data_5YZ4 # _entry.id 5YZ4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YZ4 pdb_00005yz4 10.2210/pdb5yz4/pdb WWPDB D_1300006144 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YZ4 _pdbx_database_status.recvd_initial_deposition_date 2017-12-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Du, Y.' 1 ? 'An, W.' 2 ? 'Ye, K.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos One' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1932-6203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first e0195723 _citation.page_last e0195723 _citation.title 'Structural and functional analysis of Utp24, an endonuclease for processing 18S ribosomal RNA.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pone.0195723 _citation.pdbx_database_id_PubMed 29641590 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'An, W.' 1 ? primary 'Du, Y.' 2 ? primary 'Ye, K.' 3 0000-0001-6169-7049 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5YZ4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.740 _cell.length_a_esd ? _cell.length_b 73.328 _cell.length_b_esd ? _cell.length_c 74.262 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YZ4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'rRNA-processing protein fcf1' 15369.198 1 ? ? 'UNP residues 60-192' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 14 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SLGPPYHVIIDTNFINFCLQQKIDLFEGLMTCLYAKTIPCISDCVMAELEKLGIRYRIALRIAKDERFERLPCTHKGTYA DDCIVQRVMQHKCYLVATNDKNLKQRIRKIPGIPILSVANHKIRVERLVDVVD ; _entity_poly.pdbx_seq_one_letter_code_can ;SLGPPYHVIIDTNFINFCLQQKIDLFEGLMTCLYAKTIPCISDCVMAELEKLGIRYRIALRIAKDERFERLPCTHKGTYA DDCIVQRVMQHKCYLVATNDKNLKQRIRKIPGIPILSVANHKIRVERLVDVVD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 GLY n 1 4 PRO n 1 5 PRO n 1 6 TYR n 1 7 HIS n 1 8 VAL n 1 9 ILE n 1 10 ILE n 1 11 ASP n 1 12 THR n 1 13 ASN n 1 14 PHE n 1 15 ILE n 1 16 ASN n 1 17 PHE n 1 18 CYS n 1 19 LEU n 1 20 GLN n 1 21 GLN n 1 22 LYS n 1 23 ILE n 1 24 ASP n 1 25 LEU n 1 26 PHE n 1 27 GLU n 1 28 GLY n 1 29 LEU n 1 30 MET n 1 31 THR n 1 32 CYS n 1 33 LEU n 1 34 TYR n 1 35 ALA n 1 36 LYS n 1 37 THR n 1 38 ILE n 1 39 PRO n 1 40 CYS n 1 41 ILE n 1 42 SER n 1 43 ASP n 1 44 CYS n 1 45 VAL n 1 46 MET n 1 47 ALA n 1 48 GLU n 1 49 LEU n 1 50 GLU n 1 51 LYS n 1 52 LEU n 1 53 GLY n 1 54 ILE n 1 55 ARG n 1 56 TYR n 1 57 ARG n 1 58 ILE n 1 59 ALA n 1 60 LEU n 1 61 ARG n 1 62 ILE n 1 63 ALA n 1 64 LYS n 1 65 ASP n 1 66 GLU n 1 67 ARG n 1 68 PHE n 1 69 GLU n 1 70 ARG n 1 71 LEU n 1 72 PRO n 1 73 CYS n 1 74 THR n 1 75 HIS n 1 76 LYS n 1 77 GLY n 1 78 THR n 1 79 TYR n 1 80 ALA n 1 81 ASP n 1 82 ASP n 1 83 CYS n 1 84 ILE n 1 85 VAL n 1 86 GLN n 1 87 ARG n 1 88 VAL n 1 89 MET n 1 90 GLN n 1 91 HIS n 1 92 LYS n 1 93 CYS n 1 94 TYR n 1 95 LEU n 1 96 VAL n 1 97 ALA n 1 98 THR n 1 99 ASN n 1 100 ASP n 1 101 LYS n 1 102 ASN n 1 103 LEU n 1 104 LYS n 1 105 GLN n 1 106 ARG n 1 107 ILE n 1 108 ARG n 1 109 LYS n 1 110 ILE n 1 111 PRO n 1 112 GLY n 1 113 ILE n 1 114 PRO n 1 115 ILE n 1 116 LEU n 1 117 SER n 1 118 VAL n 1 119 ALA n 1 120 ASN n 1 121 HIS n 1 122 LYS n 1 123 ILE n 1 124 ARG n 1 125 VAL n 1 126 GLU n 1 127 ARG n 1 128 LEU n 1 129 VAL n 1 130 ASP n 1 131 VAL n 1 132 VAL n 1 133 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 133 _entity_src_gen.gene_src_common_name 'Fission yeast' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene fcf1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 972h- _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schizosaccharomyces pombe 972h-' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 284812 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FCF1_SCHPO _struct_ref.pdbx_db_accession O13610 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SLGPPYHVIIDTNFINFCLQQKIDLFEGLMTCLYAKTIPCISDCVMAELEKLGIRYRIALRIAKDERFERLPCTHKGTYA DDCIVQRVMQHKCYLVATNDKNLKQRIRKIPGIPILSVANHKIRVERLVDVVD ; _struct_ref.pdbx_align_begin 60 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5YZ4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 133 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O13610 _struct_ref_seq.db_align_beg 60 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 192 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 60 _struct_ref_seq.pdbx_auth_seq_align_end 192 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YZ4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.02 _exptl_crystal.description Cluster _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M calcium acetate and 20% polyethylene glycol 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-16 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979135 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979135 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5YZ4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.13 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7270 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.1 _reflns.pdbx_Rmerge_I_obs 0.184 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.13 _reflns_shell.d_res_low 2.17 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 284 _reflns_shell.percent_possible_all 73.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.795 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YZ4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.135 _refine.ls_d_res_low 40.591 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6721 _refine.ls_number_reflns_R_free 668 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 87.39 _refine.ls_percent_reflns_R_free 9.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2282 _refine.ls_R_factor_R_free 0.2870 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2219 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4MJ7 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.72 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.32 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1072 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 1088 _refine_hist.d_res_high 2.135 _refine_hist.d_res_low 40.591 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1090 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.903 ? 1471 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 18.519 ? 679 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.055 ? 172 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 ? 186 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1348 2.2996 . . 102 891 66.00 . . . 0.3968 . 0.2830 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2996 2.5310 . . 115 1088 80.00 . . . 0.3580 . 0.2772 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5310 2.8971 . . 137 1270 92.00 . . . 0.3070 . 0.2596 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8971 3.6497 . . 151 1359 98.00 . . . 0.2726 . 0.2166 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6497 40.5985 . . 163 1445 100.00 . . . 0.2548 . 0.1916 . . . . . . . . . . # _struct.entry_id 5YZ4 _struct.title 'Structure of the PIN domain endonuclease Utp24' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YZ4 _struct_keywords.text 'PIN domain, ribonuclease, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 13 ? GLN A 21 ? ASN A 72 GLN A 80 1 ? 9 HELX_P HELX_P2 AA2 ASP A 24 ? TYR A 34 ? ASP A 83 TYR A 93 1 ? 11 HELX_P HELX_P3 AA3 ASP A 43 ? LEU A 52 ? ASP A 102 LEU A 111 1 ? 10 HELX_P HELX_P4 AA4 GLY A 53 ? ARG A 55 ? GLY A 112 ARG A 114 5 ? 3 HELX_P HELX_P5 AA5 TYR A 56 ? LYS A 64 ? TYR A 115 LYS A 123 1 ? 9 HELX_P HELX_P6 AA6 TYR A 79 ? HIS A 91 ? TYR A 138 HIS A 150 1 ? 13 HELX_P HELX_P7 AA7 ASP A 100 ? ARG A 108 ? ASP A 159 ARG A 167 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 93 SG ? ? ? 1_555 A CYS 93 SG ? ? A CYS 152 A CYS 152 3_555 ? ? ? ? ? ? ? 2.040 ? ? metalc1 metalc ? ? A CYS 44 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 103 A ZN 202 1_555 ? ? ? ? ? ? ? 2.539 ? ? metalc2 metalc ? ? A GLU 69 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 128 A CA 201 1_555 ? ? ? ? ? ? ? 2.116 ? ? metalc3 metalc ? ? A GLU 69 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 128 A CA 201 3_555 ? ? ? ? ? ? ? 2.116 ? ? metalc4 metalc ? ? A CYS 73 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 132 A ZN 202 1_555 ? ? ? ? ? ? ? 2.309 ? ? metalc5 metalc ? ? A HIS 75 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 134 A ZN 202 1_555 ? ? ? ? ? ? ? 1.838 ? ? metalc6 metalc ? ? A CYS 83 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 142 A ZN 202 1_555 ? ? ? ? ? ? ? 2.227 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 69 ? LEU A 71 ? GLU A 128 LEU A 130 AA1 2 THR A 37 ? SER A 42 ? THR A 96 SER A 101 AA1 3 TYR A 6 ? ILE A 10 ? TYR A 65 ILE A 69 AA1 4 LEU A 95 ? ALA A 97 ? LEU A 154 ALA A 156 AA1 5 ILE A 115 ? ALA A 119 ? ILE A 174 ALA A 178 AA1 6 LYS A 122 ? ARG A 127 ? LYS A 181 ARG A 186 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 69 ? O GLU A 128 N PRO A 39 ? N PRO A 98 AA1 2 3 O ILE A 38 ? O ILE A 97 N TYR A 6 ? N TYR A 65 AA1 3 4 N ILE A 9 ? N ILE A 68 O LEU A 95 ? O LEU A 154 AA1 4 5 N VAL A 96 ? N VAL A 155 O LEU A 116 ? O LEU A 175 AA1 5 6 N ALA A 119 ? N ALA A 178 O LYS A 122 ? O LYS A 181 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 201 ? 4 'binding site for residue CA A 201' AC2 Software A ZN 202 ? 4 'binding site for residue ZN A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 7 ? HIS A 66 . ? 1_555 ? 2 AC1 4 HIS A 7 ? HIS A 66 . ? 3_555 ? 3 AC1 4 GLU A 69 ? GLU A 128 . ? 3_555 ? 4 AC1 4 GLU A 69 ? GLU A 128 . ? 1_555 ? 5 AC2 4 CYS A 44 ? CYS A 103 . ? 1_555 ? 6 AC2 4 CYS A 73 ? CYS A 132 . ? 1_555 ? 7 AC2 4 HIS A 75 ? HIS A 134 . ? 1_555 ? 8 AC2 4 CYS A 83 ? CYS A 142 . ? 1_555 ? # _atom_sites.entry_id 5YZ4 _atom_sites.fract_transf_matrix[1][1] 0.020517 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013637 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013466 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 60 60 SER SER A . n A 1 2 LEU 2 61 61 LEU LEU A . n A 1 3 GLY 3 62 62 GLY GLY A . n A 1 4 PRO 4 63 63 PRO PRO A . n A 1 5 PRO 5 64 64 PRO PRO A . n A 1 6 TYR 6 65 65 TYR TYR A . n A 1 7 HIS 7 66 66 HIS HIS A . n A 1 8 VAL 8 67 67 VAL VAL A . n A 1 9 ILE 9 68 68 ILE ILE A . n A 1 10 ILE 10 69 69 ILE ILE A . n A 1 11 ASP 11 70 70 ASP ASP A . n A 1 12 THR 12 71 71 THR THR A . n A 1 13 ASN 13 72 72 ASN ASN A . n A 1 14 PHE 14 73 73 PHE PHE A . n A 1 15 ILE 15 74 74 ILE ILE A . n A 1 16 ASN 16 75 75 ASN ASN A . n A 1 17 PHE 17 76 76 PHE PHE A . n A 1 18 CYS 18 77 77 CYS CYS A . n A 1 19 LEU 19 78 78 LEU LEU A . n A 1 20 GLN 20 79 79 GLN GLN A . n A 1 21 GLN 21 80 80 GLN GLN A . n A 1 22 LYS 22 81 81 LYS LYS A . n A 1 23 ILE 23 82 82 ILE ILE A . n A 1 24 ASP 24 83 83 ASP ASP A . n A 1 25 LEU 25 84 84 LEU LEU A . n A 1 26 PHE 26 85 85 PHE PHE A . n A 1 27 GLU 27 86 86 GLU GLU A . n A 1 28 GLY 28 87 87 GLY GLY A . n A 1 29 LEU 29 88 88 LEU LEU A . n A 1 30 MET 30 89 89 MET MET A . n A 1 31 THR 31 90 90 THR THR A . n A 1 32 CYS 32 91 91 CYS CYS A . n A 1 33 LEU 33 92 92 LEU LEU A . n A 1 34 TYR 34 93 93 TYR TYR A . n A 1 35 ALA 35 94 94 ALA ALA A . n A 1 36 LYS 36 95 95 LYS LYS A . n A 1 37 THR 37 96 96 THR THR A . n A 1 38 ILE 38 97 97 ILE ILE A . n A 1 39 PRO 39 98 98 PRO PRO A . n A 1 40 CYS 40 99 99 CYS CYS A . n A 1 41 ILE 41 100 100 ILE ILE A . n A 1 42 SER 42 101 101 SER SER A . n A 1 43 ASP 43 102 102 ASP ASP A . n A 1 44 CYS 44 103 103 CYS CYS A . n A 1 45 VAL 45 104 104 VAL VAL A . n A 1 46 MET 46 105 105 MET MET A . n A 1 47 ALA 47 106 106 ALA ALA A . n A 1 48 GLU 48 107 107 GLU GLU A . n A 1 49 LEU 49 108 108 LEU LEU A . n A 1 50 GLU 50 109 109 GLU GLU A . n A 1 51 LYS 51 110 110 LYS LYS A . n A 1 52 LEU 52 111 111 LEU LEU A . n A 1 53 GLY 53 112 112 GLY GLY A . n A 1 54 ILE 54 113 113 ILE ILE A . n A 1 55 ARG 55 114 114 ARG ARG A . n A 1 56 TYR 56 115 115 TYR TYR A . n A 1 57 ARG 57 116 116 ARG ARG A . n A 1 58 ILE 58 117 117 ILE ILE A . n A 1 59 ALA 59 118 118 ALA ALA A . n A 1 60 LEU 60 119 119 LEU LEU A . n A 1 61 ARG 61 120 120 ARG ARG A . n A 1 62 ILE 62 121 121 ILE ILE A . n A 1 63 ALA 63 122 122 ALA ALA A . n A 1 64 LYS 64 123 123 LYS LYS A . n A 1 65 ASP 65 124 124 ASP ASP A . n A 1 66 GLU 66 125 125 GLU GLU A . n A 1 67 ARG 67 126 126 ARG ARG A . n A 1 68 PHE 68 127 127 PHE PHE A . n A 1 69 GLU 69 128 128 GLU GLU A . n A 1 70 ARG 70 129 129 ARG ARG A . n A 1 71 LEU 71 130 130 LEU LEU A . n A 1 72 PRO 72 131 131 PRO PRO A . n A 1 73 CYS 73 132 132 CYS CYS A . n A 1 74 THR 74 133 133 THR THR A . n A 1 75 HIS 75 134 134 HIS HIS A . n A 1 76 LYS 76 135 135 LYS LYS A . n A 1 77 GLY 77 136 136 GLY GLY A . n A 1 78 THR 78 137 137 THR THR A . n A 1 79 TYR 79 138 138 TYR TYR A . n A 1 80 ALA 80 139 139 ALA ALA A . n A 1 81 ASP 81 140 140 ASP ASP A . n A 1 82 ASP 82 141 141 ASP ASP A . n A 1 83 CYS 83 142 142 CYS CYS A . n A 1 84 ILE 84 143 143 ILE ILE A . n A 1 85 VAL 85 144 144 VAL VAL A . n A 1 86 GLN 86 145 145 GLN GLN A . n A 1 87 ARG 87 146 146 ARG ARG A . n A 1 88 VAL 88 147 147 VAL VAL A . n A 1 89 MET 89 148 148 MET MET A . n A 1 90 GLN 90 149 149 GLN GLN A . n A 1 91 HIS 91 150 150 HIS HIS A . n A 1 92 LYS 92 151 151 LYS LYS A . n A 1 93 CYS 93 152 152 CYS CYS A . n A 1 94 TYR 94 153 153 TYR TYR A . n A 1 95 LEU 95 154 154 LEU LEU A . n A 1 96 VAL 96 155 155 VAL VAL A . n A 1 97 ALA 97 156 156 ALA ALA A . n A 1 98 THR 98 157 157 THR THR A . n A 1 99 ASN 99 158 158 ASN ASN A . n A 1 100 ASP 100 159 159 ASP ASP A . n A 1 101 LYS 101 160 160 LYS LYS A . n A 1 102 ASN 102 161 161 ASN ASN A . n A 1 103 LEU 103 162 162 LEU LEU A . n A 1 104 LYS 104 163 163 LYS LYS A . n A 1 105 GLN 105 164 164 GLN GLN A . n A 1 106 ARG 106 165 165 ARG ARG A . n A 1 107 ILE 107 166 166 ILE ILE A . n A 1 108 ARG 108 167 167 ARG ARG A . n A 1 109 LYS 109 168 168 LYS LYS A . n A 1 110 ILE 110 169 169 ILE ILE A . n A 1 111 PRO 111 170 170 PRO PRO A . n A 1 112 GLY 112 171 171 GLY GLY A . n A 1 113 ILE 113 172 172 ILE ILE A . n A 1 114 PRO 114 173 173 PRO PRO A . n A 1 115 ILE 115 174 174 ILE ILE A . n A 1 116 LEU 116 175 175 LEU LEU A . n A 1 117 SER 117 176 176 SER SER A . n A 1 118 VAL 118 177 177 VAL VAL A . n A 1 119 ALA 119 178 178 ALA ALA A . n A 1 120 ASN 120 179 179 ASN ASN A . n A 1 121 HIS 121 180 180 HIS HIS A . n A 1 122 LYS 122 181 181 LYS LYS A . n A 1 123 ILE 123 182 182 ILE ILE A . n A 1 124 ARG 124 183 183 ARG ARG A . n A 1 125 VAL 125 184 184 VAL VAL A . n A 1 126 GLU 126 185 185 GLU GLU A . n A 1 127 ARG 127 186 186 ARG ARG A . n A 1 128 LEU 128 187 187 LEU LEU A . n A 1 129 VAL 129 188 188 VAL VAL A . n A 1 130 ASP 130 189 189 ASP ASP A . n A 1 131 VAL 131 190 190 VAL VAL A . n A 1 132 VAL 132 191 191 VAL VAL A . n A 1 133 ASP 133 192 192 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 1 CA CA A . C 3 ZN 1 202 1 ZN ZN A . D 4 HOH 1 301 12 HOH HOH A . D 4 HOH 2 302 6 HOH HOH A . D 4 HOH 3 303 4 HOH HOH A . D 4 HOH 4 304 8 HOH HOH A . D 4 HOH 5 305 14 HOH HOH A . D 4 HOH 6 306 10 HOH HOH A . D 4 HOH 7 307 2 HOH HOH A . D 4 HOH 8 308 1 HOH HOH A . D 4 HOH 9 309 7 HOH HOH A . D 4 HOH 10 310 3 HOH HOH A . D 4 HOH 11 311 11 HOH HOH A . D 4 HOH 12 312 9 HOH HOH A . D 4 HOH 13 313 13 HOH HOH A . D 4 HOH 14 314 5 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 80 ? 1 MORE -10 ? 1 'SSA (A^2)' 7570 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CA _pdbx_struct_special_symmetry.auth_seq_id 201 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id CA _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 44 ? A CYS 103 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 73 ? A CYS 132 ? 1_555 105.0 ? 2 SG ? A CYS 44 ? A CYS 103 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 75 ? A HIS 134 ? 1_555 127.9 ? 3 SG ? A CYS 73 ? A CYS 132 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 75 ? A HIS 134 ? 1_555 119.4 ? 4 SG ? A CYS 44 ? A CYS 103 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 83 ? A CYS 142 ? 1_555 88.9 ? 5 SG ? A CYS 73 ? A CYS 132 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 83 ? A CYS 142 ? 1_555 110.5 ? 6 NE2 ? A HIS 75 ? A HIS 134 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 83 ? A CYS 142 ? 1_555 99.0 ? 7 OE1 ? A GLU 69 ? A GLU 128 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 69 ? A GLU 128 ? 1_555 0.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-19 2 'Structure model' 2 0 2019-02-27 3 'Structure model' 2 1 2019-07-03 4 'Structure model' 2 2 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Database references' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Experimental preparation' 7 2 'Structure model' 'Polymer sequence' 8 2 'Structure model' 'Source and taxonomy' 9 2 'Structure model' 'Structure summary' 10 3 'Structure model' 'Data collection' 11 3 'Structure model' 'Database references' 12 4 'Structure model' 'Data collection' 13 4 'Structure model' 'Database references' 14 4 'Structure model' 'Derived calculations' 15 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' entity 3 2 'Structure model' entity_poly 4 2 'Structure model' entity_poly_seq 5 2 'Structure model' entity_src_gen 6 2 'Structure model' exptl_crystal 7 2 'Structure model' pdbx_poly_seq_scheme 8 2 'Structure model' pdbx_struct_conn_angle 9 2 'Structure model' pdbx_struct_sheet_hbond 10 2 'Structure model' pdbx_unobs_or_zero_occ_residues 11 2 'Structure model' struct_conf 12 2 'Structure model' struct_conn 13 2 'Structure model' struct_keywords 14 2 'Structure model' struct_ref 15 2 'Structure model' struct_ref_seq 16 2 'Structure model' struct_sheet_range 17 2 'Structure model' struct_site_gen 18 3 'Structure model' citation 19 3 'Structure model' citation_author 20 4 'Structure model' chem_comp_atom 21 4 'Structure model' chem_comp_bond 22 4 'Structure model' database_2 23 4 'Structure model' pdbx_initial_refinement_model 24 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.label_seq_id' 2 2 'Structure model' '_entity.formula_weight' 3 2 'Structure model' '_entity.pdbx_fragment' 4 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 5 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 6 2 'Structure model' '_entity_src_gen.gene_src_strain' 7 2 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 8 2 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 9 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 10 2 'Structure model' '_exptl_crystal.density_Matthews' 11 2 'Structure model' '_exptl_crystal.density_percent_sol' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id' 15 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 16 2 'Structure model' '_struct_conf.beg_label_seq_id' 17 2 'Structure model' '_struct_conf.end_label_seq_id' 18 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 19 2 'Structure model' '_struct_conn.ptnr2_label_seq_id' 20 2 'Structure model' '_struct_keywords.pdbx_keywords' 21 2 'Structure model' '_struct_keywords.text' 22 2 'Structure model' '_struct_ref.pdbx_align_begin' 23 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 24 2 'Structure model' '_struct_ref_seq.db_align_beg' 25 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg' 26 2 'Structure model' '_struct_ref_seq.seq_align_end' 27 2 'Structure model' '_struct_sheet_range.beg_label_seq_id' 28 2 'Structure model' '_struct_sheet_range.end_label_seq_id' 29 2 'Structure model' '_struct_site_gen.label_seq_id' 30 3 'Structure model' '_citation.country' 31 3 'Structure model' '_citation.journal_abbrev' 32 3 'Structure model' '_citation.journal_id_CSD' 33 3 'Structure model' '_citation.journal_id_ISSN' 34 3 'Structure model' '_citation.journal_volume' 35 3 'Structure model' '_citation.page_first' 36 3 'Structure model' '_citation.page_last' 37 3 'Structure model' '_citation.pdbx_database_id_DOI' 38 3 'Structure model' '_citation.pdbx_database_id_PubMed' 39 3 'Structure model' '_citation.title' 40 3 'Structure model' '_citation.year' 41 3 'Structure model' '_citation_author.identifier_ORCID' 42 4 'Structure model' '_database_2.pdbx_DOI' 43 4 'Structure model' '_database_2.pdbx_database_accession' 44 4 'Structure model' '_struct_conn.pdbx_dist_value' 45 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 46 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 47 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 48 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 49 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 50 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 51 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 52 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 53 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 54 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 55 4 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLY _pdbx_validate_rmsd_angle.auth_seq_id_1 62 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 63 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 63 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 115.33 _pdbx_validate_rmsd_angle.angle_target_value 128.40 _pdbx_validate_rmsd_angle.angle_deviation -13.07 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.10 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 135 ? ? -44.88 158.24 2 1 THR A 137 ? ? -126.84 -127.54 3 1 LYS A 151 ? ? -88.16 30.41 4 1 VAL A 188 ? ? -146.09 -32.17 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLY A 62 ? ? PRO A 63 ? ? 133.36 2 1 PRO A 63 ? ? PRO A 64 ? ? 140.65 3 1 GLY A 112 ? ? ILE A 113 ? ? -149.79 4 1 THR A 137 ? ? TYR A 138 ? ? -140.89 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 ZN ZN ZN N N 365 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31430024 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'ZINC ION' ZN 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4MJ7 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #