data_5Z9X # _entry.id 5Z9X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5Z9X pdb_00005z9x 10.2210/pdb5z9x/pdb WWPDB D_1300006733 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-06-27 2 'Structure model' 1 1 2018-10-03 3 'Structure model' 1 2 2024-03-27 4 'Structure model' 1 3 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' struct_conn 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' 14 3 'Structure model' '_database_2.pdbx_DOI' 15 3 'Structure model' '_database_2.pdbx_database_accession' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 26 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 27 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id' 28 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 29 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 30 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 31 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 32 3 'Structure model' '_pdbx_struct_conn_angle.value' 33 3 'Structure model' '_struct_conn.pdbx_dist_value' 34 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 35 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 36 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 37 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 38 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 39 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 40 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 41 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 42 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 43 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 44 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 45 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 46 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 47 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5Z9X _pdbx_database_status.recvd_initial_deposition_date 2018-02-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, J.' 1 ? 'Liu, L.' 2 ? 'You, C.' 3 ? 'Gu, J.' 4 ? 'Ruan, W.' 5 ? 'Zhang, L.' 6 ? 'Gan, J.' 7 ? 'Cao, C.' 8 ? 'Huang, Y.' 9 ? 'Chen, X.' 10 ? 'Ma, J.' 11 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 3585 _citation.page_last 3585 _citation.title ;Structural and biochemical insights into small RNA 3' end trimming by Arabidopsis SDN1. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-018-05942-7 _citation.pdbx_database_id_PubMed 30181559 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, J.' 1 0000-0002-1016-4661 primary 'Liu, L.' 2 ? primary 'You, C.' 3 0000-0002-9935-1892 primary 'Gu, J.' 4 ? primary 'Ruan, W.' 5 ? primary 'Zhang, L.' 6 ? primary 'Gan, J.' 7 ? primary 'Cao, C.' 8 ? primary 'Huang, Y.' 9 0000-0002-2806-2874 primary 'Chen, X.' 10 ? primary 'Ma, J.' 11 0000-0002-0232-1786 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Small RNA degrading nuclease 1' 46429.062 1 3.1.-.- ? ? ? 2 polymer syn ;RNA (5'-R(P*GP*CP*CP*CP*AP*UP*UP*AP*G)-3') ; 3160.948 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 5 water nat water 18.015 27 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MELKLATAEKQVLDELVKLLQSRDLRGENGNWKEFLHVYDKNADSPSDPSRRSHEDLVQFLTTFKKKEDLQLLKCHANHL LIENLKQESQDEDTPEQMLVRLTVEHPSYSLDYSFKPYSEDWFVSDVGMKMKKVMESTNMVAVDCEMVLCEDGTEGLVRV GVVDRDLKVILDEFVKPNKPVVDYRTDITGITAEDIENASLSVVDIQETLQPFLSTGTILVGHSLNRDLEVLKIDHPKVI DTALVFKYPNTRKLRRPSLNNLCKSILGYEVRKTGVPHDCVHDASAAMKLALAVVEKRVDTTIKPSKEMLEVEKAKLFLH KIPNNVPSEELEQVLSGKFTLDVKQAKTQGRYYCAFALFHSSEDADQAFEHIDGIEMTDSLGLPQKVVIIKLSSGSRASI YVRKMVQDE ; ;MELKLATAEKQVLDELVKLLQSRDLRGENGNWKEFLHVYDKNADSPSDPSRRSHEDLVQFLTTFKKKEDLQLLKCHANHL LIENLKQESQDEDTPEQMLVRLTVEHPSYSLDYSFKPYSEDWFVSDVGMKMKKVMESTNMVAVDCEMVLCEDGTEGLVRV GVVDRDLKVILDEFVKPNKPVVDYRTDITGITAEDIENASLSVVDIQETLQPFLSTGTILVGHSLNRDLEVLKIDHPKVI DTALVFKYPNTRKLRRPSLNNLCKSILGYEVRKTGVPHDCVHDASAAMKLALAVVEKRVDTTIKPSKEMLEVEKAKLFLH KIPNNVPSEELEQVLSGKFTLDVKQAKTQGRYYCAFALFHSSEDADQAFEHIDGIEMTDSLGLPQKVVIIKLSSGSRASI YVRKMVQDE ; A ? 2 polyribonucleotide no no AGCCCAUUAG AGCCCAUUAG R ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 'MAGNESIUM ION' MG 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LEU n 1 4 LYS n 1 5 LEU n 1 6 ALA n 1 7 THR n 1 8 ALA n 1 9 GLU n 1 10 LYS n 1 11 GLN n 1 12 VAL n 1 13 LEU n 1 14 ASP n 1 15 GLU n 1 16 LEU n 1 17 VAL n 1 18 LYS n 1 19 LEU n 1 20 LEU n 1 21 GLN n 1 22 SER n 1 23 ARG n 1 24 ASP n 1 25 LEU n 1 26 ARG n 1 27 GLY n 1 28 GLU n 1 29 ASN n 1 30 GLY n 1 31 ASN n 1 32 TRP n 1 33 LYS n 1 34 GLU n 1 35 PHE n 1 36 LEU n 1 37 HIS n 1 38 VAL n 1 39 TYR n 1 40 ASP n 1 41 LYS n 1 42 ASN n 1 43 ALA n 1 44 ASP n 1 45 SER n 1 46 PRO n 1 47 SER n 1 48 ASP n 1 49 PRO n 1 50 SER n 1 51 ARG n 1 52 ARG n 1 53 SER n 1 54 HIS n 1 55 GLU n 1 56 ASP n 1 57 LEU n 1 58 VAL n 1 59 GLN n 1 60 PHE n 1 61 LEU n 1 62 THR n 1 63 THR n 1 64 PHE n 1 65 LYS n 1 66 LYS n 1 67 LYS n 1 68 GLU n 1 69 ASP n 1 70 LEU n 1 71 GLN n 1 72 LEU n 1 73 LEU n 1 74 LYS n 1 75 CYS n 1 76 HIS n 1 77 ALA n 1 78 ASN n 1 79 HIS n 1 80 LEU n 1 81 LEU n 1 82 ILE n 1 83 GLU n 1 84 ASN n 1 85 LEU n 1 86 LYS n 1 87 GLN n 1 88 GLU n 1 89 SER n 1 90 GLN n 1 91 ASP n 1 92 GLU n 1 93 ASP n 1 94 THR n 1 95 PRO n 1 96 GLU n 1 97 GLN n 1 98 MET n 1 99 LEU n 1 100 VAL n 1 101 ARG n 1 102 LEU n 1 103 THR n 1 104 VAL n 1 105 GLU n 1 106 HIS n 1 107 PRO n 1 108 SER n 1 109 TYR n 1 110 SER n 1 111 LEU n 1 112 ASP n 1 113 TYR n 1 114 SER n 1 115 PHE n 1 116 LYS n 1 117 PRO n 1 118 TYR n 1 119 SER n 1 120 GLU n 1 121 ASP n 1 122 TRP n 1 123 PHE n 1 124 VAL n 1 125 SER n 1 126 ASP n 1 127 VAL n 1 128 GLY n 1 129 MET n 1 130 LYS n 1 131 MET n 1 132 LYS n 1 133 LYS n 1 134 VAL n 1 135 MET n 1 136 GLU n 1 137 SER n 1 138 THR n 1 139 ASN n 1 140 MET n 1 141 VAL n 1 142 ALA n 1 143 VAL n 1 144 ASP n 1 145 CYS n 1 146 GLU n 1 147 MET n 1 148 VAL n 1 149 LEU n 1 150 CYS n 1 151 GLU n 1 152 ASP n 1 153 GLY n 1 154 THR n 1 155 GLU n 1 156 GLY n 1 157 LEU n 1 158 VAL n 1 159 ARG n 1 160 VAL n 1 161 GLY n 1 162 VAL n 1 163 VAL n 1 164 ASP n 1 165 ARG n 1 166 ASP n 1 167 LEU n 1 168 LYS n 1 169 VAL n 1 170 ILE n 1 171 LEU n 1 172 ASP n 1 173 GLU n 1 174 PHE n 1 175 VAL n 1 176 LYS n 1 177 PRO n 1 178 ASN n 1 179 LYS n 1 180 PRO n 1 181 VAL n 1 182 VAL n 1 183 ASP n 1 184 TYR n 1 185 ARG n 1 186 THR n 1 187 ASP n 1 188 ILE n 1 189 THR n 1 190 GLY n 1 191 ILE n 1 192 THR n 1 193 ALA n 1 194 GLU n 1 195 ASP n 1 196 ILE n 1 197 GLU n 1 198 ASN n 1 199 ALA n 1 200 SER n 1 201 LEU n 1 202 SER n 1 203 VAL n 1 204 VAL n 1 205 ASP n 1 206 ILE n 1 207 GLN n 1 208 GLU n 1 209 THR n 1 210 LEU n 1 211 GLN n 1 212 PRO n 1 213 PHE n 1 214 LEU n 1 215 SER n 1 216 THR n 1 217 GLY n 1 218 THR n 1 219 ILE n 1 220 LEU n 1 221 VAL n 1 222 GLY n 1 223 HIS n 1 224 SER n 1 225 LEU n 1 226 ASN n 1 227 ARG n 1 228 ASP n 1 229 LEU n 1 230 GLU n 1 231 VAL n 1 232 LEU n 1 233 LYS n 1 234 ILE n 1 235 ASP n 1 236 HIS n 1 237 PRO n 1 238 LYS n 1 239 VAL n 1 240 ILE n 1 241 ASP n 1 242 THR n 1 243 ALA n 1 244 LEU n 1 245 VAL n 1 246 PHE n 1 247 LYS n 1 248 TYR n 1 249 PRO n 1 250 ASN n 1 251 THR n 1 252 ARG n 1 253 LYS n 1 254 LEU n 1 255 ARG n 1 256 ARG n 1 257 PRO n 1 258 SER n 1 259 LEU n 1 260 ASN n 1 261 ASN n 1 262 LEU n 1 263 CYS n 1 264 LYS n 1 265 SER n 1 266 ILE n 1 267 LEU n 1 268 GLY n 1 269 TYR n 1 270 GLU n 1 271 VAL n 1 272 ARG n 1 273 LYS n 1 274 THR n 1 275 GLY n 1 276 VAL n 1 277 PRO n 1 278 HIS n 1 279 ASP n 1 280 CYS n 1 281 VAL n 1 282 HIS n 1 283 ASP n 1 284 ALA n 1 285 SER n 1 286 ALA n 1 287 ALA n 1 288 MET n 1 289 LYS n 1 290 LEU n 1 291 ALA n 1 292 LEU n 1 293 ALA n 1 294 VAL n 1 295 VAL n 1 296 GLU n 1 297 LYS n 1 298 ARG n 1 299 VAL n 1 300 ASP n 1 301 THR n 1 302 THR n 1 303 ILE n 1 304 LYS n 1 305 PRO n 1 306 SER n 1 307 LYS n 1 308 GLU n 1 309 MET n 1 310 LEU n 1 311 GLU n 1 312 VAL n 1 313 GLU n 1 314 LYS n 1 315 ALA n 1 316 LYS n 1 317 LEU n 1 318 PHE n 1 319 LEU n 1 320 HIS n 1 321 LYS n 1 322 ILE n 1 323 PRO n 1 324 ASN n 1 325 ASN n 1 326 VAL n 1 327 PRO n 1 328 SER n 1 329 GLU n 1 330 GLU n 1 331 LEU n 1 332 GLU n 1 333 GLN n 1 334 VAL n 1 335 LEU n 1 336 SER n 1 337 GLY n 1 338 LYS n 1 339 PHE n 1 340 THR n 1 341 LEU n 1 342 ASP n 1 343 VAL n 1 344 LYS n 1 345 GLN n 1 346 ALA n 1 347 LYS n 1 348 THR n 1 349 GLN n 1 350 GLY n 1 351 ARG n 1 352 TYR n 1 353 TYR n 1 354 CYS n 1 355 ALA n 1 356 PHE n 1 357 ALA n 1 358 LEU n 1 359 PHE n 1 360 HIS n 1 361 SER n 1 362 SER n 1 363 GLU n 1 364 ASP n 1 365 ALA n 1 366 ASP n 1 367 GLN n 1 368 ALA n 1 369 PHE n 1 370 GLU n 1 371 HIS n 1 372 ILE n 1 373 ASP n 1 374 GLY n 1 375 ILE n 1 376 GLU n 1 377 MET n 1 378 THR n 1 379 ASP n 1 380 SER n 1 381 LEU n 1 382 GLY n 1 383 LEU n 1 384 PRO n 1 385 GLN n 1 386 LYS n 1 387 VAL n 1 388 VAL n 1 389 ILE n 1 390 ILE n 1 391 LYS n 1 392 LEU n 1 393 SER n 1 394 SER n 1 395 GLY n 1 396 SER n 1 397 ARG n 1 398 ALA n 1 399 SER n 1 400 ILE n 1 401 TYR n 1 402 VAL n 1 403 ARG n 1 404 LYS n 1 405 MET n 1 406 VAL n 1 407 GLN n 1 408 ASP n 1 409 GLU n 2 1 A n 2 2 G n 2 3 C n 2 4 C n 2 5 C n 2 6 A n 2 7 U n 2 8 U n 2 9 A n 2 10 G n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 409 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SDN1, At3g50100, F3A4.180' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 10 _pdbx_entity_src_syn.organism_scientific 'Arabidopsis thaliana' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 3702 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 ASP 91 91 91 ASP ALA A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 TRP 122 122 122 TRP TRP A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 CYS 145 145 145 CYS CYS A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 MET 147 147 147 MET MET A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 CYS 150 150 150 CYS CYS A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 GLY 156 156 156 GLY ALA A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 PRO 177 177 177 PRO PRO A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 SER 200 200 200 SER SER A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 GLN 211 211 211 GLN GLN A . n A 1 212 PRO 212 212 212 PRO PRO A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 THR 216 216 216 THR THR A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 HIS 223 223 223 HIS HIS A . n A 1 224 SER 224 224 224 SER SER A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 ASN 226 226 226 ASN ASN A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 ASP 228 228 228 ASP ASP A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 HIS 236 236 236 HIS HIS A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 LYS 238 238 238 LYS LYS A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 ILE 240 240 240 ILE ILE A . n A 1 241 ASP 241 241 241 ASP ASP A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 PHE 246 246 246 PHE PHE A . n A 1 247 LYS 247 247 ? ? ? A . n A 1 248 TYR 248 248 ? ? ? A . n A 1 249 PRO 249 249 ? ? ? A . n A 1 250 ASN 250 250 ? ? ? A . n A 1 251 THR 251 251 ? ? ? A . n A 1 252 ARG 252 252 ? ? ? A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 ARG 255 255 255 ARG ARG A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 PRO 257 257 257 PRO PRO A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 ASN 260 260 260 ASN ASN A . n A 1 261 ASN 261 261 261 ASN ASN A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 CYS 263 263 263 CYS CYS A . n A 1 264 LYS 264 264 264 LYS LYS A . n A 1 265 SER 265 265 265 SER SER A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 TYR 269 269 269 TYR TYR A . n A 1 270 GLU 270 270 ? ? ? A . n A 1 271 VAL 271 271 ? ? ? A . n A 1 272 ARG 272 272 ? ? ? A . n A 1 273 LYS 273 273 ? ? ? A . n A 1 274 THR 274 274 ? ? ? A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 VAL 276 276 276 VAL VAL A . n A 1 277 PRO 277 277 277 PRO PRO A . n A 1 278 HIS 278 278 278 HIS HIS A . n A 1 279 ASP 279 279 279 ASP ASP A . n A 1 280 CYS 280 280 280 CYS CYS A . n A 1 281 VAL 281 281 281 VAL VAL A . n A 1 282 HIS 282 282 282 HIS HIS A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 SER 285 285 285 SER SER A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 MET 288 288 288 MET MET A . n A 1 289 LYS 289 289 289 LYS LYS A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 LEU 292 292 292 LEU LEU A . n A 1 293 ALA 293 293 293 ALA ALA A . n A 1 294 VAL 294 294 294 VAL VAL A . n A 1 295 VAL 295 295 295 VAL VAL A . n A 1 296 GLU 296 296 296 GLU GLU A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 ARG 298 298 298 ARG ARG A . n A 1 299 VAL 299 299 299 VAL VAL A . n A 1 300 ASP 300 300 300 ASP ALA A . n A 1 301 THR 301 301 ? ? ? A . n A 1 302 THR 302 302 ? ? ? A . n A 1 303 ILE 303 303 ? ? ? A . n A 1 304 LYS 304 304 ? ? ? A . n A 1 305 PRO 305 305 ? ? ? A . n A 1 306 SER 306 306 ? ? ? A . n A 1 307 LYS 307 307 ? ? ? A . n A 1 308 GLU 308 308 ? ? ? A . n A 1 309 MET 309 309 ? ? ? A . n A 1 310 LEU 310 310 ? ? ? A . n A 1 311 GLU 311 311 ? ? ? A . n A 1 312 VAL 312 312 ? ? ? A . n A 1 313 GLU 313 313 ? ? ? A . n A 1 314 LYS 314 314 ? ? ? A . n A 1 315 ALA 315 315 ? ? ? A . n A 1 316 LYS 316 316 ? ? ? A . n A 1 317 LEU 317 317 ? ? ? A . n A 1 318 PHE 318 318 ? ? ? A . n A 1 319 LEU 319 319 ? ? ? A . n A 1 320 HIS 320 320 ? ? ? A . n A 1 321 LYS 321 321 ? ? ? A . n A 1 322 ILE 322 322 ? ? ? A . n A 1 323 PRO 323 323 ? ? ? A . n A 1 324 ASN 324 324 ? ? ? A . n A 1 325 ASN 325 325 ? ? ? A . n A 1 326 VAL 326 326 ? ? ? A . n A 1 327 PRO 327 327 ? ? ? A . n A 1 328 SER 328 328 ? ? ? A . n A 1 329 GLU 329 329 ? ? ? A . n A 1 330 GLU 330 330 ? ? ? A . n A 1 331 LEU 331 331 ? ? ? A . n A 1 332 GLU 332 332 ? ? ? A . n A 1 333 GLN 333 333 ? ? ? A . n A 1 334 VAL 334 334 ? ? ? A . n A 1 335 LEU 335 335 ? ? ? A . n A 1 336 SER 336 336 ? ? ? A . n A 1 337 GLY 337 337 ? ? ? A . n A 1 338 LYS 338 338 ? ? ? A . n A 1 339 PHE 339 339 ? ? ? A . n A 1 340 THR 340 340 ? ? ? A . n A 1 341 LEU 341 341 ? ? ? A . n A 1 342 ASP 342 342 ? ? ? A . n A 1 343 VAL 343 343 ? ? ? A . n A 1 344 LYS 344 344 ? ? ? A . n A 1 345 GLN 345 345 ? ? ? A . n A 1 346 ALA 346 346 ? ? ? A . n A 1 347 LYS 347 347 ? ? ? A . n A 1 348 THR 348 348 ? ? ? A . n A 1 349 GLN 349 349 ? ? ? A . n A 1 350 GLY 350 350 ? ? ? A . n A 1 351 ARG 351 351 ? ? ? A . n A 1 352 TYR 352 352 ? ? ? A . n A 1 353 TYR 353 353 ? ? ? A . n A 1 354 CYS 354 354 ? ? ? A . n A 1 355 ALA 355 355 ? ? ? A . n A 1 356 PHE 356 356 ? ? ? A . n A 1 357 ALA 357 357 ? ? ? A . n A 1 358 LEU 358 358 ? ? ? A . n A 1 359 PHE 359 359 ? ? ? A . n A 1 360 HIS 360 360 ? ? ? A . n A 1 361 SER 361 361 ? ? ? A . n A 1 362 SER 362 362 ? ? ? A . n A 1 363 GLU 363 363 ? ? ? A . n A 1 364 ASP 364 364 ? ? ? A . n A 1 365 ALA 365 365 ? ? ? A . n A 1 366 ASP 366 366 ? ? ? A . n A 1 367 GLN 367 367 ? ? ? A . n A 1 368 ALA 368 368 ? ? ? A . n A 1 369 PHE 369 369 ? ? ? A . n A 1 370 GLU 370 370 ? ? ? A . n A 1 371 HIS 371 371 ? ? ? A . n A 1 372 ILE 372 372 ? ? ? A . n A 1 373 ASP 373 373 ? ? ? A . n A 1 374 GLY 374 374 ? ? ? A . n A 1 375 ILE 375 375 ? ? ? A . n A 1 376 GLU 376 376 ? ? ? A . n A 1 377 MET 377 377 ? ? ? A . n A 1 378 THR 378 378 ? ? ? A . n A 1 379 ASP 379 379 ? ? ? A . n A 1 380 SER 380 380 ? ? ? A . n A 1 381 LEU 381 381 ? ? ? A . n A 1 382 GLY 382 382 ? ? ? A . n A 1 383 LEU 383 383 ? ? ? A . n A 1 384 PRO 384 384 ? ? ? A . n A 1 385 GLN 385 385 ? ? ? A . n A 1 386 LYS 386 386 ? ? ? A . n A 1 387 VAL 387 387 ? ? ? A . n A 1 388 VAL 388 388 ? ? ? A . n A 1 389 ILE 389 389 ? ? ? A . n A 1 390 ILE 390 390 ? ? ? A . n A 1 391 LYS 391 391 ? ? ? A . n A 1 392 LEU 392 392 ? ? ? A . n A 1 393 SER 393 393 ? ? ? A . n A 1 394 SER 394 394 ? ? ? A . n A 1 395 GLY 395 395 ? ? ? A . n A 1 396 SER 396 396 ? ? ? A . n A 1 397 ARG 397 397 ? ? ? A . n A 1 398 ALA 398 398 ? ? ? A . n A 1 399 SER 399 399 ? ? ? A . n A 1 400 ILE 400 400 ? ? ? A . n A 1 401 TYR 401 401 ? ? ? A . n A 1 402 VAL 402 402 ? ? ? A . n A 1 403 ARG 403 403 ? ? ? A . n A 1 404 LYS 404 404 ? ? ? A . n A 1 405 MET 405 405 ? ? ? A . n A 1 406 VAL 406 406 ? ? ? A . n A 1 407 GLN 407 407 ? ? ? A . n A 1 408 ASP 408 408 ? ? ? A . n A 1 409 GLU 409 409 ? ? ? A . n B 2 1 A 1 1 ? ? ? R . n B 2 2 G 2 2 2 G G R . n B 2 3 C 3 3 3 C C R . n B 2 4 C 4 4 4 C C R . n B 2 5 C 5 5 5 C C R . n B 2 6 A 6 6 6 A A R . n B 2 7 U 7 7 7 U U R . n B 2 8 U 8 8 8 U U R . n B 2 9 A 9 9 9 A A R . n B 2 10 G 10 10 10 G G R . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 501 1 SO4 SO4 A . D 4 MG 1 502 1 MG MG A . E 4 MG 1 503 2 MG MG A . F 3 SO4 1 101 2 SO4 SO4 R . G 5 HOH 1 601 19 HOH HOH A . G 5 HOH 2 602 22 HOH HOH A . G 5 HOH 3 603 7 HOH HOH A . G 5 HOH 4 604 17 HOH HOH A . G 5 HOH 5 605 13 HOH HOH A . G 5 HOH 6 606 2 HOH HOH A . G 5 HOH 7 607 5 HOH HOH A . G 5 HOH 8 608 8 HOH HOH A . G 5 HOH 9 609 18 HOH HOH A . G 5 HOH 10 610 23 HOH HOH A . G 5 HOH 11 611 10 HOH HOH A . G 5 HOH 12 612 27 HOH HOH A . G 5 HOH 13 613 4 HOH HOH A . G 5 HOH 14 614 9 HOH HOH A . G 5 HOH 15 615 1 HOH HOH A . G 5 HOH 16 616 25 HOH HOH A . G 5 HOH 17 617 16 HOH HOH A . G 5 HOH 18 618 24 HOH HOH A . G 5 HOH 19 619 21 HOH HOH A . G 5 HOH 20 620 11 HOH HOH A . G 5 HOH 21 621 14 HOH HOH A . G 5 HOH 22 622 12 HOH HOH A . G 5 HOH 23 623 20 HOH HOH A . G 5 HOH 24 624 6 HOH HOH A . G 5 HOH 25 625 3 HOH HOH A . H 5 HOH 1 201 26 HOH HOH R . H 5 HOH 2 202 15 HOH HOH R . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 41 ? CG ? A LYS 41 CG 2 1 Y 1 A LYS 41 ? CD ? A LYS 41 CD 3 1 Y 1 A LYS 41 ? CE ? A LYS 41 CE 4 1 Y 1 A LYS 41 ? NZ ? A LYS 41 NZ 5 1 Y 1 A ASN 42 ? CG ? A ASN 42 CG 6 1 Y 1 A ASN 42 ? OD1 ? A ASN 42 OD1 7 1 Y 1 A ASN 42 ? ND2 ? A ASN 42 ND2 8 1 Y 1 A ASP 44 ? CG ? A ASP 44 CG 9 1 Y 1 A ASP 44 ? OD1 ? A ASP 44 OD1 10 1 Y 1 A ASP 44 ? OD2 ? A ASP 44 OD2 11 1 Y 1 A ASP 91 ? CG ? A ASP 91 CG 12 1 Y 1 A ASP 91 ? OD1 ? A ASP 91 OD1 13 1 Y 1 A ASP 91 ? OD2 ? A ASP 91 OD2 14 1 Y 1 A LYS 253 ? CG ? A LYS 253 CG 15 1 Y 1 A LYS 253 ? CD ? A LYS 253 CD 16 1 Y 1 A LYS 253 ? CE ? A LYS 253 CE 17 1 Y 1 A LYS 253 ? NZ ? A LYS 253 NZ 18 1 Y 1 A LEU 254 ? CG ? A LEU 254 CG 19 1 Y 1 A LEU 254 ? CD1 ? A LEU 254 CD1 20 1 Y 1 A LEU 254 ? CD2 ? A LEU 254 CD2 21 1 Y 1 A ILE 266 ? CG1 ? A ILE 266 CG1 22 1 Y 1 A ILE 266 ? CG2 ? A ILE 266 CG2 23 1 Y 1 A ILE 266 ? CD1 ? A ILE 266 CD1 24 1 Y 1 A LEU 267 ? CG ? A LEU 267 CG 25 1 Y 1 A LEU 267 ? CD1 ? A LEU 267 CD1 26 1 Y 1 A LEU 267 ? CD2 ? A LEU 267 CD2 27 1 Y 1 A ASP 300 ? CG ? A ASP 300 CG 28 1 Y 1 A ASP 300 ? OD1 ? A ASP 300 OD1 29 1 Y 1 A ASP 300 ? OD2 ? A ASP 300 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.4_1496 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 0.98.699a 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.8.6.1 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.7.1_743 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 0.98.699a 5 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 0.98.699a 6 # _cell.entry_id 5Z9X _cell.length_a 87.993 _cell.length_b 87.993 _cell.length_c 178.639 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5Z9X _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5Z9X _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'lithum sulfate, magnesium chloride, 2-(N-morpholino) ethanesulfonic acid' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-04-19 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17B1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5Z9X _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.80 _reflns.d_resolution_low 30.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20440 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.98 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.80 _reflns_shell.d_res_low 2.90 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5Z9X _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 20211 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.43 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 28.986 _refine.ls_d_res_high 2.800 _refine.ls_percent_reflns_obs 99.20 _refine.ls_R_factor_obs 0.2527 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2517 _refine.ls_R_factor_R_free 0.2614 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.85 _refine.ls_number_reflns_R_free 1991 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 'SDN1 deltaC-ssRNA' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.54 _refine.pdbx_overall_phase_error 33.37 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2258 _refine_hist.pdbx_number_atoms_nucleic_acid 190 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 2487 _refine_hist.d_res_high 2.800 _refine_hist.d_res_low 28.986 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.015 ? ? 2524 'X-RAY DIFFRACTION' ? f_angle_d 1.843 ? ? 3453 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 17.381 ? ? 970 'X-RAY DIFFRACTION' ? f_chiral_restr 0.082 ? ? 413 'X-RAY DIFFRACTION' ? f_plane_restr 0.008 ? ? 410 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.8000 2.8700 1261 0.4021 99.00 0.4695 . . 139 . . 'X-RAY DIFFRACTION' . 2.8700 2.9475 1294 0.3893 99.00 0.4278 . . 142 . . 'X-RAY DIFFRACTION' . 2.9475 3.0341 1275 0.3716 99.00 0.3510 . . 143 . . 'X-RAY DIFFRACTION' . 3.0341 3.1320 1291 0.3621 100.00 0.4193 . . 137 . . 'X-RAY DIFFRACTION' . 3.1320 3.2438 1280 0.3176 99.00 0.3365 . . 139 . . 'X-RAY DIFFRACTION' . 3.2438 3.3735 1293 0.3142 100.00 0.3235 . . 142 . . 'X-RAY DIFFRACTION' . 3.3735 3.5267 1289 0.2657 99.00 0.2846 . . 139 . . 'X-RAY DIFFRACTION' . 3.5267 3.7123 1271 0.2428 99.00 0.2736 . . 138 . . 'X-RAY DIFFRACTION' . 3.7123 3.9444 1286 0.2305 99.00 0.2563 . . 137 . . 'X-RAY DIFFRACTION' . 3.9444 4.2481 1321 0.2130 99.00 0.2324 . . 150 . . 'X-RAY DIFFRACTION' . 4.2481 4.6740 1294 0.2018 99.00 0.2284 . . 140 . . 'X-RAY DIFFRACTION' . 4.6740 5.3466 1317 0.2178 99.00 0.2316 . . 146 . . 'X-RAY DIFFRACTION' . 5.3466 6.7223 1366 0.2768 100.00 0.2462 . . 141 . . 'X-RAY DIFFRACTION' . 6.7223 28.9877 1382 0.2066 98.00 0.2103 . . 158 . . # _struct.entry_id 5Z9X _struct.title 'Arabidopsis SMALL RNA DEGRADING NUCLEASE 1 in complex with an RNA substrate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5Z9X _struct_keywords.text 'exonuclease, microRNA turnover, protein-RNA complex, PLANT PROTEIN, PLANT PROTEIN-RNA complex' _struct_keywords.pdbx_keywords 'PLANT PROTEIN/RNA' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 3 ? G N N 5 ? H N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SDN1_ARATH A3KPE8 ? 1 ;MELKLATAEKQVLDELVKLLQSRDLRGENGNWKEFLHVYDKNADSPSDPSRRSHEDLVQFLTTFKKKEDLQLLKCHANHL LIENLKQESQDEDTPEQMLVRLTVEHPSYSLDYSFKPYSEDWFVSDVGMKMKKVMESTNMVAVDCEMVLCEDGTEGLVRV GVVDRDLKVILDEFVKPNKPVVDYRTDITGITAEDIENASLSVVDIQETLQPFLSTGTILVGHSLNRDLEVLKIDHPKVI DTALVFKYPNTRKLRRPSLNNLCKSILGYEVRKTGVPHDCVHDASAAMKLALAVVEKRVDTTIKPSKEMLEVEKAKLFLH KIPNNVPSEELEQVLSGKFTLDVKQAKTQGRYYCAFALFHSSEDADQAFEHIDGIEMTDSLGLPQKVVIIKLSSGSRASI YVRKMVQDE ; 1 2 PDB 5Z9X 5Z9X ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5Z9X A 1 ? 409 ? A3KPE8 1 ? 409 ? 1 409 2 2 5Z9X R 1 ? 10 ? 5Z9X 1 ? 10 ? 1 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1730 ? 1 MORE -52 ? 1 'SSA (A^2)' 16310 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 9 ? ASP A 24 ? GLU A 9 ASP A 24 1 ? 16 HELX_P HELX_P2 AA2 ASN A 31 ? TYR A 39 ? ASN A 31 TYR A 39 1 ? 9 HELX_P HELX_P3 AA3 SER A 53 ? THR A 62 ? SER A 53 THR A 62 1 ? 10 HELX_P HELX_P4 AA4 LYS A 66 ? GLN A 87 ? LYS A 66 GLN A 87 1 ? 22 HELX_P HELX_P5 AA5 SER A 89 ? ASP A 93 ? SER A 89 ASP A 93 5 ? 5 HELX_P HELX_P6 AA6 THR A 94 ? HIS A 106 ? THR A 94 HIS A 106 1 ? 13 HELX_P HELX_P7 AA7 SER A 108 ? TYR A 113 ? SER A 108 TYR A 113 1 ? 6 HELX_P HELX_P8 AA8 ASP A 126 ? LYS A 130 ? ASP A 126 LYS A 130 5 ? 5 HELX_P HELX_P9 AA9 MET A 131 ? GLU A 136 ? MET A 131 GLU A 136 1 ? 6 HELX_P HELX_P10 AB1 ILE A 191 ? ASN A 198 ? ILE A 191 ASN A 198 1 ? 8 HELX_P HELX_P11 AB2 SER A 202 ? THR A 216 ? SER A 202 THR A 216 1 ? 15 HELX_P HELX_P12 AB3 SER A 224 ? LYS A 233 ? SER A 224 LYS A 233 1 ? 10 HELX_P HELX_P13 AB4 THR A 242 ? PHE A 246 ? THR A 242 PHE A 246 1 ? 5 HELX_P HELX_P14 AB5 SER A 258 ? LEU A 267 ? SER A 258 LEU A 267 1 ? 10 HELX_P HELX_P15 AB6 ASP A 279 ? LYS A 297 ? ASP A 279 LYS A 297 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 144 OD2 ? ? ? 1_555 D MG . MG ? ? A ASP 144 A MG 502 1_555 ? ? ? ? ? ? ? 2.169 ? ? metalc2 metalc ? ? A ASP 144 OD1 ? ? ? 1_555 E MG . MG ? ? A ASP 144 A MG 503 1_555 ? ? ? ? ? ? ? 2.146 ? ? metalc3 metalc ? ? A GLU 146 OE2 B ? ? 1_555 E MG . MG ? ? A GLU 146 A MG 503 1_555 ? ? ? ? ? ? ? 2.171 ? ? metalc4 metalc ? ? A HIS 223 O ? ? ? 1_555 D MG . MG ? ? A HIS 223 A MG 502 1_555 ? ? ? ? ? ? ? 2.875 ? ? metalc5 metalc ? ? A ASP 283 OD2 ? ? ? 1_555 E MG . MG ? ? A ASP 283 A MG 503 1_555 ? ? ? ? ? ? ? 2.157 ? ? metalc6 metalc ? ? E MG . MG ? ? ? 1_555 B G 10 OP1 ? ? A MG 503 R G 10 1_555 ? ? ? ? ? ? ? 2.176 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 144 ? A ASP 144 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O ? A HIS 223 ? A HIS 223 ? 1_555 136.8 ? 2 OD1 ? A ASP 144 ? A ASP 144 ? 1_555 MG ? E MG . ? A MG 503 ? 1_555 OE2 B A GLU 146 ? A GLU 146 ? 1_555 137.6 ? 3 OD1 ? A ASP 144 ? A ASP 144 ? 1_555 MG ? E MG . ? A MG 503 ? 1_555 OD2 ? A ASP 283 ? A ASP 283 ? 1_555 97.9 ? 4 OE2 B A GLU 146 ? A GLU 146 ? 1_555 MG ? E MG . ? A MG 503 ? 1_555 OD2 ? A ASP 283 ? A ASP 283 ? 1_555 114.6 ? 5 OD1 ? A ASP 144 ? A ASP 144 ? 1_555 MG ? E MG . ? A MG 503 ? 1_555 OP1 ? B G 10 ? R G 10 ? 1_555 84.0 ? 6 OE2 B A GLU 146 ? A GLU 146 ? 1_555 MG ? E MG . ? A MG 503 ? 1_555 OP1 ? B G 10 ? R G 10 ? 1_555 118.0 ? 7 OD2 ? A ASP 283 ? A ASP 283 ? 1_555 MG ? E MG . ? A MG 503 ? 1_555 OP1 ? B G 10 ? R G 10 ? 1_555 94.1 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 116 A . ? LYS 116 A PRO 117 A ? PRO 117 A 1 5.02 2 THR 186 A . ? THR 186 A ASP 187 A ? ASP 187 A 1 28.24 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 123 ? VAL A 124 ? PHE A 123 VAL A 124 AA1 2 ILE A 234 ? ASP A 235 ? ILE A 234 ASP A 235 AA2 1 VAL A 169 ? PHE A 174 ? VAL A 169 PHE A 174 AA2 2 GLU A 155 ? ASP A 164 ? GLU A 155 ASP A 164 AA2 3 MET A 140 ? LEU A 149 ? MET A 140 LEU A 149 AA2 4 ILE A 219 ? GLY A 222 ? ILE A 219 GLY A 222 AA2 5 VAL A 239 ? ASP A 241 ? VAL A 239 ASP A 241 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 123 ? N PHE A 123 O ASP A 235 ? O ASP A 235 AA2 1 2 O LEU A 171 ? O LEU A 171 N VAL A 162 ? N VAL A 162 AA2 2 3 O GLY A 161 ? O GLY A 161 N ASP A 144 ? N ASP A 144 AA2 3 4 N VAL A 141 ? N VAL A 141 O ILE A 219 ? O ILE A 219 AA2 4 5 N GLY A 222 ? N GLY A 222 O ILE A 240 ? O ILE A 240 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 501 ? 4 'binding site for residue SO4 A 501' AC2 Software A MG 502 ? 4 'binding site for residue MG A 502' AC3 Software A MG 503 ? 6 'binding site for residue MG A 503' AC4 Software R SO4 101 ? 2 'binding site for residue SO4 R 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 23 ? ARG A 23 . ? 1_555 ? 2 AC1 4 LEU A 72 ? LEU A 72 . ? 1_555 ? 3 AC1 4 LYS A 116 ? LYS A 116 . ? 1_555 ? 4 AC1 4 HOH G . ? HOH A 618 . ? 1_555 ? 5 AC2 4 ASP A 144 ? ASP A 144 . ? 1_555 ? 6 AC2 4 HIS A 223 ? HIS A 223 . ? 1_555 ? 7 AC2 4 ASP A 228 ? ASP A 228 . ? 1_555 ? 8 AC2 4 G B 10 ? G R 10 . ? 1_555 ? 9 AC3 6 ASP A 144 ? ASP A 144 . ? 1_555 ? 10 AC3 6 CYS A 145 ? CYS A 145 . ? 1_555 ? 11 AC3 6 GLU A 146 ? GLU A 146 . ? 1_555 ? 12 AC3 6 CYS A 280 ? CYS A 280 . ? 1_555 ? 13 AC3 6 ASP A 283 ? ASP A 283 . ? 1_555 ? 14 AC3 6 G B 10 ? G R 10 . ? 1_555 ? 15 AC4 2 A B 9 ? A R 9 . ? 1_555 ? 16 AC4 2 G B 10 ? G R 10 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 613 ? ? O A HOH 622 ? ? 2.06 2 1 O A PHE 60 ? ? OG1 A THR 63 ? ? 2.14 3 1 OG A SER 119 ? ? O A HOH 601 ? ? 2.14 4 1 O A CYS 263 ? ? N A LEU 267 ? ? 2.15 5 1 NH1 A ARG 23 ? ? O3 A SO4 501 ? ? 2.15 6 1 O A ASP 48 ? ? N A SER 50 ? ? 2.16 7 1 NH2 A ARG 23 ? ? O A HOH 602 ? ? 2.17 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A ARG 255 ? ? CG A ARG 255 ? ? 1.769 1.521 0.248 0.027 N 2 1 CG A ARG 255 ? ? CD A ARG 255 ? ? 1.736 1.515 0.221 0.025 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A LEU 171 ? ? CA A LEU 171 ? ? C A LEU 171 ? ? 88.54 111.00 -22.46 2.70 N 2 1 NE A ARG 255 ? ? CZ A ARG 255 ? ? NH1 A ARG 255 ? ? 115.56 120.30 -4.74 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 87 ? ? -65.20 7.61 2 1 HIS A 106 ? ? -38.80 129.96 3 1 PRO A 180 ? ? -64.63 -173.29 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ARG A 51 ? ? ARG A 52 ? ? -134.38 2 1 GLN A 90 ? ? ASP A 91 ? ? -148.14 3 1 GLU A 120 ? ? ASP A 121 ? ? 143.67 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 609 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 27.4711 _pdbx_refine_tls.origin_y 39.4699 _pdbx_refine_tls.origin_z 74.1192 _pdbx_refine_tls.T[1][1] -0.3478 _pdbx_refine_tls.T[2][2] 1.4473 _pdbx_refine_tls.T[3][3] 0.3587 _pdbx_refine_tls.T[1][2] 0.4217 _pdbx_refine_tls.T[1][3] 0.0417 _pdbx_refine_tls.T[2][3] -0.0929 _pdbx_refine_tls.L[1][1] 2.0859 _pdbx_refine_tls.L[2][2] 1.0794 _pdbx_refine_tls.L[3][3] 2.2153 _pdbx_refine_tls.L[1][2] 0.1644 _pdbx_refine_tls.L[1][3] -0.1775 _pdbx_refine_tls.L[2][3] 0.1069 _pdbx_refine_tls.S[1][1] -0.2119 _pdbx_refine_tls.S[1][2] 1.0518 _pdbx_refine_tls.S[1][3] -0.0148 _pdbx_refine_tls.S[2][1] -0.6498 _pdbx_refine_tls.S[2][2] 0.3314 _pdbx_refine_tls.S[2][3] -0.0360 _pdbx_refine_tls.S[3][1] 0.2255 _pdbx_refine_tls.S[3][2] -0.2707 _pdbx_refine_tls.S[3][3] -0.0826 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 247 ? A LYS 247 3 1 Y 1 A TYR 248 ? A TYR 248 4 1 Y 1 A PRO 249 ? A PRO 249 5 1 Y 1 A ASN 250 ? A ASN 250 6 1 Y 1 A THR 251 ? A THR 251 7 1 Y 1 A ARG 252 ? A ARG 252 8 1 Y 1 A GLU 270 ? A GLU 270 9 1 Y 1 A VAL 271 ? A VAL 271 10 1 Y 1 A ARG 272 ? A ARG 272 11 1 Y 1 A LYS 273 ? A LYS 273 12 1 Y 1 A THR 274 ? A THR 274 13 1 Y 1 A THR 301 ? A THR 301 14 1 Y 1 A THR 302 ? A THR 302 15 1 Y 1 A ILE 303 ? A ILE 303 16 1 Y 1 A LYS 304 ? A LYS 304 17 1 Y 1 A PRO 305 ? A PRO 305 18 1 Y 1 A SER 306 ? A SER 306 19 1 Y 1 A LYS 307 ? A LYS 307 20 1 Y 1 A GLU 308 ? A GLU 308 21 1 Y 1 A MET 309 ? A MET 309 22 1 Y 1 A LEU 310 ? A LEU 310 23 1 Y 1 A GLU 311 ? A GLU 311 24 1 Y 1 A VAL 312 ? A VAL 312 25 1 Y 1 A GLU 313 ? A GLU 313 26 1 Y 1 A LYS 314 ? A LYS 314 27 1 Y 1 A ALA 315 ? A ALA 315 28 1 Y 1 A LYS 316 ? A LYS 316 29 1 Y 1 A LEU 317 ? A LEU 317 30 1 Y 1 A PHE 318 ? A PHE 318 31 1 Y 1 A LEU 319 ? A LEU 319 32 1 Y 1 A HIS 320 ? A HIS 320 33 1 Y 1 A LYS 321 ? A LYS 321 34 1 Y 1 A ILE 322 ? A ILE 322 35 1 Y 1 A PRO 323 ? A PRO 323 36 1 Y 1 A ASN 324 ? A ASN 324 37 1 Y 1 A ASN 325 ? A ASN 325 38 1 Y 1 A VAL 326 ? A VAL 326 39 1 Y 1 A PRO 327 ? A PRO 327 40 1 Y 1 A SER 328 ? A SER 328 41 1 Y 1 A GLU 329 ? A GLU 329 42 1 Y 1 A GLU 330 ? A GLU 330 43 1 Y 1 A LEU 331 ? A LEU 331 44 1 Y 1 A GLU 332 ? A GLU 332 45 1 Y 1 A GLN 333 ? A GLN 333 46 1 Y 1 A VAL 334 ? A VAL 334 47 1 Y 1 A LEU 335 ? A LEU 335 48 1 Y 1 A SER 336 ? A SER 336 49 1 Y 1 A GLY 337 ? A GLY 337 50 1 Y 1 A LYS 338 ? A LYS 338 51 1 Y 1 A PHE 339 ? A PHE 339 52 1 Y 1 A THR 340 ? A THR 340 53 1 Y 1 A LEU 341 ? A LEU 341 54 1 Y 1 A ASP 342 ? A ASP 342 55 1 Y 1 A VAL 343 ? A VAL 343 56 1 Y 1 A LYS 344 ? A LYS 344 57 1 Y 1 A GLN 345 ? A GLN 345 58 1 Y 1 A ALA 346 ? A ALA 346 59 1 Y 1 A LYS 347 ? A LYS 347 60 1 Y 1 A THR 348 ? A THR 348 61 1 Y 1 A GLN 349 ? A GLN 349 62 1 Y 1 A GLY 350 ? A GLY 350 63 1 Y 1 A ARG 351 ? A ARG 351 64 1 Y 1 A TYR 352 ? A TYR 352 65 1 Y 1 A TYR 353 ? A TYR 353 66 1 Y 1 A CYS 354 ? A CYS 354 67 1 Y 1 A ALA 355 ? A ALA 355 68 1 Y 1 A PHE 356 ? A PHE 356 69 1 Y 1 A ALA 357 ? A ALA 357 70 1 Y 1 A LEU 358 ? A LEU 358 71 1 Y 1 A PHE 359 ? A PHE 359 72 1 Y 1 A HIS 360 ? A HIS 360 73 1 Y 1 A SER 361 ? A SER 361 74 1 Y 1 A SER 362 ? A SER 362 75 1 Y 1 A GLU 363 ? A GLU 363 76 1 Y 1 A ASP 364 ? A ASP 364 77 1 Y 1 A ALA 365 ? A ALA 365 78 1 Y 1 A ASP 366 ? A ASP 366 79 1 Y 1 A GLN 367 ? A GLN 367 80 1 Y 1 A ALA 368 ? A ALA 368 81 1 Y 1 A PHE 369 ? A PHE 369 82 1 Y 1 A GLU 370 ? A GLU 370 83 1 Y 1 A HIS 371 ? A HIS 371 84 1 Y 1 A ILE 372 ? A ILE 372 85 1 Y 1 A ASP 373 ? A ASP 373 86 1 Y 1 A GLY 374 ? A GLY 374 87 1 Y 1 A ILE 375 ? A ILE 375 88 1 Y 1 A GLU 376 ? A GLU 376 89 1 Y 1 A MET 377 ? A MET 377 90 1 Y 1 A THR 378 ? A THR 378 91 1 Y 1 A ASP 379 ? A ASP 379 92 1 Y 1 A SER 380 ? A SER 380 93 1 Y 1 A LEU 381 ? A LEU 381 94 1 Y 1 A GLY 382 ? A GLY 382 95 1 Y 1 A LEU 383 ? A LEU 383 96 1 Y 1 A PRO 384 ? A PRO 384 97 1 Y 1 A GLN 385 ? A GLN 385 98 1 Y 1 A LYS 386 ? A LYS 386 99 1 Y 1 A VAL 387 ? A VAL 387 100 1 Y 1 A VAL 388 ? A VAL 388 101 1 Y 1 A ILE 389 ? A ILE 389 102 1 Y 1 A ILE 390 ? A ILE 390 103 1 Y 1 A LYS 391 ? A LYS 391 104 1 Y 1 A LEU 392 ? A LEU 392 105 1 Y 1 A SER 393 ? A SER 393 106 1 Y 1 A SER 394 ? A SER 394 107 1 Y 1 A GLY 395 ? A GLY 395 108 1 Y 1 A SER 396 ? A SER 396 109 1 Y 1 A ARG 397 ? A ARG 397 110 1 Y 1 A ALA 398 ? A ALA 398 111 1 Y 1 A SER 399 ? A SER 399 112 1 Y 1 A ILE 400 ? A ILE 400 113 1 Y 1 A TYR 401 ? A TYR 401 114 1 Y 1 A VAL 402 ? A VAL 402 115 1 Y 1 A ARG 403 ? A ARG 403 116 1 Y 1 A LYS 404 ? A LYS 404 117 1 Y 1 A MET 405 ? A MET 405 118 1 Y 1 A VAL 406 ? A VAL 406 119 1 Y 1 A GLN 407 ? A GLN 407 120 1 Y 1 A ASP 408 ? A ASP 408 121 1 Y 1 A GLU 409 ? A GLU 409 122 1 Y 1 R A 1 ? B A 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A OP3 O N N 1 A P P N N 2 A OP1 O N N 3 A OP2 O N N 4 A "O5'" O N N 5 A "C5'" C N N 6 A "C4'" C N R 7 A "O4'" O N N 8 A "C3'" C N S 9 A "O3'" O N N 10 A "C2'" C N R 11 A "O2'" O N N 12 A "C1'" C N R 13 A N9 N Y N 14 A C8 C Y N 15 A N7 N Y N 16 A C5 C Y N 17 A C6 C Y N 18 A N6 N N N 19 A N1 N Y N 20 A C2 C Y N 21 A N3 N Y N 22 A C4 C Y N 23 A HOP3 H N N 24 A HOP2 H N N 25 A "H5'" H N N 26 A "H5''" H N N 27 A "H4'" H N N 28 A "H3'" H N N 29 A "HO3'" H N N 30 A "H2'" H N N 31 A "HO2'" H N N 32 A "H1'" H N N 33 A H8 H N N 34 A H61 H N N 35 A H62 H N N 36 A H2 H N N 37 ALA N N N N 38 ALA CA C N S 39 ALA C C N N 40 ALA O O N N 41 ALA CB C N N 42 ALA OXT O N N 43 ALA H H N N 44 ALA H2 H N N 45 ALA HA H N N 46 ALA HB1 H N N 47 ALA HB2 H N N 48 ALA HB3 H N N 49 ALA HXT H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 C OP3 O N N 111 C P P N N 112 C OP1 O N N 113 C OP2 O N N 114 C "O5'" O N N 115 C "C5'" C N N 116 C "C4'" C N R 117 C "O4'" O N N 118 C "C3'" C N S 119 C "O3'" O N N 120 C "C2'" C N R 121 C "O2'" O N N 122 C "C1'" C N R 123 C N1 N N N 124 C C2 C N N 125 C O2 O N N 126 C N3 N N N 127 C C4 C N N 128 C N4 N N N 129 C C5 C N N 130 C C6 C N N 131 C HOP3 H N N 132 C HOP2 H N N 133 C "H5'" H N N 134 C "H5''" H N N 135 C "H4'" H N N 136 C "H3'" H N N 137 C "HO3'" H N N 138 C "H2'" H N N 139 C "HO2'" H N N 140 C "H1'" H N N 141 C H41 H N N 142 C H42 H N N 143 C H5 H N N 144 C H6 H N N 145 CYS N N N N 146 CYS CA C N R 147 CYS C C N N 148 CYS O O N N 149 CYS CB C N N 150 CYS SG S N N 151 CYS OXT O N N 152 CYS H H N N 153 CYS H2 H N N 154 CYS HA H N N 155 CYS HB2 H N N 156 CYS HB3 H N N 157 CYS HG H N N 158 CYS HXT H N N 159 G OP3 O N N 160 G P P N N 161 G OP1 O N N 162 G OP2 O N N 163 G "O5'" O N N 164 G "C5'" C N N 165 G "C4'" C N R 166 G "O4'" O N N 167 G "C3'" C N S 168 G "O3'" O N N 169 G "C2'" C N R 170 G "O2'" O N N 171 G "C1'" C N R 172 G N9 N Y N 173 G C8 C Y N 174 G N7 N Y N 175 G C5 C Y N 176 G C6 C N N 177 G O6 O N N 178 G N1 N N N 179 G C2 C N N 180 G N2 N N N 181 G N3 N N N 182 G C4 C Y N 183 G HOP3 H N N 184 G HOP2 H N N 185 G "H5'" H N N 186 G "H5''" H N N 187 G "H4'" H N N 188 G "H3'" H N N 189 G "HO3'" H N N 190 G "H2'" H N N 191 G "HO2'" H N N 192 G "H1'" H N N 193 G H8 H N N 194 G H1 H N N 195 G H21 H N N 196 G H22 H N N 197 GLN N N N N 198 GLN CA C N S 199 GLN C C N N 200 GLN O O N N 201 GLN CB C N N 202 GLN CG C N N 203 GLN CD C N N 204 GLN OE1 O N N 205 GLN NE2 N N N 206 GLN OXT O N N 207 GLN H H N N 208 GLN H2 H N N 209 GLN HA H N N 210 GLN HB2 H N N 211 GLN HB3 H N N 212 GLN HG2 H N N 213 GLN HG3 H N N 214 GLN HE21 H N N 215 GLN HE22 H N N 216 GLN HXT H N N 217 GLU N N N N 218 GLU CA C N S 219 GLU C C N N 220 GLU O O N N 221 GLU CB C N N 222 GLU CG C N N 223 GLU CD C N N 224 GLU OE1 O N N 225 GLU OE2 O N N 226 GLU OXT O N N 227 GLU H H N N 228 GLU H2 H N N 229 GLU HA H N N 230 GLU HB2 H N N 231 GLU HB3 H N N 232 GLU HG2 H N N 233 GLU HG3 H N N 234 GLU HE2 H N N 235 GLU HXT H N N 236 GLY N N N N 237 GLY CA C N N 238 GLY C C N N 239 GLY O O N N 240 GLY OXT O N N 241 GLY H H N N 242 GLY H2 H N N 243 GLY HA2 H N N 244 GLY HA3 H N N 245 GLY HXT H N N 246 HIS N N N N 247 HIS CA C N S 248 HIS C C N N 249 HIS O O N N 250 HIS CB C N N 251 HIS CG C Y N 252 HIS ND1 N Y N 253 HIS CD2 C Y N 254 HIS CE1 C Y N 255 HIS NE2 N Y N 256 HIS OXT O N N 257 HIS H H N N 258 HIS H2 H N N 259 HIS HA H N N 260 HIS HB2 H N N 261 HIS HB3 H N N 262 HIS HD1 H N N 263 HIS HD2 H N N 264 HIS HE1 H N N 265 HIS HE2 H N N 266 HIS HXT H N N 267 HOH O O N N 268 HOH H1 H N N 269 HOH H2 H N N 270 ILE N N N N 271 ILE CA C N S 272 ILE C C N N 273 ILE O O N N 274 ILE CB C N S 275 ILE CG1 C N N 276 ILE CG2 C N N 277 ILE CD1 C N N 278 ILE OXT O N N 279 ILE H H N N 280 ILE H2 H N N 281 ILE HA H N N 282 ILE HB H N N 283 ILE HG12 H N N 284 ILE HG13 H N N 285 ILE HG21 H N N 286 ILE HG22 H N N 287 ILE HG23 H N N 288 ILE HD11 H N N 289 ILE HD12 H N N 290 ILE HD13 H N N 291 ILE HXT H N N 292 LEU N N N N 293 LEU CA C N S 294 LEU C C N N 295 LEU O O N N 296 LEU CB C N N 297 LEU CG C N N 298 LEU CD1 C N N 299 LEU CD2 C N N 300 LEU OXT O N N 301 LEU H H N N 302 LEU H2 H N N 303 LEU HA H N N 304 LEU HB2 H N N 305 LEU HB3 H N N 306 LEU HG H N N 307 LEU HD11 H N N 308 LEU HD12 H N N 309 LEU HD13 H N N 310 LEU HD21 H N N 311 LEU HD22 H N N 312 LEU HD23 H N N 313 LEU HXT H N N 314 LYS N N N N 315 LYS CA C N S 316 LYS C C N N 317 LYS O O N N 318 LYS CB C N N 319 LYS CG C N N 320 LYS CD C N N 321 LYS CE C N N 322 LYS NZ N N N 323 LYS OXT O N N 324 LYS H H N N 325 LYS H2 H N N 326 LYS HA H N N 327 LYS HB2 H N N 328 LYS HB3 H N N 329 LYS HG2 H N N 330 LYS HG3 H N N 331 LYS HD2 H N N 332 LYS HD3 H N N 333 LYS HE2 H N N 334 LYS HE3 H N N 335 LYS HZ1 H N N 336 LYS HZ2 H N N 337 LYS HZ3 H N N 338 LYS HXT H N N 339 MET N N N N 340 MET CA C N S 341 MET C C N N 342 MET O O N N 343 MET CB C N N 344 MET CG C N N 345 MET SD S N N 346 MET CE C N N 347 MET OXT O N N 348 MET H H N N 349 MET H2 H N N 350 MET HA H N N 351 MET HB2 H N N 352 MET HB3 H N N 353 MET HG2 H N N 354 MET HG3 H N N 355 MET HE1 H N N 356 MET HE2 H N N 357 MET HE3 H N N 358 MET HXT H N N 359 MG MG MG N N 360 PHE N N N N 361 PHE CA C N S 362 PHE C C N N 363 PHE O O N N 364 PHE CB C N N 365 PHE CG C Y N 366 PHE CD1 C Y N 367 PHE CD2 C Y N 368 PHE CE1 C Y N 369 PHE CE2 C Y N 370 PHE CZ C Y N 371 PHE OXT O N N 372 PHE H H N N 373 PHE H2 H N N 374 PHE HA H N N 375 PHE HB2 H N N 376 PHE HB3 H N N 377 PHE HD1 H N N 378 PHE HD2 H N N 379 PHE HE1 H N N 380 PHE HE2 H N N 381 PHE HZ H N N 382 PHE HXT H N N 383 PRO N N N N 384 PRO CA C N S 385 PRO C C N N 386 PRO O O N N 387 PRO CB C N N 388 PRO CG C N N 389 PRO CD C N N 390 PRO OXT O N N 391 PRO H H N N 392 PRO HA H N N 393 PRO HB2 H N N 394 PRO HB3 H N N 395 PRO HG2 H N N 396 PRO HG3 H N N 397 PRO HD2 H N N 398 PRO HD3 H N N 399 PRO HXT H N N 400 SER N N N N 401 SER CA C N S 402 SER C C N N 403 SER O O N N 404 SER CB C N N 405 SER OG O N N 406 SER OXT O N N 407 SER H H N N 408 SER H2 H N N 409 SER HA H N N 410 SER HB2 H N N 411 SER HB3 H N N 412 SER HG H N N 413 SER HXT H N N 414 SO4 S S N N 415 SO4 O1 O N N 416 SO4 O2 O N N 417 SO4 O3 O N N 418 SO4 O4 O N N 419 THR N N N N 420 THR CA C N S 421 THR C C N N 422 THR O O N N 423 THR CB C N R 424 THR OG1 O N N 425 THR CG2 C N N 426 THR OXT O N N 427 THR H H N N 428 THR H2 H N N 429 THR HA H N N 430 THR HB H N N 431 THR HG1 H N N 432 THR HG21 H N N 433 THR HG22 H N N 434 THR HG23 H N N 435 THR HXT H N N 436 TRP N N N N 437 TRP CA C N S 438 TRP C C N N 439 TRP O O N N 440 TRP CB C N N 441 TRP CG C Y N 442 TRP CD1 C Y N 443 TRP CD2 C Y N 444 TRP NE1 N Y N 445 TRP CE2 C Y N 446 TRP CE3 C Y N 447 TRP CZ2 C Y N 448 TRP CZ3 C Y N 449 TRP CH2 C Y N 450 TRP OXT O N N 451 TRP H H N N 452 TRP H2 H N N 453 TRP HA H N N 454 TRP HB2 H N N 455 TRP HB3 H N N 456 TRP HD1 H N N 457 TRP HE1 H N N 458 TRP HE3 H N N 459 TRP HZ2 H N N 460 TRP HZ3 H N N 461 TRP HH2 H N N 462 TRP HXT H N N 463 TYR N N N N 464 TYR CA C N S 465 TYR C C N N 466 TYR O O N N 467 TYR CB C N N 468 TYR CG C Y N 469 TYR CD1 C Y N 470 TYR CD2 C Y N 471 TYR CE1 C Y N 472 TYR CE2 C Y N 473 TYR CZ C Y N 474 TYR OH O N N 475 TYR OXT O N N 476 TYR H H N N 477 TYR H2 H N N 478 TYR HA H N N 479 TYR HB2 H N N 480 TYR HB3 H N N 481 TYR HD1 H N N 482 TYR HD2 H N N 483 TYR HE1 H N N 484 TYR HE2 H N N 485 TYR HH H N N 486 TYR HXT H N N 487 U OP3 O N N 488 U P P N N 489 U OP1 O N N 490 U OP2 O N N 491 U "O5'" O N N 492 U "C5'" C N N 493 U "C4'" C N R 494 U "O4'" O N N 495 U "C3'" C N S 496 U "O3'" O N N 497 U "C2'" C N R 498 U "O2'" O N N 499 U "C1'" C N R 500 U N1 N N N 501 U C2 C N N 502 U O2 O N N 503 U N3 N N N 504 U C4 C N N 505 U O4 O N N 506 U C5 C N N 507 U C6 C N N 508 U HOP3 H N N 509 U HOP2 H N N 510 U "H5'" H N N 511 U "H5''" H N N 512 U "H4'" H N N 513 U "H3'" H N N 514 U "HO3'" H N N 515 U "H2'" H N N 516 U "HO2'" H N N 517 U "H1'" H N N 518 U H3 H N N 519 U H5 H N N 520 U H6 H N N 521 VAL N N N N 522 VAL CA C N S 523 VAL C C N N 524 VAL O O N N 525 VAL CB C N N 526 VAL CG1 C N N 527 VAL CG2 C N N 528 VAL OXT O N N 529 VAL H H N N 530 VAL H2 H N N 531 VAL HA H N N 532 VAL HB H N N 533 VAL HG11 H N N 534 VAL HG12 H N N 535 VAL HG13 H N N 536 VAL HG21 H N N 537 VAL HG22 H N N 538 VAL HG23 H N N 539 VAL HXT H N N 540 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A OP3 P sing N N 1 A OP3 HOP3 sing N N 2 A P OP1 doub N N 3 A P OP2 sing N N 4 A P "O5'" sing N N 5 A OP2 HOP2 sing N N 6 A "O5'" "C5'" sing N N 7 A "C5'" "C4'" sing N N 8 A "C5'" "H5'" sing N N 9 A "C5'" "H5''" sing N N 10 A "C4'" "O4'" sing N N 11 A "C4'" "C3'" sing N N 12 A "C4'" "H4'" sing N N 13 A "O4'" "C1'" sing N N 14 A "C3'" "O3'" sing N N 15 A "C3'" "C2'" sing N N 16 A "C3'" "H3'" sing N N 17 A "O3'" "HO3'" sing N N 18 A "C2'" "O2'" sing N N 19 A "C2'" "C1'" sing N N 20 A "C2'" "H2'" sing N N 21 A "O2'" "HO2'" sing N N 22 A "C1'" N9 sing N N 23 A "C1'" "H1'" sing N N 24 A N9 C8 sing Y N 25 A N9 C4 sing Y N 26 A C8 N7 doub Y N 27 A C8 H8 sing N N 28 A N7 C5 sing Y N 29 A C5 C6 sing Y N 30 A C5 C4 doub Y N 31 A C6 N6 sing N N 32 A C6 N1 doub Y N 33 A N6 H61 sing N N 34 A N6 H62 sing N N 35 A N1 C2 sing Y N 36 A C2 N3 doub Y N 37 A C2 H2 sing N N 38 A N3 C4 sing Y N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 C OP3 P sing N N 109 C OP3 HOP3 sing N N 110 C P OP1 doub N N 111 C P OP2 sing N N 112 C P "O5'" sing N N 113 C OP2 HOP2 sing N N 114 C "O5'" "C5'" sing N N 115 C "C5'" "C4'" sing N N 116 C "C5'" "H5'" sing N N 117 C "C5'" "H5''" sing N N 118 C "C4'" "O4'" sing N N 119 C "C4'" "C3'" sing N N 120 C "C4'" "H4'" sing N N 121 C "O4'" "C1'" sing N N 122 C "C3'" "O3'" sing N N 123 C "C3'" "C2'" sing N N 124 C "C3'" "H3'" sing N N 125 C "O3'" "HO3'" sing N N 126 C "C2'" "O2'" sing N N 127 C "C2'" "C1'" sing N N 128 C "C2'" "H2'" sing N N 129 C "O2'" "HO2'" sing N N 130 C "C1'" N1 sing N N 131 C "C1'" "H1'" sing N N 132 C N1 C2 sing N N 133 C N1 C6 sing N N 134 C C2 O2 doub N N 135 C C2 N3 sing N N 136 C N3 C4 doub N N 137 C C4 N4 sing N N 138 C C4 C5 sing N N 139 C N4 H41 sing N N 140 C N4 H42 sing N N 141 C C5 C6 doub N N 142 C C5 H5 sing N N 143 C C6 H6 sing N N 144 CYS N CA sing N N 145 CYS N H sing N N 146 CYS N H2 sing N N 147 CYS CA C sing N N 148 CYS CA CB sing N N 149 CYS CA HA sing N N 150 CYS C O doub N N 151 CYS C OXT sing N N 152 CYS CB SG sing N N 153 CYS CB HB2 sing N N 154 CYS CB HB3 sing N N 155 CYS SG HG sing N N 156 CYS OXT HXT sing N N 157 G OP3 P sing N N 158 G OP3 HOP3 sing N N 159 G P OP1 doub N N 160 G P OP2 sing N N 161 G P "O5'" sing N N 162 G OP2 HOP2 sing N N 163 G "O5'" "C5'" sing N N 164 G "C5'" "C4'" sing N N 165 G "C5'" "H5'" sing N N 166 G "C5'" "H5''" sing N N 167 G "C4'" "O4'" sing N N 168 G "C4'" "C3'" sing N N 169 G "C4'" "H4'" sing N N 170 G "O4'" "C1'" sing N N 171 G "C3'" "O3'" sing N N 172 G "C3'" "C2'" sing N N 173 G "C3'" "H3'" sing N N 174 G "O3'" "HO3'" sing N N 175 G "C2'" "O2'" sing N N 176 G "C2'" "C1'" sing N N 177 G "C2'" "H2'" sing N N 178 G "O2'" "HO2'" sing N N 179 G "C1'" N9 sing N N 180 G "C1'" "H1'" sing N N 181 G N9 C8 sing Y N 182 G N9 C4 sing Y N 183 G C8 N7 doub Y N 184 G C8 H8 sing N N 185 G N7 C5 sing Y N 186 G C5 C6 sing N N 187 G C5 C4 doub Y N 188 G C6 O6 doub N N 189 G C6 N1 sing N N 190 G N1 C2 sing N N 191 G N1 H1 sing N N 192 G C2 N2 sing N N 193 G C2 N3 doub N N 194 G N2 H21 sing N N 195 G N2 H22 sing N N 196 G N3 C4 sing N N 197 GLN N CA sing N N 198 GLN N H sing N N 199 GLN N H2 sing N N 200 GLN CA C sing N N 201 GLN CA CB sing N N 202 GLN CA HA sing N N 203 GLN C O doub N N 204 GLN C OXT sing N N 205 GLN CB CG sing N N 206 GLN CB HB2 sing N N 207 GLN CB HB3 sing N N 208 GLN CG CD sing N N 209 GLN CG HG2 sing N N 210 GLN CG HG3 sing N N 211 GLN CD OE1 doub N N 212 GLN CD NE2 sing N N 213 GLN NE2 HE21 sing N N 214 GLN NE2 HE22 sing N N 215 GLN OXT HXT sing N N 216 GLU N CA sing N N 217 GLU N H sing N N 218 GLU N H2 sing N N 219 GLU CA C sing N N 220 GLU CA CB sing N N 221 GLU CA HA sing N N 222 GLU C O doub N N 223 GLU C OXT sing N N 224 GLU CB CG sing N N 225 GLU CB HB2 sing N N 226 GLU CB HB3 sing N N 227 GLU CG CD sing N N 228 GLU CG HG2 sing N N 229 GLU CG HG3 sing N N 230 GLU CD OE1 doub N N 231 GLU CD OE2 sing N N 232 GLU OE2 HE2 sing N N 233 GLU OXT HXT sing N N 234 GLY N CA sing N N 235 GLY N H sing N N 236 GLY N H2 sing N N 237 GLY CA C sing N N 238 GLY CA HA2 sing N N 239 GLY CA HA3 sing N N 240 GLY C O doub N N 241 GLY C OXT sing N N 242 GLY OXT HXT sing N N 243 HIS N CA sing N N 244 HIS N H sing N N 245 HIS N H2 sing N N 246 HIS CA C sing N N 247 HIS CA CB sing N N 248 HIS CA HA sing N N 249 HIS C O doub N N 250 HIS C OXT sing N N 251 HIS CB CG sing N N 252 HIS CB HB2 sing N N 253 HIS CB HB3 sing N N 254 HIS CG ND1 sing Y N 255 HIS CG CD2 doub Y N 256 HIS ND1 CE1 doub Y N 257 HIS ND1 HD1 sing N N 258 HIS CD2 NE2 sing Y N 259 HIS CD2 HD2 sing N N 260 HIS CE1 NE2 sing Y N 261 HIS CE1 HE1 sing N N 262 HIS NE2 HE2 sing N N 263 HIS OXT HXT sing N N 264 HOH O H1 sing N N 265 HOH O H2 sing N N 266 ILE N CA sing N N 267 ILE N H sing N N 268 ILE N H2 sing N N 269 ILE CA C sing N N 270 ILE CA CB sing N N 271 ILE CA HA sing N N 272 ILE C O doub N N 273 ILE C OXT sing N N 274 ILE CB CG1 sing N N 275 ILE CB CG2 sing N N 276 ILE CB HB sing N N 277 ILE CG1 CD1 sing N N 278 ILE CG1 HG12 sing N N 279 ILE CG1 HG13 sing N N 280 ILE CG2 HG21 sing N N 281 ILE CG2 HG22 sing N N 282 ILE CG2 HG23 sing N N 283 ILE CD1 HD11 sing N N 284 ILE CD1 HD12 sing N N 285 ILE CD1 HD13 sing N N 286 ILE OXT HXT sing N N 287 LEU N CA sing N N 288 LEU N H sing N N 289 LEU N H2 sing N N 290 LEU CA C sing N N 291 LEU CA CB sing N N 292 LEU CA HA sing N N 293 LEU C O doub N N 294 LEU C OXT sing N N 295 LEU CB CG sing N N 296 LEU CB HB2 sing N N 297 LEU CB HB3 sing N N 298 LEU CG CD1 sing N N 299 LEU CG CD2 sing N N 300 LEU CG HG sing N N 301 LEU CD1 HD11 sing N N 302 LEU CD1 HD12 sing N N 303 LEU CD1 HD13 sing N N 304 LEU CD2 HD21 sing N N 305 LEU CD2 HD22 sing N N 306 LEU CD2 HD23 sing N N 307 LEU OXT HXT sing N N 308 LYS N CA sing N N 309 LYS N H sing N N 310 LYS N H2 sing N N 311 LYS CA C sing N N 312 LYS CA CB sing N N 313 LYS CA HA sing N N 314 LYS C O doub N N 315 LYS C OXT sing N N 316 LYS CB CG sing N N 317 LYS CB HB2 sing N N 318 LYS CB HB3 sing N N 319 LYS CG CD sing N N 320 LYS CG HG2 sing N N 321 LYS CG HG3 sing N N 322 LYS CD CE sing N N 323 LYS CD HD2 sing N N 324 LYS CD HD3 sing N N 325 LYS CE NZ sing N N 326 LYS CE HE2 sing N N 327 LYS CE HE3 sing N N 328 LYS NZ HZ1 sing N N 329 LYS NZ HZ2 sing N N 330 LYS NZ HZ3 sing N N 331 LYS OXT HXT sing N N 332 MET N CA sing N N 333 MET N H sing N N 334 MET N H2 sing N N 335 MET CA C sing N N 336 MET CA CB sing N N 337 MET CA HA sing N N 338 MET C O doub N N 339 MET C OXT sing N N 340 MET CB CG sing N N 341 MET CB HB2 sing N N 342 MET CB HB3 sing N N 343 MET CG SD sing N N 344 MET CG HG2 sing N N 345 MET CG HG3 sing N N 346 MET SD CE sing N N 347 MET CE HE1 sing N N 348 MET CE HE2 sing N N 349 MET CE HE3 sing N N 350 MET OXT HXT sing N N 351 PHE N CA sing N N 352 PHE N H sing N N 353 PHE N H2 sing N N 354 PHE CA C sing N N 355 PHE CA CB sing N N 356 PHE CA HA sing N N 357 PHE C O doub N N 358 PHE C OXT sing N N 359 PHE CB CG sing N N 360 PHE CB HB2 sing N N 361 PHE CB HB3 sing N N 362 PHE CG CD1 doub Y N 363 PHE CG CD2 sing Y N 364 PHE CD1 CE1 sing Y N 365 PHE CD1 HD1 sing N N 366 PHE CD2 CE2 doub Y N 367 PHE CD2 HD2 sing N N 368 PHE CE1 CZ doub Y N 369 PHE CE1 HE1 sing N N 370 PHE CE2 CZ sing Y N 371 PHE CE2 HE2 sing N N 372 PHE CZ HZ sing N N 373 PHE OXT HXT sing N N 374 PRO N CA sing N N 375 PRO N CD sing N N 376 PRO N H sing N N 377 PRO CA C sing N N 378 PRO CA CB sing N N 379 PRO CA HA sing N N 380 PRO C O doub N N 381 PRO C OXT sing N N 382 PRO CB CG sing N N 383 PRO CB HB2 sing N N 384 PRO CB HB3 sing N N 385 PRO CG CD sing N N 386 PRO CG HG2 sing N N 387 PRO CG HG3 sing N N 388 PRO CD HD2 sing N N 389 PRO CD HD3 sing N N 390 PRO OXT HXT sing N N 391 SER N CA sing N N 392 SER N H sing N N 393 SER N H2 sing N N 394 SER CA C sing N N 395 SER CA CB sing N N 396 SER CA HA sing N N 397 SER C O doub N N 398 SER C OXT sing N N 399 SER CB OG sing N N 400 SER CB HB2 sing N N 401 SER CB HB3 sing N N 402 SER OG HG sing N N 403 SER OXT HXT sing N N 404 SO4 S O1 doub N N 405 SO4 S O2 doub N N 406 SO4 S O3 sing N N 407 SO4 S O4 sing N N 408 THR N CA sing N N 409 THR N H sing N N 410 THR N H2 sing N N 411 THR CA C sing N N 412 THR CA CB sing N N 413 THR CA HA sing N N 414 THR C O doub N N 415 THR C OXT sing N N 416 THR CB OG1 sing N N 417 THR CB CG2 sing N N 418 THR CB HB sing N N 419 THR OG1 HG1 sing N N 420 THR CG2 HG21 sing N N 421 THR CG2 HG22 sing N N 422 THR CG2 HG23 sing N N 423 THR OXT HXT sing N N 424 TRP N CA sing N N 425 TRP N H sing N N 426 TRP N H2 sing N N 427 TRP CA C sing N N 428 TRP CA CB sing N N 429 TRP CA HA sing N N 430 TRP C O doub N N 431 TRP C OXT sing N N 432 TRP CB CG sing N N 433 TRP CB HB2 sing N N 434 TRP CB HB3 sing N N 435 TRP CG CD1 doub Y N 436 TRP CG CD2 sing Y N 437 TRP CD1 NE1 sing Y N 438 TRP CD1 HD1 sing N N 439 TRP CD2 CE2 doub Y N 440 TRP CD2 CE3 sing Y N 441 TRP NE1 CE2 sing Y N 442 TRP NE1 HE1 sing N N 443 TRP CE2 CZ2 sing Y N 444 TRP CE3 CZ3 doub Y N 445 TRP CE3 HE3 sing N N 446 TRP CZ2 CH2 doub Y N 447 TRP CZ2 HZ2 sing N N 448 TRP CZ3 CH2 sing Y N 449 TRP CZ3 HZ3 sing N N 450 TRP CH2 HH2 sing N N 451 TRP OXT HXT sing N N 452 TYR N CA sing N N 453 TYR N H sing N N 454 TYR N H2 sing N N 455 TYR CA C sing N N 456 TYR CA CB sing N N 457 TYR CA HA sing N N 458 TYR C O doub N N 459 TYR C OXT sing N N 460 TYR CB CG sing N N 461 TYR CB HB2 sing N N 462 TYR CB HB3 sing N N 463 TYR CG CD1 doub Y N 464 TYR CG CD2 sing Y N 465 TYR CD1 CE1 sing Y N 466 TYR CD1 HD1 sing N N 467 TYR CD2 CE2 doub Y N 468 TYR CD2 HD2 sing N N 469 TYR CE1 CZ doub Y N 470 TYR CE1 HE1 sing N N 471 TYR CE2 CZ sing Y N 472 TYR CE2 HE2 sing N N 473 TYR CZ OH sing N N 474 TYR OH HH sing N N 475 TYR OXT HXT sing N N 476 U OP3 P sing N N 477 U OP3 HOP3 sing N N 478 U P OP1 doub N N 479 U P OP2 sing N N 480 U P "O5'" sing N N 481 U OP2 HOP2 sing N N 482 U "O5'" "C5'" sing N N 483 U "C5'" "C4'" sing N N 484 U "C5'" "H5'" sing N N 485 U "C5'" "H5''" sing N N 486 U "C4'" "O4'" sing N N 487 U "C4'" "C3'" sing N N 488 U "C4'" "H4'" sing N N 489 U "O4'" "C1'" sing N N 490 U "C3'" "O3'" sing N N 491 U "C3'" "C2'" sing N N 492 U "C3'" "H3'" sing N N 493 U "O3'" "HO3'" sing N N 494 U "C2'" "O2'" sing N N 495 U "C2'" "C1'" sing N N 496 U "C2'" "H2'" sing N N 497 U "O2'" "HO2'" sing N N 498 U "C1'" N1 sing N N 499 U "C1'" "H1'" sing N N 500 U N1 C2 sing N N 501 U N1 C6 sing N N 502 U C2 O2 doub N N 503 U C2 N3 sing N N 504 U N3 C4 sing N N 505 U N3 H3 sing N N 506 U C4 O4 doub N N 507 U C4 C5 sing N N 508 U C5 C6 doub N N 509 U C5 H5 sing N N 510 U C6 H6 sing N N 511 VAL N CA sing N N 512 VAL N H sing N N 513 VAL N H2 sing N N 514 VAL CA C sing N N 515 VAL CA CB sing N N 516 VAL CA HA sing N N 517 VAL C O doub N N 518 VAL C OXT sing N N 519 VAL CB CG1 sing N N 520 VAL CB CG2 sing N N 521 VAL CB HB sing N N 522 VAL CG1 HG11 sing N N 523 VAL CG1 HG12 sing N N 524 VAL CG1 HG13 sing N N 525 VAL CG2 HG21 sing N N 526 VAL CG2 HG22 sing N N 527 VAL CG2 HG23 sing N N 528 VAL OXT HXT sing N N 529 # _pdbx_audit_support.funding_organization 'Natural Science Foundation of China' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 'NSFC 31230041' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'In-house Se-SAD model' # _atom_sites.entry_id 5Z9X _atom_sites.fract_transf_matrix[1][1] 0.011365 _atom_sites.fract_transf_matrix[1][2] 0.006561 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013123 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005598 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_