data_5YWJ # _entry.id 5YWJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YWJ pdb_00005ywj 10.2210/pdb5ywj/pdb WWPDB D_1300006029 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YWJ _pdbx_database_status.recvd_initial_deposition_date 2017-11-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Wang, Q.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of SarX from Staphylococcus aureus' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Wang, Q.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5YWJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 33.392 _cell.length_a_esd ? _cell.length_b 33.392 _cell.length_b_esd ? _cell.length_c 230.930 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YWJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HTH-type transcriptional regulator SarX' 15030.436 1 ? ? ? ? 2 water nat water 18.015 17 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Staphylococcal accessory regulator X' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHMNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLDLTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIR RLIEKERLSKVRSSKDERKIYIYLNNDDISKFNALFEDVEQFLNI ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHMNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLDLTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIR RLIEKERLSKVRSSKDERKIYIYLNNDDISKFNALFEDVEQFLNI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 MET n 1 8 ASN n 1 9 THR n 1 10 GLU n 1 11 LYS n 1 12 LEU n 1 13 GLU n 1 14 THR n 1 15 LEU n 1 16 LEU n 1 17 GLY n 1 18 PHE n 1 19 TYR n 1 20 LYS n 1 21 GLN n 1 22 TYR n 1 23 LYS n 1 24 ALA n 1 25 LEU n 1 26 SER n 1 27 GLU n 1 28 TYR n 1 29 ILE n 1 30 ASP n 1 31 LYS n 1 32 LYS n 1 33 TYR n 1 34 LYS n 1 35 LEU n 1 36 SER n 1 37 LEU n 1 38 ASN n 1 39 ASP n 1 40 LEU n 1 41 ALA n 1 42 VAL n 1 43 LEU n 1 44 ASP n 1 45 LEU n 1 46 THR n 1 47 MET n 1 48 LYS n 1 49 HIS n 1 50 CYS n 1 51 LYS n 1 52 ASP n 1 53 GLU n 1 54 LYS n 1 55 VAL n 1 56 LEU n 1 57 MET n 1 58 GLN n 1 59 SER n 1 60 PHE n 1 61 LEU n 1 62 LYS n 1 63 THR n 1 64 ALA n 1 65 MET n 1 66 ASP n 1 67 GLU n 1 68 LEU n 1 69 ASP n 1 70 LEU n 1 71 SER n 1 72 ARG n 1 73 THR n 1 74 LYS n 1 75 LEU n 1 76 LEU n 1 77 VAL n 1 78 SER n 1 79 ILE n 1 80 ARG n 1 81 ARG n 1 82 LEU n 1 83 ILE n 1 84 GLU n 1 85 LYS n 1 86 GLU n 1 87 ARG n 1 88 LEU n 1 89 SER n 1 90 LYS n 1 91 VAL n 1 92 ARG n 1 93 SER n 1 94 SER n 1 95 LYS n 1 96 ASP n 1 97 GLU n 1 98 ARG n 1 99 LYS n 1 100 ILE n 1 101 TYR n 1 102 ILE n 1 103 TYR n 1 104 LEU n 1 105 ASN n 1 106 ASN n 1 107 ASP n 1 108 ASP n 1 109 ILE n 1 110 SER n 1 111 LYS n 1 112 PHE n 1 113 ASN n 1 114 ALA n 1 115 LEU n 1 116 PHE n 1 117 GLU n 1 118 ASP n 1 119 VAL n 1 120 GLU n 1 121 GLN n 1 122 PHE n 1 123 LEU n 1 124 ASN n 1 125 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'sarX, SAOUHSC_00674' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'NCTC 8325' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus (strain NCTC 8325)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 93061 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain K-12 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SARX_STAA8 _struct_ref.pdbx_db_accession Q2G0D1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLDLTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKE RLSKVRSSKDERKIYIYLNNDDISKFNALFEDVEQFLNI ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5YWJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2G0D1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 119 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 119 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5YWJ HIS A 1 ? UNP Q2G0D1 ? ? 'expression tag' -5 1 1 5YWJ HIS A 2 ? UNP Q2G0D1 ? ? 'expression tag' -4 2 1 5YWJ HIS A 3 ? UNP Q2G0D1 ? ? 'expression tag' -3 3 1 5YWJ HIS A 4 ? UNP Q2G0D1 ? ? 'expression tag' -2 4 1 5YWJ HIS A 5 ? UNP Q2G0D1 ? ? 'expression tag' -1 5 1 5YWJ HIS A 6 ? UNP Q2G0D1 ? ? 'expression tag' 0 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YWJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289.16 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Bicine pH9.0, 1,4-Dioxane, PEG 20000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X 1M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-06-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97774 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97774 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5YWJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 57.74 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8345 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.2 _reflns.pdbx_Rmerge_I_obs 0.087 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.087 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.19 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.14 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 557 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.221 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.6 _reflns_shell.pdbx_Rsym_value 0.221 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YWJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.102 _refine.ls_d_res_low 23.612 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8323 _refine.ls_number_reflns_R_free 386 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.72 _refine.ls_percent_reflns_R_free 4.64 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2489 _refine.ls_R_factor_R_free 0.2849 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2472 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.40 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5HS5 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.58 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 820 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 837 _refine_hist.d_res_high 2.102 _refine_hist.d_res_low 23.612 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 830 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.031 ? 1123 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.939 ? 289 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.074 ? 140 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 137 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1018 2.4056 . . 130 2578 100.00 . . . 0.3035 . 0.2221 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4056 3.0299 . . 129 2612 100.00 . . . 0.3374 . 0.2947 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0299 23.6132 . . 127 2747 97.00 . . . 0.2658 . 0.2369 . . . . . . . . . . # _struct.entry_id 5YWJ _struct.title 'Global regulatory element SarX' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YWJ _struct_keywords.text 'Global regulatory element, DNA-binding, transcriptional contral, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 15 ? LYS A 34 ? LEU A 9 LYS A 28 1 ? 20 HELX_P HELX_P2 AA2 SER A 36 ? CYS A 50 ? SER A 30 CYS A 44 1 ? 15 HELX_P HELX_P3 AA3 MET A 57 ? ASP A 69 ? MET A 51 ASP A 63 1 ? 13 HELX_P HELX_P4 AA4 SER A 71 ? LYS A 85 ? SER A 65 LYS A 79 1 ? 15 HELX_P HELX_P5 AA5 ASN A 105 ? ASN A 124 ? ASN A 99 ASN A 118 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 55 ? LEU A 56 ? VAL A 49 LEU A 50 AA1 2 ILE A 100 ? TYR A 103 ? ILE A 94 TYR A 97 AA1 3 SER A 89 ? ARG A 92 ? SER A 83 ARG A 86 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 55 ? N VAL A 49 O ILE A 102 ? O ILE A 96 AA1 2 3 O TYR A 101 ? O TYR A 95 N VAL A 91 ? N VAL A 85 # _atom_sites.entry_id 5YWJ _atom_sites.fract_transf_matrix[1][1] 0.029947 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.029947 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004330 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -5 ? ? ? A . n A 1 2 HIS 2 -4 ? ? ? A . n A 1 3 HIS 3 -3 ? ? ? A . n A 1 4 HIS 4 -2 ? ? ? A . n A 1 5 HIS 5 -1 ? ? ? A . n A 1 6 HIS 6 0 ? ? ? A . n A 1 7 MET 7 1 ? ? ? A . n A 1 8 ASN 8 2 ? ? ? A . n A 1 9 THR 9 3 ? ? ? A . n A 1 10 GLU 10 4 ? ? ? A . n A 1 11 LYS 11 5 ? ? ? A . n A 1 12 LEU 12 6 ? ? ? A . n A 1 13 GLU 13 7 ? ? ? A . n A 1 14 THR 14 8 ? ? ? A . n A 1 15 LEU 15 9 9 LEU LEU A . n A 1 16 LEU 16 10 10 LEU LEU A . n A 1 17 GLY 17 11 11 GLY GLY A . n A 1 18 PHE 18 12 12 PHE PHE A . n A 1 19 TYR 19 13 13 TYR TYR A . n A 1 20 LYS 20 14 14 LYS LYS A . n A 1 21 GLN 21 15 15 GLN GLN A . n A 1 22 TYR 22 16 16 TYR TYR A . n A 1 23 LYS 23 17 17 LYS LYS A . n A 1 24 ALA 24 18 18 ALA ALA A . n A 1 25 LEU 25 19 19 LEU LEU A . n A 1 26 SER 26 20 20 SER SER A . n A 1 27 GLU 27 21 21 GLU GLU A . n A 1 28 TYR 28 22 22 TYR TYR A . n A 1 29 ILE 29 23 23 ILE ILE A . n A 1 30 ASP 30 24 24 ASP ASP A . n A 1 31 LYS 31 25 25 LYS LYS A . n A 1 32 LYS 32 26 26 LYS LYS A . n A 1 33 TYR 33 27 27 TYR TYR A . n A 1 34 LYS 34 28 28 LYS LYS A . n A 1 35 LEU 35 29 29 LEU LEU A . n A 1 36 SER 36 30 30 SER SER A . n A 1 37 LEU 37 31 31 LEU LEU A . n A 1 38 ASN 38 32 32 ASN ASN A . n A 1 39 ASP 39 33 33 ASP ASP A . n A 1 40 LEU 40 34 34 LEU LEU A . n A 1 41 ALA 41 35 35 ALA ALA A . n A 1 42 VAL 42 36 36 VAL VAL A . n A 1 43 LEU 43 37 37 LEU LEU A . n A 1 44 ASP 44 38 38 ASP ASP A . n A 1 45 LEU 45 39 39 LEU LEU A . n A 1 46 THR 46 40 40 THR THR A . n A 1 47 MET 47 41 41 MET MET A . n A 1 48 LYS 48 42 42 LYS LYS A . n A 1 49 HIS 49 43 43 HIS HIS A . n A 1 50 CYS 50 44 44 CYS CYS A . n A 1 51 LYS 51 45 45 LYS LYS A . n A 1 52 ASP 52 46 46 ASP ASP A . n A 1 53 GLU 53 47 47 GLU GLU A . n A 1 54 LYS 54 48 48 LYS LYS A . n A 1 55 VAL 55 49 49 VAL VAL A . n A 1 56 LEU 56 50 50 LEU LEU A . n A 1 57 MET 57 51 51 MET MET A . n A 1 58 GLN 58 52 52 GLN GLN A . n A 1 59 SER 59 53 53 SER SER A . n A 1 60 PHE 60 54 54 PHE PHE A . n A 1 61 LEU 61 55 55 LEU LEU A . n A 1 62 LYS 62 56 56 LYS LYS A . n A 1 63 THR 63 57 57 THR THR A . n A 1 64 ALA 64 58 58 ALA ALA A . n A 1 65 MET 65 59 59 MET MET A . n A 1 66 ASP 66 60 60 ASP ASP A . n A 1 67 GLU 67 61 61 GLU GLU A . n A 1 68 LEU 68 62 62 LEU LEU A . n A 1 69 ASP 69 63 63 ASP ASP A . n A 1 70 LEU 70 64 64 LEU LEU A . n A 1 71 SER 71 65 65 SER SER A . n A 1 72 ARG 72 66 66 ARG ARG A . n A 1 73 THR 73 67 67 THR THR A . n A 1 74 LYS 74 68 68 LYS LYS A . n A 1 75 LEU 75 69 69 LEU LEU A . n A 1 76 LEU 76 70 70 LEU LEU A . n A 1 77 VAL 77 71 71 VAL VAL A . n A 1 78 SER 78 72 72 SER SER A . n A 1 79 ILE 79 73 73 ILE ILE A . n A 1 80 ARG 80 74 74 ARG ARG A . n A 1 81 ARG 81 75 75 ARG ARG A . n A 1 82 LEU 82 76 76 LEU LEU A . n A 1 83 ILE 83 77 77 ILE ILE A . n A 1 84 GLU 84 78 78 GLU GLU A . n A 1 85 LYS 85 79 79 LYS LYS A . n A 1 86 GLU 86 80 80 GLU GLU A . n A 1 87 ARG 87 81 81 ARG ARG A . n A 1 88 LEU 88 82 82 LEU LEU A . n A 1 89 SER 89 83 83 SER SER A . n A 1 90 LYS 90 84 84 LYS LYS A . n A 1 91 VAL 91 85 85 VAL VAL A . n A 1 92 ARG 92 86 86 ARG ARG A . n A 1 93 SER 93 87 87 SER SER A . n A 1 94 SER 94 88 88 SER SER A . n A 1 95 LYS 95 89 89 LYS LYS A . n A 1 96 ASP 96 90 90 ASP ASP A . n A 1 97 GLU 97 91 91 GLU GLU A . n A 1 98 ARG 98 92 92 ARG ARG A . n A 1 99 LYS 99 93 93 LYS LYS A . n A 1 100 ILE 100 94 94 ILE ILE A . n A 1 101 TYR 101 95 95 TYR TYR A . n A 1 102 ILE 102 96 96 ILE ILE A . n A 1 103 TYR 103 97 97 TYR TYR A . n A 1 104 LEU 104 98 98 LEU LEU A . n A 1 105 ASN 105 99 99 ASN ASN A . n A 1 106 ASN 106 100 100 ASN ASN A . n A 1 107 ASP 107 101 101 ASP ASP A . n A 1 108 ASP 108 102 102 ASP ASP A . n A 1 109 ILE 109 103 103 ILE ILE A . n A 1 110 SER 110 104 104 SER SER A . n A 1 111 LYS 111 105 105 LYS LYS A . n A 1 112 PHE 112 106 106 PHE PHE A . n A 1 113 ASN 113 107 107 ASN ASN A . n A 1 114 ALA 114 108 108 ALA ALA A . n A 1 115 LEU 115 109 109 LEU LEU A . n A 1 116 PHE 116 110 110 PHE PHE A . n A 1 117 GLU 117 111 111 GLU GLU A . n A 1 118 ASP 118 112 112 ASP ASP A . n A 1 119 VAL 119 113 113 VAL VAL A . n A 1 120 GLU 120 114 114 GLU GLU A . n A 1 121 GLN 121 115 115 GLN GLN A . n A 1 122 PHE 122 116 116 PHE PHE A . n A 1 123 LEU 123 117 117 LEU LEU A . n A 1 124 ASN 124 118 118 ASN ASN A . n A 1 125 ILE 125 119 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 10 HOH HOH A . B 2 HOH 2 202 4 HOH HOH A . B 2 HOH 3 203 8 HOH HOH A . B 2 HOH 4 204 12 HOH HOH A . B 2 HOH 5 205 17 HOH HOH A . B 2 HOH 6 206 13 HOH HOH A . B 2 HOH 7 207 1 HOH HOH A . B 2 HOH 8 208 15 HOH HOH A . B 2 HOH 9 209 3 HOH HOH A . B 2 HOH 10 210 2 HOH HOH A . B 2 HOH 11 211 16 HOH HOH A . B 2 HOH 12 212 6 HOH HOH A . B 2 HOH 13 213 19 HOH HOH A . B 2 HOH 14 214 22 HOH HOH A . B 2 HOH 15 215 5 HOH HOH A . B 2 HOH 16 216 7 HOH HOH A . B 2 HOH 17 217 21 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6420 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-05 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 14.0315 _pdbx_refine_tls.origin_y 10.4895 _pdbx_refine_tls.origin_z 16.1537 _pdbx_refine_tls.T[1][1] 0.2788 _pdbx_refine_tls.T[2][2] 0.2124 _pdbx_refine_tls.T[3][3] 0.2569 _pdbx_refine_tls.T[1][2] -0.0418 _pdbx_refine_tls.T[1][3] -0.0117 _pdbx_refine_tls.T[2][3] 0.0028 _pdbx_refine_tls.L[1][1] 2.7504 _pdbx_refine_tls.L[2][2] 3.7638 _pdbx_refine_tls.L[3][3] 8.3851 _pdbx_refine_tls.L[1][2] 0.1817 _pdbx_refine_tls.L[1][3] -1.4917 _pdbx_refine_tls.L[2][3] -2.6501 _pdbx_refine_tls.S[1][1] 0.0772 _pdbx_refine_tls.S[1][2] -0.0669 _pdbx_refine_tls.S[1][3] -0.0288 _pdbx_refine_tls.S[2][1] 0.4889 _pdbx_refine_tls.S[2][2] -0.1017 _pdbx_refine_tls.S[2][3] 0.1421 _pdbx_refine_tls.S[3][1] -0.3483 _pdbx_refine_tls.S[3][2] 0.2451 _pdbx_refine_tls.S[3][3] 0.0238 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.2_1309 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 46 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -83.35 _pdbx_validate_torsion.psi -72.33 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 9 ? CG ? A LEU 15 CG 2 1 Y 1 A LEU 9 ? CD1 ? A LEU 15 CD1 3 1 Y 1 A LEU 9 ? CD2 ? A LEU 15 CD2 4 1 Y 1 A LEU 10 ? CG ? A LEU 16 CG 5 1 Y 1 A LEU 10 ? CD1 ? A LEU 16 CD1 6 1 Y 1 A LEU 10 ? CD2 ? A LEU 16 CD2 7 1 Y 1 A PHE 12 ? CG ? A PHE 18 CG 8 1 Y 1 A PHE 12 ? CD1 ? A PHE 18 CD1 9 1 Y 1 A PHE 12 ? CD2 ? A PHE 18 CD2 10 1 Y 1 A PHE 12 ? CE1 ? A PHE 18 CE1 11 1 Y 1 A PHE 12 ? CE2 ? A PHE 18 CE2 12 1 Y 1 A PHE 12 ? CZ ? A PHE 18 CZ 13 1 Y 1 A GLN 15 ? CG ? A GLN 21 CG 14 1 Y 1 A GLN 15 ? CD ? A GLN 21 CD 15 1 Y 1 A GLN 15 ? OE1 ? A GLN 21 OE1 16 1 Y 1 A GLN 15 ? NE2 ? A GLN 21 NE2 17 1 Y 1 A LYS 17 ? CG ? A LYS 23 CG 18 1 Y 1 A LYS 17 ? CD ? A LYS 23 CD 19 1 Y 1 A LYS 17 ? CE ? A LYS 23 CE 20 1 Y 1 A LYS 17 ? NZ ? A LYS 23 NZ 21 1 Y 1 A GLU 21 ? CG ? A GLU 27 CG 22 1 Y 1 A GLU 21 ? CD ? A GLU 27 CD 23 1 Y 1 A GLU 21 ? OE1 ? A GLU 27 OE1 24 1 Y 1 A GLU 21 ? OE2 ? A GLU 27 OE2 25 1 Y 1 A LYS 25 ? CG ? A LYS 31 CG 26 1 Y 1 A LYS 25 ? CD ? A LYS 31 CD 27 1 Y 1 A LYS 25 ? CE ? A LYS 31 CE 28 1 Y 1 A LYS 25 ? NZ ? A LYS 31 NZ 29 1 Y 1 A LYS 28 ? CG ? A LYS 34 CG 30 1 Y 1 A LYS 28 ? CD ? A LYS 34 CD 31 1 Y 1 A LYS 28 ? CE ? A LYS 34 CE 32 1 Y 1 A LYS 28 ? NZ ? A LYS 34 NZ 33 1 Y 1 A LYS 45 ? CG ? A LYS 51 CG 34 1 Y 1 A LYS 45 ? CD ? A LYS 51 CD 35 1 Y 1 A LYS 45 ? CE ? A LYS 51 CE 36 1 Y 1 A LYS 45 ? NZ ? A LYS 51 NZ 37 1 Y 1 A ASP 46 ? CG ? A ASP 52 CG 38 1 Y 1 A ASP 46 ? OD1 ? A ASP 52 OD1 39 1 Y 1 A ASP 46 ? OD2 ? A ASP 52 OD2 40 1 Y 1 A GLU 47 ? CG ? A GLU 53 CG 41 1 Y 1 A GLU 47 ? CD ? A GLU 53 CD 42 1 Y 1 A GLU 47 ? OE1 ? A GLU 53 OE1 43 1 Y 1 A GLU 47 ? OE2 ? A GLU 53 OE2 44 1 Y 1 A GLN 52 ? CG ? A GLN 58 CG 45 1 Y 1 A GLN 52 ? CD ? A GLN 58 CD 46 1 Y 1 A GLN 52 ? OE1 ? A GLN 58 OE1 47 1 Y 1 A GLN 52 ? NE2 ? A GLN 58 NE2 48 1 Y 1 A LYS 56 ? CG ? A LYS 62 CG 49 1 Y 1 A LYS 56 ? CD ? A LYS 62 CD 50 1 Y 1 A LYS 56 ? CE ? A LYS 62 CE 51 1 Y 1 A LYS 56 ? NZ ? A LYS 62 NZ 52 1 Y 1 A ASP 60 ? CG ? A ASP 66 CG 53 1 Y 1 A ASP 60 ? OD1 ? A ASP 66 OD1 54 1 Y 1 A ASP 60 ? OD2 ? A ASP 66 OD2 55 1 Y 1 A GLU 61 ? CG ? A GLU 67 CG 56 1 Y 1 A GLU 61 ? CD ? A GLU 67 CD 57 1 Y 1 A GLU 61 ? OE1 ? A GLU 67 OE1 58 1 Y 1 A GLU 61 ? OE2 ? A GLU 67 OE2 59 1 Y 1 A ASP 63 ? CG ? A ASP 69 CG 60 1 Y 1 A ASP 63 ? OD1 ? A ASP 69 OD1 61 1 Y 1 A ASP 63 ? OD2 ? A ASP 69 OD2 62 1 Y 1 A ARG 66 ? CG ? A ARG 72 CG 63 1 Y 1 A ARG 66 ? CD ? A ARG 72 CD 64 1 Y 1 A ARG 66 ? NE ? A ARG 72 NE 65 1 Y 1 A ARG 66 ? CZ ? A ARG 72 CZ 66 1 Y 1 A ARG 66 ? NH1 ? A ARG 72 NH1 67 1 Y 1 A ARG 66 ? NH2 ? A ARG 72 NH2 68 1 Y 1 A ARG 75 ? CG ? A ARG 81 CG 69 1 Y 1 A ARG 75 ? CD ? A ARG 81 CD 70 1 Y 1 A ARG 75 ? NE ? A ARG 81 NE 71 1 Y 1 A ARG 75 ? CZ ? A ARG 81 CZ 72 1 Y 1 A ARG 75 ? NH1 ? A ARG 81 NH1 73 1 Y 1 A ARG 75 ? NH2 ? A ARG 81 NH2 74 1 Y 1 A GLU 78 ? CG ? A GLU 84 CG 75 1 Y 1 A GLU 78 ? CD ? A GLU 84 CD 76 1 Y 1 A GLU 78 ? OE1 ? A GLU 84 OE1 77 1 Y 1 A GLU 78 ? OE2 ? A GLU 84 OE2 78 1 Y 1 A LYS 89 ? CG ? A LYS 95 CG 79 1 Y 1 A LYS 89 ? CD ? A LYS 95 CD 80 1 Y 1 A LYS 89 ? CE ? A LYS 95 CE 81 1 Y 1 A LYS 89 ? NZ ? A LYS 95 NZ 82 1 Y 1 A ASP 90 ? CG ? A ASP 96 CG 83 1 Y 1 A ASP 90 ? OD1 ? A ASP 96 OD1 84 1 Y 1 A ASP 90 ? OD2 ? A ASP 96 OD2 85 1 Y 1 A GLU 91 ? CG ? A GLU 97 CG 86 1 Y 1 A GLU 91 ? CD ? A GLU 97 CD 87 1 Y 1 A GLU 91 ? OE1 ? A GLU 97 OE1 88 1 Y 1 A GLU 91 ? OE2 ? A GLU 97 OE2 89 1 Y 1 A ARG 92 ? CG ? A ARG 98 CG 90 1 Y 1 A ARG 92 ? CD ? A ARG 98 CD 91 1 Y 1 A ARG 92 ? NE ? A ARG 98 NE 92 1 Y 1 A ARG 92 ? CZ ? A ARG 98 CZ 93 1 Y 1 A ARG 92 ? NH1 ? A ARG 98 NH1 94 1 Y 1 A ARG 92 ? NH2 ? A ARG 98 NH2 95 1 Y 1 A LYS 93 ? CG ? A LYS 99 CG 96 1 Y 1 A LYS 93 ? CD ? A LYS 99 CD 97 1 Y 1 A LYS 93 ? CE ? A LYS 99 CE 98 1 Y 1 A LYS 93 ? NZ ? A LYS 99 NZ 99 1 Y 1 A ASN 118 ? CG ? A ASN 124 CG 100 1 Y 1 A ASN 118 ? OD1 ? A ASN 124 OD1 101 1 Y 1 A ASN 118 ? ND2 ? A ASN 124 ND2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS -5 ? A HIS 1 2 1 Y 1 A HIS -4 ? A HIS 2 3 1 Y 1 A HIS -3 ? A HIS 3 4 1 Y 1 A HIS -2 ? A HIS 4 5 1 Y 1 A HIS -1 ? A HIS 5 6 1 Y 1 A HIS 0 ? A HIS 6 7 1 Y 1 A MET 1 ? A MET 7 8 1 Y 1 A ASN 2 ? A ASN 8 9 1 Y 1 A THR 3 ? A THR 9 10 1 Y 1 A GLU 4 ? A GLU 10 11 1 Y 1 A LYS 5 ? A LYS 11 12 1 Y 1 A LEU 6 ? A LEU 12 13 1 Y 1 A GLU 7 ? A GLU 13 14 1 Y 1 A THR 8 ? A THR 14 15 1 Y 1 A ILE 119 ? A ILE 125 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 SER N CA sing N N 260 SER N H sing N N 261 SER N H2 sing N N 262 SER CA C sing N N 263 SER CA CB sing N N 264 SER CA HA sing N N 265 SER C O doub N N 266 SER C OXT sing N N 267 SER CB OG sing N N 268 SER CB HB2 sing N N 269 SER CB HB3 sing N N 270 SER OG HG sing N N 271 SER OXT HXT sing N N 272 THR N CA sing N N 273 THR N H sing N N 274 THR N H2 sing N N 275 THR CA C sing N N 276 THR CA CB sing N N 277 THR CA HA sing N N 278 THR C O doub N N 279 THR C OXT sing N N 280 THR CB OG1 sing N N 281 THR CB CG2 sing N N 282 THR CB HB sing N N 283 THR OG1 HG1 sing N N 284 THR CG2 HG21 sing N N 285 THR CG2 HG22 sing N N 286 THR CG2 HG23 sing N N 287 THR OXT HXT sing N N 288 TYR N CA sing N N 289 TYR N H sing N N 290 TYR N H2 sing N N 291 TYR CA C sing N N 292 TYR CA CB sing N N 293 TYR CA HA sing N N 294 TYR C O doub N N 295 TYR C OXT sing N N 296 TYR CB CG sing N N 297 TYR CB HB2 sing N N 298 TYR CB HB3 sing N N 299 TYR CG CD1 doub Y N 300 TYR CG CD2 sing Y N 301 TYR CD1 CE1 sing Y N 302 TYR CD1 HD1 sing N N 303 TYR CD2 CE2 doub Y N 304 TYR CD2 HD2 sing N N 305 TYR CE1 CZ doub Y N 306 TYR CE1 HE1 sing N N 307 TYR CE2 CZ sing Y N 308 TYR CE2 HE2 sing N N 309 TYR CZ OH sing N N 310 TYR OH HH sing N N 311 TYR OXT HXT sing N N 312 VAL N CA sing N N 313 VAL N H sing N N 314 VAL N H2 sing N N 315 VAL CA C sing N N 316 VAL CA CB sing N N 317 VAL CA HA sing N N 318 VAL C O doub N N 319 VAL C OXT sing N N 320 VAL CB CG1 sing N N 321 VAL CB CG2 sing N N 322 VAL CB HB sing N N 323 VAL CG1 HG11 sing N N 324 VAL CG1 HG12 sing N N 325 VAL CG1 HG13 sing N N 326 VAL CG2 HG21 sing N N 327 VAL CG2 HG22 sing N N 328 VAL CG2 HG23 sing N N 329 VAL OXT HXT sing N N 330 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China' China 31130018 1 'National Natural Science Foundation of China' China 31370732 2 'National Natural Science Foundation of China' China 31270014 3 'National Natural Science Foundation of China' China U1432107 4 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5HS5 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #