data_5YZK # _entry.id 5YZK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YZK pdb_00005yzk 10.2210/pdb5yzk/pdb WWPDB D_1300006151 ? ? BMRB 12002 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5YZ6 unspecified BMRB . 12002 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5YZK _pdbx_database_status.recvd_initial_deposition_date 2017-12-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kitaoku, Y.' 1 ? 'Nishimura, S.' 2 ? 'Fukamizo, T.' 3 ? 'Ohnuma, T.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Glycobiology _citation.journal_id_ASTM ? _citation.journal_id_CSD 9999 _citation.journal_id_ISSN 1460-2423 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 565 _citation.page_last 575 _citation.title 'Structures and chitin-binding properties of two N-terminal lysin motifs (LysMs) found in a chitinase from Volvox carteri.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/glycob/cwz024 _citation.pdbx_database_id_PubMed 30976779 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kitaoku, Y.' 1 ? primary 'Nishimura, S.' 2 ? primary 'Hirono, T.' 3 ? primary 'Suginta, W.' 4 ? primary 'Ohnuma, T.' 5 ? primary 'Fukamizo, T.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Chitinase, lysozyme' _entity.formula_weight 5290.043 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name LysM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVNPARLQVGQVINVPC _entity_poly.pdbx_seq_one_letter_code_can MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVNPARLQVGQVINVPC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 CYS n 1 4 THR n 1 5 TYR n 1 6 THR n 1 7 ILE n 1 8 GLN n 1 9 PRO n 1 10 GLY n 1 11 ASP n 1 12 THR n 1 13 PHE n 1 14 TRP n 1 15 ALA n 1 16 ILE n 1 17 ALA n 1 18 GLN n 1 19 ARG n 1 20 ARG n 1 21 GLY n 1 22 THR n 1 23 THR n 1 24 VAL n 1 25 ASP n 1 26 VAL n 1 27 ILE n 1 28 GLN n 1 29 SER n 1 30 LEU n 1 31 ASN n 1 32 PRO n 1 33 GLY n 1 34 VAL n 1 35 ASN n 1 36 PRO n 1 37 ALA n 1 38 ARG n 1 39 LEU n 1 40 GLN n 1 41 VAL n 1 42 GLY n 1 43 GLN n 1 44 VAL n 1 45 ILE n 1 46 ASN n 1 47 VAL n 1 48 PRO n 1 49 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 49 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'chi4, VOLCADRAFT_127242' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Volvox carteri f. nagariensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3068 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D8UFB5_VOLCA _struct_ref.pdbx_db_accession D8UFB5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVNPARLQVGQVINVPC _struct_ref.pdbx_align_begin 104 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5YZK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D8UFB5 _struct_ref_seq.db_align_beg 104 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 84 _struct_ref_seq.pdbx_auth_seq_align_end 131 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5YZK _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code D8UFB5 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 83 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HNCACO' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 12 1 2 '3D 1H-15N NOESY' 1 isotropic 11 1 2 '3D 1H-15N TOCSY' 1 isotropic 14 1 2 '3D HBHACBCACONH' 1 isotropic 10 2 3 '2D 1H-13C HSQC' 1 isotropic 9 2 3 '3D 1H-13C NOESY aliphatic' 1 isotropic 8 2 3 '3D 1H-13C NOESY aromatic' 1 isotropic 7 2 3 '3D HCCH-TOCSY' 1 isotropic 6 2 3 '3D CCH-TOCSY' 1 isotropic 13 2 3 '2D DQF-COSY' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 atm 1 5.0 20 ? ? mM 13C,15N_sample_H2O ? pH ? ? K 2 300 atm 1 5.0 20 ? ? mM 13C,15N_sample_D2O ? pH ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '194 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C,15N_sample_1 solution ? 2 '359 uM [U-13C; U-15N] LysM, 20 mM [U-13C; U-15N] sodium acetate, 100% D2O' '100% D2O' 13C,15N_sample_2 solution ? 3 '287 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 100% D2O' '100% D2O' 13C,15N_sample_D2O solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5YZK _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 5YZK _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5YZK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 processing NMRDraw ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'peak picking' Sparky ? Goddard 7 'chemical shift assignment' Sparky ? Goddard 6 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YZK _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5YZK _struct.title 'Solution structure of LysM domain from a chitinase derived from Volvox carteri' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YZK _struct_keywords.text 'lysin motif, chitin-specific, CBM50, SUGAR BINDING PROTEIN, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 12 ? GLY A 21 ? THR A 94 GLY A 103 1 ? 10 HELX_P HELX_P2 AA2 THR A 23 ? ASN A 31 ? THR A 105 ASN A 113 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 3 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 49 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 85 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 131 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.000 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 4 ? ILE A 7 ? THR A 86 ILE A 89 AA1 2 GLN A 43 ? ASN A 46 ? GLN A 125 ASN A 128 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 5 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 87 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 127 # _atom_sites.entry_id 5YZK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 83 83 MET MET A . n A 1 2 GLY 2 84 84 GLY GLY A . n A 1 3 CYS 3 85 85 CYS CYS A . n A 1 4 THR 4 86 86 THR THR A . n A 1 5 TYR 5 87 87 TYR TYR A . n A 1 6 THR 6 88 88 THR THR A . n A 1 7 ILE 7 89 89 ILE ILE A . n A 1 8 GLN 8 90 90 GLN GLN A . n A 1 9 PRO 9 91 91 PRO PRO A . n A 1 10 GLY 10 92 92 GLY GLY A . n A 1 11 ASP 11 93 93 ASP ASP A . n A 1 12 THR 12 94 94 THR THR A . n A 1 13 PHE 13 95 95 PHE PHE A . n A 1 14 TRP 14 96 96 TRP TRP A . n A 1 15 ALA 15 97 97 ALA ALA A . n A 1 16 ILE 16 98 98 ILE ILE A . n A 1 17 ALA 17 99 99 ALA ALA A . n A 1 18 GLN 18 100 100 GLN GLN A . n A 1 19 ARG 19 101 101 ARG ARG A . n A 1 20 ARG 20 102 102 ARG ARG A . n A 1 21 GLY 21 103 103 GLY GLY A . n A 1 22 THR 22 104 104 THR THR A . n A 1 23 THR 23 105 105 THR THR A . n A 1 24 VAL 24 106 106 VAL VAL A . n A 1 25 ASP 25 107 107 ASP ASP A . n A 1 26 VAL 26 108 108 VAL VAL A . n A 1 27 ILE 27 109 109 ILE ILE A . n A 1 28 GLN 28 110 110 GLN GLN A . n A 1 29 SER 29 111 111 SER SER A . n A 1 30 LEU 30 112 112 LEU LEU A . n A 1 31 ASN 31 113 113 ASN ASN A . n A 1 32 PRO 32 114 114 PRO PRO A . n A 1 33 GLY 33 115 115 GLY GLY A . n A 1 34 VAL 34 116 116 VAL VAL A . n A 1 35 ASN 35 117 117 ASN ASN A . n A 1 36 PRO 36 118 118 PRO PRO A . n A 1 37 ALA 37 119 119 ALA ALA A . n A 1 38 ARG 38 120 120 ARG ARG A . n A 1 39 LEU 39 121 121 LEU LEU A . n A 1 40 GLN 40 122 122 GLN GLN A . n A 1 41 VAL 41 123 123 VAL VAL A . n A 1 42 GLY 42 124 124 GLY GLY A . n A 1 43 GLN 43 125 125 GLN GLN A . n A 1 44 VAL 44 126 126 VAL VAL A . n A 1 45 ILE 45 127 127 ILE ILE A . n A 1 46 ASN 46 128 128 ASN ASN A . n A 1 47 VAL 47 129 129 VAL VAL A . n A 1 48 PRO 48 130 130 PRO PRO A . n A 1 49 CYS 49 131 131 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3530 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-19 2 'Structure model' 1 1 2022-06-22 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' pdbx_nmr_spectrometer 6 2 'Structure model' struct_conn 7 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_database_2.pdbx_DOI' 13 2 'Structure model' '_database_2.pdbx_database_accession' 14 2 'Structure model' '_pdbx_nmr_software.name' 15 2 'Structure model' '_pdbx_nmr_spectrometer.model' 16 2 'Structure model' '_struct_conn.pdbx_dist_value' 17 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 LysM 194 ? uM '[U-13C; U-15N]' 1 'sodium acetate' 20 ? mM '[U-2H]' 2 LysM 359 ? uM '[U-13C; U-15N]' 2 'sodium acetate' 20 ? mM '[U-13C; U-15N]' 3 LysM 287 ? uM '[U-13C; U-15N]' 3 'sodium acetate' 20 ? mM '[U-2H]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 95 ? ? -54.51 -70.86 2 1 ASN A 113 ? ? -117.96 68.15 3 1 ARG A 120 ? ? -170.56 115.33 4 2 ASN A 113 ? ? -117.67 68.29 5 3 ASN A 113 ? ? -117.64 68.34 6 4 PRO A 91 ? ? -46.52 107.79 7 4 ASN A 113 ? ? -117.93 67.97 8 4 ARG A 120 ? ? -173.34 108.16 9 4 PRO A 130 ? ? -69.73 83.91 10 5 PRO A 91 ? ? -59.67 92.79 11 5 ARG A 120 ? ? -151.63 49.68 12 5 PRO A 130 ? ? -69.76 87.84 13 6 PRO A 91 ? ? -58.16 94.12 14 6 GLN A 100 ? ? -51.66 -73.06 15 6 ASN A 113 ? ? -118.69 67.61 16 6 ARG A 120 ? ? -143.32 40.82 17 6 PRO A 130 ? ? -69.80 91.00 18 7 PRO A 91 ? ? -59.41 92.88 19 7 GLN A 100 ? ? -51.93 -72.77 20 7 ASN A 113 ? ? -118.03 67.85 21 7 ARG A 120 ? ? -178.36 104.17 22 8 ASN A 113 ? ? -117.83 67.89 23 9 PRO A 91 ? ? -58.54 93.61 24 9 ASN A 113 ? ? -118.50 67.33 25 9 ARG A 120 ? ? -144.07 43.62 26 9 PRO A 130 ? ? -69.78 91.61 27 10 PHE A 95 ? ? -54.64 -70.02 28 10 GLN A 100 ? ? -51.92 -70.74 29 10 ASN A 113 ? ? -118.51 67.28 30 11 PRO A 91 ? ? -57.95 94.47 31 11 ASN A 113 ? ? -118.18 67.84 32 11 ARG A 120 ? ? -91.83 55.02 33 11 PRO A 130 ? ? -69.80 90.87 34 12 PRO A 91 ? ? -47.33 101.07 35 12 GLN A 100 ? ? -52.59 -74.11 36 12 ASN A 113 ? ? -117.37 68.58 37 13 PRO A 91 ? ? -46.14 101.53 38 13 ASN A 113 ? ? -117.83 68.29 39 13 ARG A 120 ? ? -143.77 49.67 40 13 PRO A 130 ? ? -69.77 86.58 41 14 PRO A 91 ? ? -47.28 101.22 42 14 ASN A 113 ? ? -117.66 68.06 43 15 PRO A 91 ? ? -46.78 101.27 44 15 ASN A 113 ? ? -117.97 67.96 45 16 PRO A 91 ? ? -45.86 105.15 46 16 ASN A 113 ? ? -117.72 67.86 47 17 PRO A 91 ? ? -58.81 93.12 48 17 ASN A 113 ? ? -118.06 67.57 49 17 ARG A 120 ? ? -177.33 111.56 50 18 ASN A 113 ? ? -118.45 67.91 51 18 ALA A 119 ? ? -95.13 31.99 52 18 ARG A 120 ? ? 179.88 93.18 53 19 GLN A 100 ? ? -51.91 -72.11 54 19 ASN A 113 ? ? -117.95 68.05 55 19 ARG A 120 ? ? -170.61 115.23 56 20 ASN A 113 ? ? -117.96 68.17 57 20 ARG A 120 ? ? -173.48 116.63 58 20 PRO A 130 ? ? -69.80 85.47 # _pdbx_audit_support.funding_organization JSPS _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 16J10483 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #