data_5ZAZ # _entry.id 5ZAZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZAZ pdb_00005zaz 10.2210/pdb5zaz/pdb WWPDB D_1300006774 ? ? BMRB 36165 ? 10.13018/BMR36165 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-17 2 'Structure model' 1 1 2018-11-28 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 3 'Structure model' pdbx_nmr_software 6 3 'Structure model' pdbx_nmr_spectrometer 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' 14 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 15 3 'Structure model' '_pdbx_nmr_software.name' 16 3 'Structure model' '_pdbx_nmr_spectrometer.model' 17 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5ZAZ _pdbx_database_status.recvd_initial_deposition_date 2018-02-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of integrin b2 monomer tranmembrane domain in bicelle' _pdbx_database_related.db_id 36165 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, H.' 1 0000-0002-5436-848X 'Guo, J.' 2 0000-0002-9403-5305 'Xu, C.' 3 0000-0002-4968-6782 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'PLoS Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-7885 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first e2006525 _citation.page_last e2006525 _citation.title 'Intramembrane ionic protein-lipid interaction regulates integrin structure and function.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pbio.2006525 _citation.pdbx_database_id_PubMed 30427828 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guo, J.' 1 0000-0002-9403-5305 primary 'Zhang, Y.' 2 ? primary 'Li, H.' 3 ? primary 'Chu, H.' 4 ? primary 'Wang, Q.' 5 ? primary 'Jiang, S.' 6 ? primary 'Li, Y.' 7 ? primary 'Shen, H.' 8 ? primary 'Li, G.' 9 ? primary 'Chen, J.' 10 ? primary 'Xu, C.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Integrin beta-2' _entity.formula_weight 5647.616 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation C695S _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta,Complement receptor C3 subunit beta' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code PVDESRESVAGPNIAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFE _entity_poly.pdbx_seq_one_letter_code_can PVDESRESVAGPNIAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 VAL n 1 3 ASP n 1 4 GLU n 1 5 SER n 1 6 ARG n 1 7 GLU n 1 8 SER n 1 9 VAL n 1 10 ALA n 1 11 GLY n 1 12 PRO n 1 13 ASN n 1 14 ILE n 1 15 ALA n 1 16 ALA n 1 17 ILE n 1 18 VAL n 1 19 GLY n 1 20 GLY n 1 21 THR n 1 22 VAL n 1 23 ALA n 1 24 GLY n 1 25 ILE n 1 26 VAL n 1 27 LEU n 1 28 ILE n 1 29 GLY n 1 30 ILE n 1 31 LEU n 1 32 LEU n 1 33 LEU n 1 34 VAL n 1 35 ILE n 1 36 TRP n 1 37 LYS n 1 38 ALA n 1 39 LEU n 1 40 ILE n 1 41 HIS n 1 42 LEU n 1 43 SER n 1 44 ASP n 1 45 LEU n 1 46 ARG n 1 47 GLU n 1 48 TYR n 1 49 ARG n 1 50 ARG n 1 51 PHE n 1 52 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 52 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ITGB2, CD18, MFI7' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'BL21(DE3)' _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 688 688 PRO PRO A . n A 1 2 VAL 2 689 689 VAL VAL A . n A 1 3 ASP 3 690 690 ASP ASP A . n A 1 4 GLU 4 691 691 GLU GLU A . n A 1 5 SER 5 692 692 SER SER A . n A 1 6 ARG 6 693 693 ARG ARG A . n A 1 7 GLU 7 694 694 GLU GLU A . n A 1 8 SER 8 695 695 SER SER A . n A 1 9 VAL 9 696 696 VAL VAL A . n A 1 10 ALA 10 697 697 ALA ALA A . n A 1 11 GLY 11 698 698 GLY GLY A . n A 1 12 PRO 12 699 699 PRO PRO A . n A 1 13 ASN 13 700 700 ASN ASN A . n A 1 14 ILE 14 701 701 ILE ILE A . n A 1 15 ALA 15 702 702 ALA ALA A . n A 1 16 ALA 16 703 703 ALA ALA A . n A 1 17 ILE 17 704 704 ILE ILE A . n A 1 18 VAL 18 705 705 VAL VAL A . n A 1 19 GLY 19 706 706 GLY GLY A . n A 1 20 GLY 20 707 707 GLY GLY A . n A 1 21 THR 21 708 708 THR THR A . n A 1 22 VAL 22 709 709 VAL VAL A . n A 1 23 ALA 23 710 710 ALA ALA A . n A 1 24 GLY 24 711 711 GLY GLY A . n A 1 25 ILE 25 712 712 ILE ILE A . n A 1 26 VAL 26 713 713 VAL VAL A . n A 1 27 LEU 27 714 714 LEU LEU A . n A 1 28 ILE 28 715 715 ILE ILE A . n A 1 29 GLY 29 716 716 GLY GLY A . n A 1 30 ILE 30 717 717 ILE ILE A . n A 1 31 LEU 31 718 718 LEU LEU A . n A 1 32 LEU 32 719 719 LEU LEU A . n A 1 33 LEU 33 720 720 LEU LEU A . n A 1 34 VAL 34 721 721 VAL VAL A . n A 1 35 ILE 35 722 722 ILE ILE A . n A 1 36 TRP 36 723 723 TRP TRP A . n A 1 37 LYS 37 724 724 LYS LYS A . n A 1 38 ALA 38 725 725 ALA ALA A . n A 1 39 LEU 39 726 726 LEU LEU A . n A 1 40 ILE 40 727 727 ILE ILE A . n A 1 41 HIS 41 728 728 HIS HIS A . n A 1 42 LEU 42 729 729 LEU LEU A . n A 1 43 SER 43 730 730 SER SER A . n A 1 44 ASP 44 731 731 ASP ASP A . n A 1 45 LEU 45 732 732 LEU LEU A . n A 1 46 ARG 46 733 733 ARG ARG A . n A 1 47 GLU 47 734 734 GLU GLU A . n A 1 48 TYR 48 735 735 TYR TYR A . n A 1 49 ARG 49 736 736 ARG ARG A . n A 1 50 ARG 50 737 737 ARG ARG A . n A 1 51 PHE 51 738 738 PHE PHE A . n A 1 52 GLU 52 739 739 GLU GLU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZAZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5ZAZ _struct.title 'Solution structure of integrin b2 monomer tranmembrane domain in bicelle' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZAZ _struct_keywords.text 'integrin b2, protein-lipid interaction, phospholipids, Ca2+, cell adhesion' _struct_keywords.pdbx_keywords 'CELL ADHESION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITB2_HUMAN _struct_ref.pdbx_db_accession P05107 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VDESRECVAGPNIAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFE _struct_ref.pdbx_align_begin 689 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ZAZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05107 _struct_ref_seq.db_align_beg 689 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 739 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 689 _struct_ref_seq.pdbx_auth_seq_align_end 739 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZAZ PRO A 1 ? UNP P05107 ? ? 'expression tag' 688 1 1 5ZAZ SER A 8 ? UNP P05107 CYS 695 'engineered mutation' 695 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 14 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 48 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 701 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 735 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 35 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 695 ? ? -163.82 51.03 2 1 ALA A 697 ? ? -175.75 -57.69 3 1 PRO A 699 ? ? -69.78 -167.09 4 1 ASN A 700 ? ? -60.44 -168.33 5 1 TYR A 735 ? ? -57.26 171.14 6 2 GLU A 691 ? ? -98.78 41.11 7 2 ALA A 697 ? ? -155.74 -54.64 8 2 PRO A 699 ? ? -69.77 -167.07 9 2 ASN A 700 ? ? -60.46 -168.27 10 2 TYR A 735 ? ? -56.51 172.59 11 2 ARG A 736 ? ? -105.26 43.51 12 3 GLU A 694 ? ? 59.73 174.21 13 3 SER A 695 ? ? -175.44 63.15 14 3 ALA A 697 ? ? -144.36 26.94 15 3 PRO A 699 ? ? -69.78 -166.96 16 3 ASN A 700 ? ? -60.54 -168.13 17 3 ARG A 736 ? ? -98.09 35.50 18 4 ASP A 690 ? ? -125.45 -51.03 19 4 GLU A 694 ? ? 59.26 176.11 20 4 SER A 695 ? ? -167.09 65.43 21 4 ALA A 697 ? ? -172.28 -45.17 22 4 PRO A 699 ? ? -69.73 -165.56 23 4 ASN A 700 ? ? -60.74 -166.97 24 4 ARG A 736 ? ? -94.16 45.70 25 5 ASP A 690 ? ? -152.67 -73.70 26 5 GLU A 691 ? ? -111.31 50.54 27 5 ALA A 697 ? ? -157.40 -64.96 28 5 PRO A 699 ? ? -69.79 -167.08 29 5 ASN A 700 ? ? -60.46 -168.27 30 6 ASP A 690 ? ? 72.10 -69.47 31 6 GLU A 691 ? ? 51.84 -169.87 32 6 SER A 692 ? ? 61.36 177.75 33 6 SER A 695 ? ? -151.72 59.57 34 6 ALA A 697 ? ? -155.96 -63.12 35 6 PRO A 699 ? ? -69.78 -170.97 36 6 ARG A 736 ? ? -103.56 40.11 37 7 SER A 695 ? ? -178.19 82.36 38 7 ALA A 697 ? ? -150.04 -64.87 39 7 PRO A 699 ? ? -69.70 -174.64 40 7 ASN A 700 ? ? -65.94 -175.87 41 8 GLU A 694 ? ? 59.17 176.43 42 8 SER A 695 ? ? -147.62 50.04 43 8 ALA A 697 ? ? -171.91 -58.36 44 8 PRO A 699 ? ? -69.77 -167.04 45 8 ASN A 700 ? ? -60.37 -168.28 46 8 ARG A 736 ? ? -92.69 46.03 47 9 ASP A 690 ? ? 50.83 -169.04 48 9 SER A 695 ? ? -175.84 63.58 49 9 ALA A 697 ? ? -173.79 -55.00 50 9 PRO A 699 ? ? -69.72 -165.61 51 9 ASN A 700 ? ? -60.73 -166.96 52 9 ARG A 736 ? ? -98.98 43.26 53 10 GLU A 691 ? ? 56.84 94.82 54 10 SER A 692 ? ? -162.49 45.26 55 10 ALA A 697 ? ? -173.58 -36.77 56 10 PRO A 699 ? ? -69.77 -165.44 57 10 ASN A 700 ? ? -60.72 -166.57 58 10 ARG A 736 ? ? -95.13 46.49 59 11 SER A 692 ? ? 62.55 170.37 60 11 ARG A 693 ? ? -66.73 -176.93 61 11 SER A 695 ? ? -155.04 57.81 62 11 ALA A 697 ? ? -175.50 -47.17 63 11 PRO A 699 ? ? -69.74 -167.05 64 11 ASN A 700 ? ? -59.67 -170.06 65 11 ARG A 736 ? ? -91.69 47.34 66 12 SER A 695 ? ? 62.78 76.64 67 12 PRO A 699 ? ? -69.74 -167.26 68 12 ASN A 700 ? ? -59.76 -170.34 69 12 TYR A 735 ? ? -56.96 172.53 70 12 ARG A 736 ? ? -98.26 39.29 71 13 ARG A 693 ? ? -170.26 -179.59 72 13 SER A 695 ? ? -178.35 81.83 73 13 ALA A 697 ? ? -170.57 -42.62 74 13 PRO A 699 ? ? -69.74 -166.77 75 13 ASN A 700 ? ? -59.70 -169.83 76 13 TYR A 735 ? ? -57.93 171.34 77 13 ARG A 736 ? ? -94.49 41.67 78 14 ASP A 690 ? ? 50.51 88.49 79 14 PRO A 699 ? ? -69.77 -167.01 80 14 ASN A 700 ? ? -59.70 -170.05 81 14 ARG A 736 ? ? -94.04 43.77 82 15 GLU A 691 ? ? -106.26 61.84 83 15 SER A 695 ? ? 63.17 63.31 84 15 ALA A 697 ? ? -177.05 -42.22 85 15 PRO A 699 ? ? -69.71 -166.93 86 15 ASN A 700 ? ? -60.49 -168.16 87 15 GLU A 734 ? ? -69.91 -74.65 88 15 TYR A 735 ? ? 51.33 -173.76 89 15 ARG A 736 ? ? -96.02 36.08 90 16 GLU A 691 ? ? 56.79 94.75 91 16 ALA A 697 ? ? -178.22 -35.06 92 16 PRO A 699 ? ? -69.78 -167.11 93 16 ASN A 700 ? ? -60.49 -168.29 94 16 ARG A 736 ? ? -95.95 38.89 95 17 GLU A 694 ? ? 59.77 175.40 96 17 SER A 695 ? ? 61.72 75.57 97 17 ALA A 697 ? ? -167.99 -47.92 98 17 PRO A 699 ? ? -69.74 -165.70 99 17 ASN A 700 ? ? -60.68 -167.11 100 18 SER A 692 ? ? -177.59 138.93 101 18 SER A 695 ? ? -170.23 62.34 102 18 ALA A 697 ? ? -143.75 -67.60 103 18 PRO A 699 ? ? -69.74 -166.70 104 18 ASN A 700 ? ? -60.58 -168.07 105 18 ARG A 736 ? ? -102.58 43.83 106 19 ASP A 690 ? ? 63.25 162.23 107 19 SER A 692 ? ? 62.72 172.52 108 19 SER A 695 ? ? -172.15 54.58 109 19 ALA A 697 ? ? -143.67 -69.13 110 19 PRO A 699 ? ? -69.71 -165.68 111 19 ASN A 700 ? ? -59.74 -169.10 112 20 VAL A 689 ? ? 58.67 90.14 113 20 ASP A 690 ? ? -153.65 21.59 114 20 SER A 695 ? ? -167.48 77.08 115 20 ALA A 697 ? ? -177.47 76.62 116 20 ASN A 700 ? ? 63.82 -165.96 117 20 ARG A 736 ? ? -100.63 40.53 # _pdbx_nmr_ensemble.entry_id 5ZAZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5ZAZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.6 mM [U-13C; U-15N] integrin b2, 20 mM Bis-Tris, 240 mM DHPC, 48 mM POPC, 24 mM POPG, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C15N_sample _pdbx_nmr_sample_details.type bicelle _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'integrin b2' 0.6 ? mM '[U-13C; U-15N]' 1 Bis-Tris 20 ? mM 'natural abundance' 1 DHPC 240 ? mM 'natural abundance' 1 POPC 48 ? mM 'natural abundance' 1 POPG 24 ? mM 'natural abundance' 1 'Protease inhibitor cocktail' 1 ? % 'natural abundance' 1 NaN3 0.2 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 2 isotropic 2 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 3 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D CBCA(CO)NH' 1 isotropic 7 1 1 '3D HNCO' 1 isotropic 8 1 1 '2D 1H-15N HSQC' 1 isotropic 9 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 5ZAZ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert P.' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' KUJIRA ? 'Kobayashi N.' 4 'peak picking' KUJIRA ? 'Kobayashi N.' 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 6 collection TopSpin ? 'Bruker Biospin' 7 'data analysis' NMRView ? 'Johnson, One Moon Scientific' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 HIS N N N N 117 HIS CA C N S 118 HIS C C N N 119 HIS O O N N 120 HIS CB C N N 121 HIS CG C Y N 122 HIS ND1 N Y N 123 HIS CD2 C Y N 124 HIS CE1 C Y N 125 HIS NE2 N Y N 126 HIS OXT O N N 127 HIS H H N N 128 HIS H2 H N N 129 HIS HA H N N 130 HIS HB2 H N N 131 HIS HB3 H N N 132 HIS HD1 H N N 133 HIS HD2 H N N 134 HIS HE1 H N N 135 HIS HE2 H N N 136 HIS HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 PHE N N N N 207 PHE CA C N S 208 PHE C C N N 209 PHE O O N N 210 PHE CB C N N 211 PHE CG C Y N 212 PHE CD1 C Y N 213 PHE CD2 C Y N 214 PHE CE1 C Y N 215 PHE CE2 C Y N 216 PHE CZ C Y N 217 PHE OXT O N N 218 PHE H H N N 219 PHE H2 H N N 220 PHE HA H N N 221 PHE HB2 H N N 222 PHE HB3 H N N 223 PHE HD1 H N N 224 PHE HD2 H N N 225 PHE HE1 H N N 226 PHE HE2 H N N 227 PHE HZ H N N 228 PHE HXT H N N 229 PRO N N N N 230 PRO CA C N S 231 PRO C C N N 232 PRO O O N N 233 PRO CB C N N 234 PRO CG C N N 235 PRO CD C N N 236 PRO OXT O N N 237 PRO H H N N 238 PRO HA H N N 239 PRO HB2 H N N 240 PRO HB3 H N N 241 PRO HG2 H N N 242 PRO HG3 H N N 243 PRO HD2 H N N 244 PRO HD3 H N N 245 PRO HXT H N N 246 SER N N N N 247 SER CA C N S 248 SER C C N N 249 SER O O N N 250 SER CB C N N 251 SER OG O N N 252 SER OXT O N N 253 SER H H N N 254 SER H2 H N N 255 SER HA H N N 256 SER HB2 H N N 257 SER HB3 H N N 258 SER HG H N N 259 SER HXT H N N 260 THR N N N N 261 THR CA C N S 262 THR C C N N 263 THR O O N N 264 THR CB C N R 265 THR OG1 O N N 266 THR CG2 C N N 267 THR OXT O N N 268 THR H H N N 269 THR H2 H N N 270 THR HA H N N 271 THR HB H N N 272 THR HG1 H N N 273 THR HG21 H N N 274 THR HG22 H N N 275 THR HG23 H N N 276 THR HXT H N N 277 TRP N N N N 278 TRP CA C N S 279 TRP C C N N 280 TRP O O N N 281 TRP CB C N N 282 TRP CG C Y N 283 TRP CD1 C Y N 284 TRP CD2 C Y N 285 TRP NE1 N Y N 286 TRP CE2 C Y N 287 TRP CE3 C Y N 288 TRP CZ2 C Y N 289 TRP CZ3 C Y N 290 TRP CH2 C Y N 291 TRP OXT O N N 292 TRP H H N N 293 TRP H2 H N N 294 TRP HA H N N 295 TRP HB2 H N N 296 TRP HB3 H N N 297 TRP HD1 H N N 298 TRP HE1 H N N 299 TRP HE3 H N N 300 TRP HZ2 H N N 301 TRP HZ3 H N N 302 TRP HH2 H N N 303 TRP HXT H N N 304 TYR N N N N 305 TYR CA C N S 306 TYR C C N N 307 TYR O O N N 308 TYR CB C N N 309 TYR CG C Y N 310 TYR CD1 C Y N 311 TYR CD2 C Y N 312 TYR CE1 C Y N 313 TYR CE2 C Y N 314 TYR CZ C Y N 315 TYR OH O N N 316 TYR OXT O N N 317 TYR H H N N 318 TYR H2 H N N 319 TYR HA H N N 320 TYR HB2 H N N 321 TYR HB3 H N N 322 TYR HD1 H N N 323 TYR HD2 H N N 324 TYR HE1 H N N 325 TYR HE2 H N N 326 TYR HH H N N 327 TYR HXT H N N 328 VAL N N N N 329 VAL CA C N S 330 VAL C C N N 331 VAL O O N N 332 VAL CB C N N 333 VAL CG1 C N N 334 VAL CG2 C N N 335 VAL OXT O N N 336 VAL H H N N 337 VAL H2 H N N 338 VAL HA H N N 339 VAL HB H N N 340 VAL HG11 H N N 341 VAL HG12 H N N 342 VAL HG13 H N N 343 VAL HG21 H N N 344 VAL HG22 H N N 345 VAL HG23 H N N 346 VAL HXT H N N 347 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 PHE N CA sing N N 197 PHE N H sing N N 198 PHE N H2 sing N N 199 PHE CA C sing N N 200 PHE CA CB sing N N 201 PHE CA HA sing N N 202 PHE C O doub N N 203 PHE C OXT sing N N 204 PHE CB CG sing N N 205 PHE CB HB2 sing N N 206 PHE CB HB3 sing N N 207 PHE CG CD1 doub Y N 208 PHE CG CD2 sing Y N 209 PHE CD1 CE1 sing Y N 210 PHE CD1 HD1 sing N N 211 PHE CD2 CE2 doub Y N 212 PHE CD2 HD2 sing N N 213 PHE CE1 CZ doub Y N 214 PHE CE1 HE1 sing N N 215 PHE CE2 CZ sing Y N 216 PHE CE2 HE2 sing N N 217 PHE CZ HZ sing N N 218 PHE OXT HXT sing N N 219 PRO N CA sing N N 220 PRO N CD sing N N 221 PRO N H sing N N 222 PRO CA C sing N N 223 PRO CA CB sing N N 224 PRO CA HA sing N N 225 PRO C O doub N N 226 PRO C OXT sing N N 227 PRO CB CG sing N N 228 PRO CB HB2 sing N N 229 PRO CB HB3 sing N N 230 PRO CG CD sing N N 231 PRO CG HG2 sing N N 232 PRO CG HG3 sing N N 233 PRO CD HD2 sing N N 234 PRO CD HD3 sing N N 235 PRO OXT HXT sing N N 236 SER N CA sing N N 237 SER N H sing N N 238 SER N H2 sing N N 239 SER CA C sing N N 240 SER CA CB sing N N 241 SER CA HA sing N N 242 SER C O doub N N 243 SER C OXT sing N N 244 SER CB OG sing N N 245 SER CB HB2 sing N N 246 SER CB HB3 sing N N 247 SER OG HG sing N N 248 SER OXT HXT sing N N 249 THR N CA sing N N 250 THR N H sing N N 251 THR N H2 sing N N 252 THR CA C sing N N 253 THR CA CB sing N N 254 THR CA HA sing N N 255 THR C O doub N N 256 THR C OXT sing N N 257 THR CB OG1 sing N N 258 THR CB CG2 sing N N 259 THR CB HB sing N N 260 THR OG1 HG1 sing N N 261 THR CG2 HG21 sing N N 262 THR CG2 HG22 sing N N 263 THR CG2 HG23 sing N N 264 THR OXT HXT sing N N 265 TRP N CA sing N N 266 TRP N H sing N N 267 TRP N H2 sing N N 268 TRP CA C sing N N 269 TRP CA CB sing N N 270 TRP CA HA sing N N 271 TRP C O doub N N 272 TRP C OXT sing N N 273 TRP CB CG sing N N 274 TRP CB HB2 sing N N 275 TRP CB HB3 sing N N 276 TRP CG CD1 doub Y N 277 TRP CG CD2 sing Y N 278 TRP CD1 NE1 sing Y N 279 TRP CD1 HD1 sing N N 280 TRP CD2 CE2 doub Y N 281 TRP CD2 CE3 sing Y N 282 TRP NE1 CE2 sing Y N 283 TRP NE1 HE1 sing N N 284 TRP CE2 CZ2 sing Y N 285 TRP CE3 CZ3 doub Y N 286 TRP CE3 HE3 sing N N 287 TRP CZ2 CH2 doub Y N 288 TRP CZ2 HZ2 sing N N 289 TRP CZ3 CH2 sing Y N 290 TRP CZ3 HZ3 sing N N 291 TRP CH2 HH2 sing N N 292 TRP OXT HXT sing N N 293 TYR N CA sing N N 294 TYR N H sing N N 295 TYR N H2 sing N N 296 TYR CA C sing N N 297 TYR CA CB sing N N 298 TYR CA HA sing N N 299 TYR C O doub N N 300 TYR C OXT sing N N 301 TYR CB CG sing N N 302 TYR CB HB2 sing N N 303 TYR CB HB3 sing N N 304 TYR CG CD1 doub Y N 305 TYR CG CD2 sing Y N 306 TYR CD1 CE1 sing Y N 307 TYR CD1 HD1 sing N N 308 TYR CD2 CE2 doub Y N 309 TYR CD2 HD2 sing N N 310 TYR CE1 CZ doub Y N 311 TYR CE1 HE1 sing N N 312 TYR CE2 CZ sing Y N 313 TYR CE2 HE2 sing N N 314 TYR CZ OH sing N N 315 TYR OH HH sing N N 316 TYR OXT HXT sing N N 317 VAL N CA sing N N 318 VAL N H sing N N 319 VAL N H2 sing N N 320 VAL CA C sing N N 321 VAL CA CB sing N N 322 VAL CA HA sing N N 323 VAL C O doub N N 324 VAL C OXT sing N N 325 VAL CB CG1 sing N N 326 VAL CB CG2 sing N N 327 VAL CB HB sing N N 328 VAL CG1 HG11 sing N N 329 VAL CG1 HG12 sing N N 330 VAL CG1 HG13 sing N N 331 VAL CG2 HG21 sing N N 332 VAL CG2 HG22 sing N N 333 VAL CG2 HG23 sing N N 334 VAL OXT HXT sing N N 335 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal NSFC China 31470734 1 NSFC China 31670751 2 MOST China 2014CB541903 3 'CAS Key Research Program of Frontier Sciences' China QYZDB-SSW-SMC048 4 'CAS Facility-based Open Research Program' China ? 5 'NSFC Innovative Research Group' China 31621003 6 'NSFC Key Program' China 31530022 7 'Ten Thousand Talent Program National Program for Support of Top-notch Young Professionals of China' China ? 8 'STSMC Key Program' China 16JC1404800 9 'NSFC National Science Fund for Distinguished Young Scholars' China 31425009 10 'STSMC Outstanding Academic Leader Program' China 15XD1504200 11 'CAS Strategic Priority Research Program' China XDB08020100 12 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 900 ? # _atom_sites.entry_id 5ZAZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_