D 3 HOH 28 328 24 HOH HOH B . D 3 HOH 29 329 205 HOH HOH B . D 3 HOH 30 330 224 HOH HOH B . D 3 HOH 31 331 212 HOH HOH B . D 3 HOH 32 332 16 HOH HOH B . D 3 HOH 33 333 10 HOH HOH B . D 3 HOH 34 334 75 HOH HOH B . D 3 HOH 35 335 102 HOH HOH B . D 3 HOH 36 336 32 HOH HOH B . D 3 HOH 37 337 38 HOH HOH B . D 3 HOH 38 338 31 HOH HOH B . D 3 HOH 39 339 89 HOH HOH B . D 3 HOH 40 340 207 HOH HOH B . D 3 HOH 41 341 202 HOH HOH B . D 3 HOH 42 342 130 HOH HOH B . D 3 HOH 43 343 104 HOH HOH B . D 3 HOH 44 344 12 HOH HOH B . D 3 HOH 45 345 25 HOH HOH B . D 3 HOH 46 346 203 HOH HOH B . D 3 HOH 47 347 96 HOH HOH B . D 3 HOH 48 348 124 HOH HOH B . D 3 HOH 49 349 81 HOH HOH B . D 3 HOH 50 350 116 HOH HOH B . D 3 HOH 51 351 88 HOH HOH B . D 3 HOH 52 352 206 HOH HOH B . D 3 HOH 53 353 5 HOH HOH B . D 3 HOH 54 354 92 HOH HOH B . D 3 HOH 55 355 27 HOH HOH B . D 3 HOH 56 356 204 HOH HOH B . D 3 HOH 57 357 208 HOH HOH B . D 3 HOH 58 358 17 HOH HOH B . D 3 HOH 59 359 119 HOH HOH B . D 3 HOH 60 360 9 HOH HOH B . D 3 HOH 61 361 86 HOH HOH B . D 3 HOH 62 362 153 HOH HOH B . D 3 HOH 63 363 44 HOH HOH B . D 3 HOH 64 364 80 HOH HOH B . D 3 HOH 65 365 62 HOH HOH B . D 3 HOH 66 366 135 HOH HOH B . D 3 HOH 67 367 211 HOH HOH B . D 3 HOH 68 368 169 HOH HOH B . D 3 HOH 69 369 232 HOH HOH B . D 3 HOH 70 370 235 HOH HOH B . D 3 HOH 71 371 159 HOH HOH B . D 3 HOH 72 372 154 HOH HOH B . D 3 HOH 73 373 7 HOH HOH B . D 3 HOH 74 374 95 HOH HOH B . D 3 HOH 75 375 69 HOH HOH B . D 3 HOH 76 376 57 HOH HOH B . D 3 HOH 77 377 123 HOH HOH B . D 3 HOH 78 378 56 HOH HOH B . D 3 HOH 79 379 49 HOH HOH B . D 3 HOH 80 380 46 HOH HOH B . D 3 HOH 81 381 45 HOH HOH B . D 3 HOH 82 382 228 HOH HOH B . D 3 HOH 83 383 216 HOH HOH B . D 3 HOH 84 384 219 HOH HOH B . D 3 HOH 85 385 236 HOH HOH B . D 3 HOH 86 386 76 HOH HOH B . D 3 HOH 87 387 215 HOH HOH B . D 3 HOH 88 388 40 HOH HOH B . D 3 HOH 89 389 87 HOH HOH B . D 3 HOH 90 390 4 HOH HOH B . D 3 HOH 91 391 48 HOH HOH B . D 3 HOH 92 392 33 HOH HOH B . D 3 HOH 93 393 26 HOH HOH B . D 3 HOH 94 394 167 HOH HOH B . D 3 HOH 95 395 217 HOH HOH B . D 3 HOH 96 396 148 HOH HOH B . D 3 HOH 97 397 78 HOH HOH B . D 3 HOH 98 398 61 HOH HOH B . D 3 HOH 99 399 227 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0222 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHARP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5YR0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 45.112 _cell.length_a_esd ? _cell.length_b 45.112 _cell.length_b_esd ? _cell.length_c 161.524 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YR0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YR0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M citric acid pH 3.5, 3.0M sodium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-03-30 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5YR0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.8 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8323 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 41.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.86 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 22.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.165 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.04 _refine.aniso_B[1][2] -0.02 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.04 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.14 _refine.B_iso_max ? _refine.B_iso_mean 22.352 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.950 _refine.correlation_coeff_Fo_to_Fc_free 0.954 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YR0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.90 _refine.ls_d_res_low 35.18 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7908 _refine.ls_number_reflns_R_free 419 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.55 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.17070 _refine.ls_R_factor_R_free 0.19455 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.16943 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SIRAS _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.166 _refine.pdbx_overall_ESU_R_Free 0.134 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.572 _refine.overall_SU_ML 0.078 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 767 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 164 _refine_hist.number_atoms_total 931 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 35.18 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.014 844 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 815 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.527 1.662 1133 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.026 1.639 1942 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 3.848 5.000 107 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 28.278 24.237 59 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.269 15.000 202 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.138 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.075 0.200 103 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 946 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 118 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.385 1.850 397 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.360 1.845 396 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.457 2.706 499 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.454 2.711 500 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.441 2.405 445 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.438 2.418 446 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.540 3.436 628 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 10.322 25.793 1058 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 9.889 24.914 1015 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.900 _refine_ls_shell.d_res_low 1.949 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 27 _refine_ls_shell.number_reflns_R_work 564 _refine_ls_shell.percent_reflns_obs 98.34 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.256 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.168 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5YR0 _struct.title 'Structure of Beclin1-UVRAG coiled coil domain complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YR0 _struct_keywords.text 'autophagy regulator, ENDOCYTOSIS' _struct_keywords.pdbx_keywords ENDOCYTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP BECN1_MOUSE O88597 ? 1 DSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQE 174 2 UNP UVRAG_MOUSE Q8K245 ? 2 TSNELKKESECLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKG 228 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5YR0 A 1 ? 50 ? O88597 174 ? 223 ? 174 223 2 2 5YR0 B 1 ? 48 ? Q8K245 228 ? 275 ? 228 275 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 5YR0 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 11 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8K245 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 238 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 238 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2190 ? 1 MORE -22 ? 1 'SSA (A^2)' 7270 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? GLN A 49 ? SER A 175 GLN A 222 1 ? 48 HELX_P HELX_P2 AA2 LEU B 5 ? LYS B 47 ? LEU B 232 LYS B 274 1 ? 43 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 188 ? B O A HOH 301 ? ? 1.84 2 1 OE2 A GLU 211 ? ? O A HOH 302 ? ? 1.87 3 1 O B HOH 370 ? ? O B HOH 387 ? ? 1.94 4 1 OD1 A ASN 202 ? B O A HOH 303 ? ? 1.96 5 1 O A HOH 305 ? ? O A HOH 337 ? ? 1.97 6 1 OE2 B GLU 235 ? ? O B HOH 302 ? ? 2.02 7 1 O B HOH 324 ? ? O B HOH 363 ? ? 2.12 8 1 OE1 B GLU 249 ? A O B HOH 303 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O B HOH 369 ? ? 1_555 O B HOH 373 ? ? 12_575 2.05 2 1 O B HOH 369 ? ? 1_555 O B HOH 387 ? ? 12_575 2.18 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 180 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.138 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B HOH 398 ? D HOH . 2 1 B HOH 399 ? D HOH . # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id B _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 399 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.81 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 174 ? A ASP 1 2 1 Y 1 A GLU 223 ? A GLU 50 3 1 Y 1 B THR 228 ? B THR 1 4 1 Y 1 B SER 229 ? B SER 2 5 1 Y 1 B ASN 230 ? B ASN 3 6 1 Y 1 B GLY 275 ? B GLY 48 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 VAL N N N N 304 VAL CA C N S 305 VAL C C N N 306 VAL O O N N 307 VAL CB C N N 308 VAL CG1 C N N 309 VAL CG2 C N N 310 VAL OXT O N N 311 VAL H H N N 312 VAL H2 H N N 313 VAL HA H N N 314 VAL HB H N N 315 VAL HG11 H N N 316 VAL HG12 H N N 317 VAL HG13 H N N 318 VAL HG21 H N N 319 VAL HG22 H N N 320 VAL HG23 H N N 321 VAL HXT H N N 322 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 SER N CA sing N N 260 SER N H sing N N 261 SER N H2 sing N N 262 SER CA C sing N N 263 SER CA CB sing N N 264 SER CA HA sing N N 265 SER C O doub N N 266 SER C OXT sing N N 267 SER CB OG sing N N 268 SER CB HB2 sing N N 269 SER CB HB3 sing N N 270 SER OG HG sing N N 271 SER OXT HXT sing N N 272 THR N CA sing N N 273 THR N H sing N N 274 THR N H2 sing N N 275 THR CA C sing N N 276 THR CA CB sing N N 277 THR CA HA sing N N 278 THR C O doub N N 279 THR C OXT sing N N 280 THR CB OG1 sing N N 281 THR CB CG2 sing N N 282 THR CB HB sing N N 283 THR OG1 HG1 sing N N 284 THR CG2 HG21 sing N N 285 THR CG2 HG22 sing N N 286 THR CG2 HG23 sing N N 287 THR OXT HXT sing N N 288 VAL N CA sing N N 289 VAL N H sing N N 290 VAL N H2 sing N N 291 VAL CA C sing N N 292 VAL CA CB sing N N 293 VAL CA HA sing N N 294 VAL C O doub N N 295 VAL C OXT sing N N 296 VAL CB CG1 sing N N 297 VAL CB CG2 sing N N 298 VAL CB HB sing N N 299 VAL CG1 HG11 sing N N 300 VAL CG1 HG12 sing N N 301 VAL CG1 HG13 sing N N 302 VAL CG2 HG21 sing N N 303 VAL CG2 HG22 sing N N 304 VAL CG2 HG23 sing N N 305 VAL OXT HXT sing N N 306 # _atom_sites.entry_id 5YR0 _atom_sites.fract_transf_matrix[1][1] 0.022167 _atom_sites.fract_transf_matrix[1][2] 0.012798 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025596 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006191 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_