data_5ZK6 # _entry.id 5ZK6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZK6 pdb_00005zk6 10.2210/pdb5zk6/pdb WWPDB D_1300007197 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZK6 _pdbx_database_status.recvd_initial_deposition_date 2018-03-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Arimura, Y.' 1 0000-0002-1903-6076 'Kono, T.' 2 0000-0003-3205-7653 'Kino, K.' 3 0000-0003-2367-3876 'Kurumizaka, H.' 4 0000-0001-7412-3722 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Molecular dynamics prediction of substrate recognition by poly-alpha-L-glutamate synthetase' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnuki, J.' 1 ? primary 'Arimura, Y.' 2 ? primary 'Kono, T.' 3 ? primary 'Kino, K.' 4 ? primary 'Kurumizaka, H.' 5 ? primary 'Takano, M.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5ZK6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 131.272 _cell.length_a_esd ? _cell.length_b 131.272 _cell.length_b_esd ? _cell.length_c 168.571 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZK6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ribosomal protein S6--L-glutamate ligase' 33104.254 1 6.3.2.- ? ? ? 2 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Polyglutamate synthase,Ribosomal protein S6 modification protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNINPAASSIHYKGRKLPHFDAVIPRIGTAITFYGTAALRQF EMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAA ESVIDAFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASITPQEREIAIKAARTM ALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRWIERHATTEYCLKTGGGTLVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNINPAASSIHYKGRKLPHFDAVIPRIGTAITFYGTAALRQF EMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAA ESVIDAFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASITPQEREIAIKAARTM ALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRWIERHATTEYCLKTGGGTLVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ILE n 1 4 ALA n 1 5 ILE n 1 6 LEU n 1 7 SER n 1 8 ARG n 1 9 ASP n 1 10 GLY n 1 11 THR n 1 12 LEU n 1 13 TYR n 1 14 SER n 1 15 CYS n 1 16 LYS n 1 17 ARG n 1 18 LEU n 1 19 ARG n 1 20 GLU n 1 21 ALA n 1 22 ALA n 1 23 ILE n 1 24 GLN n 1 25 ARG n 1 26 GLY n 1 27 HIS n 1 28 LEU n 1 29 VAL n 1 30 GLU n 1 31 ILE n 1 32 LEU n 1 33 ASP n 1 34 PRO n 1 35 LEU n 1 36 SER n 1 37 CYS n 1 38 TYR n 1 39 MET n 1 40 ASN n 1 41 ILE n 1 42 ASN n 1 43 PRO n 1 44 ALA n 1 45 ALA n 1 46 SER n 1 47 SER n 1 48 ILE n 1 49 HIS n 1 50 TYR n 1 51 LYS n 1 52 GLY n 1 53 ARG n 1 54 LYS n 1 55 LEU n 1 56 PRO n 1 57 HIS n 1 58 PHE n 1 59 ASP n 1 60 ALA n 1 61 VAL n 1 62 ILE n 1 63 PRO n 1 64 ARG n 1 65 ILE n 1 66 GLY n 1 67 THR n 1 68 ALA n 1 69 ILE n 1 70 THR n 1 71 PHE n 1 72 TYR n 1 73 GLY n 1 74 THR n 1 75 ALA n 1 76 ALA n 1 77 LEU n 1 78 ARG n 1 79 GLN n 1 80 PHE n 1 81 GLU n 1 82 MET n 1 83 LEU n 1 84 GLY n 1 85 SER n 1 86 TYR n 1 87 PRO n 1 88 LEU n 1 89 ASN n 1 90 GLU n 1 91 SER n 1 92 VAL n 1 93 ALA n 1 94 ILE n 1 95 ALA n 1 96 ARG n 1 97 ALA n 1 98 ARG n 1 99 ASP n 1 100 LYS n 1 101 LEU n 1 102 ARG n 1 103 SER n 1 104 MET n 1 105 GLN n 1 106 LEU n 1 107 LEU n 1 108 ALA n 1 109 ARG n 1 110 GLN n 1 111 GLY n 1 112 ILE n 1 113 ASP n 1 114 LEU n 1 115 PRO n 1 116 VAL n 1 117 THR n 1 118 GLY n 1 119 ILE n 1 120 ALA n 1 121 HIS n 1 122 SER n 1 123 PRO n 1 124 ASP n 1 125 ASP n 1 126 THR n 1 127 SER n 1 128 ASP n 1 129 LEU n 1 130 ILE n 1 131 ASP n 1 132 MET n 1 133 VAL n 1 134 GLY n 1 135 GLY n 1 136 ALA n 1 137 PRO n 1 138 LEU n 1 139 VAL n 1 140 VAL n 1 141 LYS n 1 142 LEU n 1 143 VAL n 1 144 GLU n 1 145 GLY n 1 146 THR n 1 147 GLN n 1 148 GLY n 1 149 ILE n 1 150 GLY n 1 151 VAL n 1 152 VAL n 1 153 LEU n 1 154 ALA n 1 155 GLU n 1 156 THR n 1 157 ARG n 1 158 GLN n 1 159 ALA n 1 160 ALA n 1 161 GLU n 1 162 SER n 1 163 VAL n 1 164 ILE n 1 165 ASP n 1 166 ALA n 1 167 PHE n 1 168 ARG n 1 169 GLY n 1 170 LEU n 1 171 ASN n 1 172 ALA n 1 173 HIS n 1 174 ILE n 1 175 LEU n 1 176 VAL n 1 177 GLN n 1 178 GLU n 1 179 TYR n 1 180 ILE n 1 181 LYS n 1 182 GLU n 1 183 ALA n 1 184 GLN n 1 185 GLY n 1 186 CYS n 1 187 ASP n 1 188 ILE n 1 189 ARG n 1 190 CYS n 1 191 LEU n 1 192 VAL n 1 193 VAL n 1 194 GLY n 1 195 ASP n 1 196 GLU n 1 197 VAL n 1 198 VAL n 1 199 ALA n 1 200 ALA n 1 201 ILE n 1 202 GLU n 1 203 ARG n 1 204 ARG n 1 205 ALA n 1 206 LYS n 1 207 GLU n 1 208 GLY n 1 209 ASP n 1 210 PHE n 1 211 ARG n 1 212 SER n 1 213 ASN n 1 214 LEU n 1 215 HIS n 1 216 ARG n 1 217 GLY n 1 218 GLY n 1 219 ALA n 1 220 ALA n 1 221 SER n 1 222 VAL n 1 223 ALA n 1 224 SER n 1 225 ILE n 1 226 THR n 1 227 PRO n 1 228 GLN n 1 229 GLU n 1 230 ARG n 1 231 GLU n 1 232 ILE n 1 233 ALA n 1 234 ILE n 1 235 LYS n 1 236 ALA n 1 237 ALA n 1 238 ARG n 1 239 THR n 1 240 MET n 1 241 ALA n 1 242 LEU n 1 243 ASP n 1 244 VAL n 1 245 ALA n 1 246 GLY n 1 247 VAL n 1 248 ASP n 1 249 ILE n 1 250 LEU n 1 251 ARG n 1 252 ALA n 1 253 ASN n 1 254 ARG n 1 255 GLY n 1 256 PRO n 1 257 LEU n 1 258 VAL n 1 259 MET n 1 260 GLU n 1 261 VAL n 1 262 ASN n 1 263 ALA n 1 264 SER n 1 265 PRO n 1 266 GLY n 1 267 LEU n 1 268 GLU n 1 269 GLY n 1 270 ILE n 1 271 GLU n 1 272 LYS n 1 273 THR n 1 274 THR n 1 275 GLY n 1 276 ILE n 1 277 ASP n 1 278 ILE n 1 279 ALA n 1 280 GLY n 1 281 LYS n 1 282 MET n 1 283 ILE n 1 284 ARG n 1 285 TRP n 1 286 ILE n 1 287 GLU n 1 288 ARG n 1 289 HIS n 1 290 ALA n 1 291 THR n 1 292 THR n 1 293 GLU n 1 294 TYR n 1 295 CYS n 1 296 LEU n 1 297 LYS n 1 298 THR n 1 299 GLY n 1 300 GLY n 1 301 GLY n 1 302 THR n 1 303 LEU n 1 304 VAL n 1 305 PRO n 1 306 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 306 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene rimK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RIMK_ECOLI _struct_ref.pdbx_db_accession P0C0U4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNINPAASSIHYKGRKLPHFDAVIPRIGTAITFYGTAALRQF EMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAA ESVIDAFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASITPQEREIAIKAARTM ALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRWIERHATTEYCLKTGG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ZK6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 300 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0C0U4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 300 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 300 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZK6 GLY A 301 ? UNP P0C0U4 ? ? 'expression tag' 301 1 1 5ZK6 THR A 302 ? UNP P0C0U4 ? ? 'expression tag' 302 2 1 5ZK6 LEU A 303 ? UNP P0C0U4 ? ? 'expression tag' 303 3 1 5ZK6 VAL A 304 ? UNP P0C0U4 ? ? 'expression tag' 304 4 1 5ZK6 PRO A 305 ? UNP P0C0U4 ? ? 'expression tag' 305 5 1 5ZK6 ARG A 306 ? UNP P0C0U4 ? ? 'expression tag' 306 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZK6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM Tris-HCl (pH 7.8), 600mM Sodium formate, 8% Poly-gamma-glutamic acid 200-400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-04 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL41XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL41XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 121.870 _reflns.entry_id 5ZK6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.150 _reflns.d_resolution_low 47.130 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15497 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 37.700 _reflns.pdbx_Rmerge_I_obs 0.167 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.170 _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.150 3.360 ? ? ? ? ? ? 2724 99.600 ? ? ? ? 2.942 ? ? ? ? ? ? ? ? 38.200 ? ? ? ? 2.981 0.478 ? 1 1 0.926 ? 8.900 47.130 ? ? ? ? ? ? 793 99.300 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 29.300 ? ? ? ? 0.037 0.007 ? 2 1 1.000 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 164.730 _refine.B_iso_mean 114.1968 _refine.B_iso_min 81.030 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZK6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.1500 _refine.ls_d_res_low 42.9690 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15391 _refine.ls_number_reflns_R_free 711 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7700 _refine.ls_percent_reflns_R_free 4.6200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2095 _refine.ls_R_factor_R_free 0.2449 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2079 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5ZCT _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.5900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.1500 _refine_hist.d_res_low 42.9690 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2234 _refine_hist.pdbx_number_residues_total 291 _refine_hist.pdbx_B_iso_mean_ligand 122.50 _refine_hist.pdbx_number_atoms_protein 2206 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 2266 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.155 ? 3067 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.065 ? 358 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 395 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 10.681 ? 1386 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.1500 3.3932 2990 . 144 2846 100.0000 . . . 0.4181 0.0000 0.3510 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.3932 3.7344 3004 . 147 2857 100.0000 . . . 0.3149 0.0000 0.2784 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.7344 4.2744 3032 . 155 2877 100.0000 . . . 0.2956 0.0000 0.2305 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.2744 5.3836 3086 . 123 2963 100.0000 . . . 0.2119 0.0000 0.1866 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 5.3836 42.9728 3279 . 142 3137 100.0000 . . . 0.2072 0.0000 0.1826 . . . . . . 5 . . . # _struct.entry_id 5ZK6 _struct.title 'Crystal structure of RimK complexed with RpsF' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZK6 _struct_keywords.text 'Ribosomal protein modification protein, carboxylate-amine/thiol ligase, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 12 ? GLN A 24 ? LEU A 12 GLN A 24 1 ? 13 HELX_P HELX_P2 AA2 ASP A 33 ? LEU A 35 ? ASP A 33 LEU A 35 5 ? 3 HELX_P HELX_P3 AA3 ILE A 69 ? LEU A 83 ? ILE A 69 LEU A 83 1 ? 15 HELX_P HELX_P4 AA4 GLU A 90 ? ASP A 99 ? GLU A 90 ASP A 99 1 ? 10 HELX_P HELX_P5 AA5 ASP A 99 ? GLN A 110 ? ASP A 99 GLN A 110 1 ? 12 HELX_P HELX_P6 AA6 ASP A 125 ? VAL A 133 ? ASP A 125 VAL A 133 1 ? 9 HELX_P HELX_P7 AA7 THR A 156 ? ARG A 168 ? THR A 156 ARG A 168 1 ? 13 HELX_P HELX_P8 AA8 ILE A 180 ? GLN A 184 ? ILE A 180 GLN A 184 5 ? 5 HELX_P HELX_P9 AA9 THR A 226 ? MET A 240 ? THR A 226 MET A 240 1 ? 15 HELX_P HELX_P10 AB1 LEU A 267 ? GLY A 275 ? LEU A 267 GLY A 275 1 ? 9 HELX_P HELX_P11 AB2 ASP A 277 ? ALA A 290 ? ASP A 277 ALA A 290 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A SER 212 CB ? ? ? 1_555 B ADP . "O3'" ? ? A SER 212 A ADP 1001 1_555 ? ? ? ? ? ? ? 1.379 ? ? metalc1 metalc ? ? A GLU 260 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 260 A MG 1002 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc2 metalc ? ? B ADP . O3B ? ? ? 1_555 C MG . MG ? ? A ADP 1001 A MG 1002 1_555 ? ? ? ? ? ? ? 2.478 ? ? metalc3 metalc ? ? B ADP . O2A ? ? ? 1_555 C MG . MG ? ? A ADP 1001 A MG 1002 1_555 ? ? ? ? ? ? ? 2.505 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 42 A . ? ASN 42 A PRO 43 A ? PRO 43 A 1 4.39 2 ALA 136 A . ? ALA 136 A PRO 137 A ? PRO 137 A 1 -4.08 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 28 ? LEU A 32 ? LEU A 28 LEU A 32 AA1 2 LYS A 2 ? LEU A 6 ? LYS A 2 LEU A 6 AA1 3 ALA A 60 ? PRO A 63 ? ALA A 60 PRO A 63 AA1 4 TYR A 86 ? PRO A 87 ? TYR A 86 PRO A 87 AA2 1 CYS A 37 ? MET A 39 ? CYS A 37 MET A 39 AA2 2 ILE A 48 ? TYR A 50 ? ILE A 48 TYR A 50 AA2 3 ARG A 53 ? LYS A 54 ? ARG A 53 LYS A 54 AA3 1 THR A 117 ? ALA A 120 ? THR A 117 ALA A 120 AA3 2 HIS A 173 ? GLU A 178 ? HIS A 173 GLU A 178 AA3 3 LEU A 138 ? GLU A 144 ? LEU A 138 GLU A 144 AA3 4 GLN A 147 ? ALA A 154 ? GLN A 147 ALA A 154 AA4 1 ALA A 219 ? VAL A 222 ? ALA A 219 VAL A 222 AA4 2 GLU A 196 ? ARG A 204 ? GLU A 196 ARG A 204 AA4 3 CYS A 186 ? VAL A 193 ? CYS A 186 VAL A 193 AA4 4 VAL A 244 ? ALA A 252 ? VAL A 244 ALA A 252 AA4 5 GLY A 255 ? ASN A 262 ? GLY A 255 ASN A 262 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 32 ? O LEU A 32 N ILE A 5 ? N ILE A 5 AA1 2 3 N LEU A 6 ? N LEU A 6 O ILE A 62 ? O ILE A 62 AA1 3 4 N VAL A 61 ? N VAL A 61 O TYR A 86 ? O TYR A 86 AA2 1 2 N TYR A 38 ? N TYR A 38 O HIS A 49 ? O HIS A 49 AA2 2 3 N TYR A 50 ? N TYR A 50 O ARG A 53 ? O ARG A 53 AA3 1 2 N GLY A 118 ? N GLY A 118 O VAL A 176 ? O VAL A 176 AA3 2 3 O LEU A 175 ? O LEU A 175 N LYS A 141 ? N LYS A 141 AA3 3 4 N GLU A 144 ? N GLU A 144 O GLN A 147 ? O GLN A 147 AA4 1 2 O SER A 221 ? O SER A 221 N GLU A 202 ? N GLU A 202 AA4 2 3 O ARG A 203 ? O ARG A 203 N ASP A 187 ? N ASP A 187 AA4 3 4 N CYS A 190 ? N CYS A 190 O VAL A 247 ? O VAL A 247 AA4 4 5 N ALA A 252 ? N ALA A 252 O GLY A 255 ? O GLY A 255 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ADP 1001 ? 16 'binding site for residue ADP A 1001' AC2 Software A MG 1002 ? 3 'binding site for residue MG A 1002' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 LYS A 141 ? LYS A 141 . ? 1_555 ? 2 AC1 16 VAL A 151 ? VAL A 151 . ? 1_555 ? 3 AC1 16 GLN A 177 ? GLN A 177 . ? 1_555 ? 4 AC1 16 GLU A 178 ? GLU A 178 . ? 1_555 ? 5 AC1 16 TYR A 179 ? TYR A 179 . ? 1_555 ? 6 AC1 16 ILE A 180 ? ILE A 180 . ? 1_555 ? 7 AC1 16 ARG A 203 ? ARG A 203 . ? 1_555 ? 8 AC1 16 PHE A 210 ? PHE A 210 . ? 1_555 ? 9 AC1 16 ARG A 211 ? ARG A 211 . ? 1_555 ? 10 AC1 16 SER A 212 ? SER A 212 . ? 1_555 ? 11 AC1 16 ASN A 213 ? ASN A 213 . ? 1_555 ? 12 AC1 16 ARG A 216 ? ARG A 216 . ? 1_555 ? 13 AC1 16 LEU A 250 ? LEU A 250 . ? 1_555 ? 14 AC1 16 MET A 259 ? MET A 259 . ? 1_555 ? 15 AC1 16 GLU A 260 ? GLU A 260 . ? 1_555 ? 16 AC1 16 MG C . ? MG A 1002 . ? 1_555 ? 17 AC2 3 ASN A 213 ? ASN A 213 . ? 1_555 ? 18 AC2 3 GLU A 260 ? GLU A 260 . ? 1_555 ? 19 AC2 3 ADP B . ? ADP A 1001 . ? 1_555 ? # _atom_sites.entry_id 5ZK6 _atom_sites.fract_transf_matrix[1][1] 0.007618 _atom_sites.fract_transf_matrix[1][2] 0.004398 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008796 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005932 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 MET 132 132 132 MET MET A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 CYS 186 186 186 CYS CYS A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 CYS 190 190 190 CYS CYS A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 PHE 210 210 210 PHE PHE A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 HIS 215 215 215 HIS HIS A . n A 1 216 ARG 216 216 216 ARG ARG A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 ALA 219 219 219 ALA ALA A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 SER 224 224 224 SER SER A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 GLN 228 228 228 GLN GLN A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 ARG 230 230 230 ARG ARG A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 LYS 235 235 235 LYS LYS A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 THR 239 239 239 THR THR A . n A 1 240 MET 240 240 240 MET MET A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 ASP 243 243 243 ASP ASP A . n A 1 244 VAL 244 244 244 VAL VAL A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 ASP 248 248 248 ASP ASP A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 ASN 253 253 253 ASN ASN A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 GLY 255 255 255 GLY GLY A . n A 1 256 PRO 256 256 256 PRO PRO A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 MET 259 259 259 MET MET A . n A 1 260 GLU 260 260 260 GLU GLU A . n A 1 261 VAL 261 261 261 VAL VAL A . n A 1 262 ASN 262 262 262 ASN ASN A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 SER 264 264 264 SER SER A . n A 1 265 PRO 265 265 265 PRO PRO A . n A 1 266 GLY 266 266 266 GLY GLY A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 GLU 268 268 268 GLU GLU A . n A 1 269 GLY 269 269 269 GLY GLY A . n A 1 270 ILE 270 270 270 ILE ILE A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 LYS 272 272 272 LYS LYS A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 THR 274 274 274 THR THR A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 ILE 276 276 276 ILE ILE A . n A 1 277 ASP 277 277 277 ASP ASP A . n A 1 278 ILE 278 278 278 ILE ILE A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 LYS 281 281 281 LYS LYS A . n A 1 282 MET 282 282 282 MET MET A . n A 1 283 ILE 283 283 283 ILE ILE A . n A 1 284 ARG 284 284 284 ARG ARG A . n A 1 285 TRP 285 285 285 TRP TRP A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 GLU 287 287 287 GLU GLU A . n A 1 288 ARG 288 288 288 ARG ARG A . n A 1 289 HIS 289 289 289 HIS HIS A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 THR 291 291 291 THR THR A . n A 1 292 THR 292 292 ? ? ? A . n A 1 293 GLU 293 293 ? ? ? A . n A 1 294 TYR 294 294 ? ? ? A . n A 1 295 CYS 295 295 ? ? ? A . n A 1 296 LEU 296 296 ? ? ? A . n A 1 297 LYS 297 297 ? ? ? A . n A 1 298 THR 298 298 ? ? ? A . n A 1 299 GLY 299 299 ? ? ? A . n A 1 300 GLY 300 300 ? ? ? A . n A 1 301 GLY 301 301 ? ? ? A . n A 1 302 THR 302 302 ? ? ? A . n A 1 303 LEU 303 303 ? ? ? A . n A 1 304 VAL 304 304 ? ? ? A . n A 1 305 PRO 305 305 ? ? ? A . n A 1 306 ARG 306 306 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ADP 1 1001 1001 ADP ADP A . C 3 MG 1 1002 2001 MG MG A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 14610 ? 1 MORE -131 ? 1 'SSA (A^2)' 42330 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_475 -x-1,-y+2,z -1.0000000000 0.0000000000 0.0000000000 -262.5440000000 0.0000000000 -1.0000000000 0.0000000000 227.3697736112 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 8_675 x-y+1,-y+2,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 227.3697736112 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 11_355 -x+y-2,y,-z -1.0000000000 0.0000000000 0.0000000000 -262.5440000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 260 ? A GLU 260 ? 1_555 MG ? C MG . ? A MG 1002 ? 1_555 O3B ? B ADP . ? A ADP 1001 ? 1_555 128.7 ? 2 OE1 ? A GLU 260 ? A GLU 260 ? 1_555 MG ? C MG . ? A MG 1002 ? 1_555 O2A ? B ADP . ? A ADP 1001 ? 1_555 67.4 ? 3 O3B ? B ADP . ? A ADP 1001 ? 1_555 MG ? C MG . ? A MG 1002 ? 1_555 O2A ? B ADP . ? A ADP 1001 ? 1_555 65.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-03-27 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_phasing_MR.entry_id 5ZK6 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 6.740 _pdbx_phasing_MR.d_res_low_rotation 42.970 _pdbx_phasing_MR.d_res_high_translation 6.740 _pdbx_phasing_MR.d_res_low_translation 42.970 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 1 ? 'data scaling' ? ? 'Phil Evans' ? 21/10/15 ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program 0.5.17 2 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk 'Fri Jul 7 22:41:19 2017 (svn 8200) (git 7250, 5e21953... )' ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program 2.8.0 3 ? refinement ? ? 'Paul D. Adams' PDAdams@lbl.gov ? ? ? ? C++ http://www.phenix-online.org/ ? PHENIX ? ? package 1.12_2829 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Sep. 1, 2017' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.24 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 142 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 142 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 142 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 100.64 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -10.36 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 89 ? ? 84.54 114.01 2 1 ASP A 99 ? ? -57.14 101.33 3 1 HIS A 121 ? ? -107.21 -70.26 4 1 ASN A 171 ? ? 84.70 18.59 5 1 ALA A 200 ? ? -176.20 139.73 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 292 ? A THR 292 2 1 Y 1 A GLU 293 ? A GLU 293 3 1 Y 1 A TYR 294 ? A TYR 294 4 1 Y 1 A CYS 295 ? A CYS 295 5 1 Y 1 A LEU 296 ? A LEU 296 6 1 Y 1 A LYS 297 ? A LYS 297 7 1 Y 1 A THR 298 ? A THR 298 8 1 Y 1 A GLY 299 ? A GLY 299 9 1 Y 1 A GLY 300 ? A GLY 300 10 1 Y 1 A GLY 301 ? A GLY 301 11 1 Y 1 A THR 302 ? A THR 302 12 1 Y 1 A LEU 303 ? A LEU 303 13 1 Y 1 A VAL 304 ? A VAL 304 14 1 Y 1 A PRO 305 ? A PRO 305 15 1 Y 1 A ARG 306 ? A ARG 306 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ADP PB P N N 1 ADP O1B O N N 2 ADP O2B O N N 3 ADP O3B O N N 4 ADP PA P N S 5 ADP O1A O N N 6 ADP O2A O N N 7 ADP O3A O N N 8 ADP "O5'" O N N 9 ADP "C5'" C N N 10 ADP "C4'" C N R 11 ADP "O4'" O N N 12 ADP "C3'" C N S 13 ADP "O3'" O N N 14 ADP "C2'" C N R 15 ADP "O2'" O N N 16 ADP "C1'" C N R 17 ADP N9 N Y N 18 ADP C8 C Y N 19 ADP N7 N Y N 20 ADP C5 C Y N 21 ADP C6 C Y N 22 ADP N6 N N N 23 ADP N1 N Y N 24 ADP C2 C Y N 25 ADP N3 N Y N 26 ADP C4 C Y N 27 ADP HOB2 H N N 28 ADP HOB3 H N N 29 ADP HOA2 H N N 30 ADP "H5'1" H N N 31 ADP "H5'2" H N N 32 ADP "H4'" H N N 33 ADP "H3'" H N N 34 ADP "HO3'" H N N 35 ADP "H2'" H N N 36 ADP "HO2'" H N N 37 ADP "H1'" H N N 38 ADP H8 H N N 39 ADP HN61 H N N 40 ADP HN62 H N N 41 ADP H2 H N N 42 ALA N N N N 43 ALA CA C N S 44 ALA C C N N 45 ALA O O N N 46 ALA CB C N N 47 ALA OXT O N N 48 ALA H H N N 49 ALA H2 H N N 50 ALA HA H N N 51 ALA HB1 H N N 52 ALA HB2 H N N 53 ALA HB3 H N N 54 ALA HXT H N N 55 ARG N N N N 56 ARG CA C N S 57 ARG C C N N 58 ARG O O N N 59 ARG CB C N N 60 ARG CG C N N 61 ARG CD C N N 62 ARG NE N N N 63 ARG CZ C N N 64 ARG NH1 N N N 65 ARG NH2 N N N 66 ARG OXT O N N 67 ARG H H N N 68 ARG H2 H N N 69 ARG HA H N N 70 ARG HB2 H N N 71 ARG HB3 H N N 72 ARG HG2 H N N 73 ARG HG3 H N N 74 ARG HD2 H N N 75 ARG HD3 H N N 76 ARG HE H N N 77 ARG HH11 H N N 78 ARG HH12 H N N 79 ARG HH21 H N N 80 ARG HH22 H N N 81 ARG HXT H N N 82 ASN N N N N 83 ASN CA C N S 84 ASN C C N N 85 ASN O O N N 86 ASN CB C N N 87 ASN CG C N N 88 ASN OD1 O N N 89 ASN ND2 N N N 90 ASN OXT O N N 91 ASN H H N N 92 ASN H2 H N N 93 ASN HA H N N 94 ASN HB2 H N N 95 ASN HB3 H N N 96 ASN HD21 H N N 97 ASN HD22 H N N 98 ASN HXT H N N 99 ASP N N N N 100 ASP CA C N S 101 ASP C C N N 102 ASP O O N N 103 ASP CB C N N 104 ASP CG C N N 105 ASP OD1 O N N 106 ASP OD2 O N N 107 ASP OXT O N N 108 ASP H H N N 109 ASP H2 H N N 110 ASP HA H N N 111 ASP HB2 H N N 112 ASP HB3 H N N 113 ASP HD2 H N N 114 ASP HXT H N N 115 CYS N N N N 116 CYS CA C N R 117 CYS C C N N 118 CYS O O N N 119 CYS CB C N N 120 CYS SG S N N 121 CYS OXT O N N 122 CYS H H N N 123 CYS H2 H N N 124 CYS HA H N N 125 CYS HB2 H N N 126 CYS HB3 H N N 127 CYS HG H N N 128 CYS HXT H N N 129 GLN N N N N 130 GLN CA C N S 131 GLN C C N N 132 GLN O O N N 133 GLN CB C N N 134 GLN CG C N N 135 GLN CD C N N 136 GLN OE1 O N N 137 GLN NE2 N N N 138 GLN OXT O N N 139 GLN H H N N 140 GLN H2 H N N 141 GLN HA H N N 142 GLN HB2 H N N 143 GLN HB3 H N N 144 GLN HG2 H N N 145 GLN HG3 H N N 146 GLN HE21 H N N 147 GLN HE22 H N N 148 GLN HXT H N N 149 GLU N N N N 150 GLU CA C N S 151 GLU C C N N 152 GLU O O N N 153 GLU CB C N N 154 GLU CG C N N 155 GLU CD C N N 156 GLU OE1 O N N 157 GLU OE2 O N N 158 GLU OXT O N N 159 GLU H H N N 160 GLU H2 H N N 161 GLU HA H N N 162 GLU HB2 H N N 163 GLU HB3 H N N 164 GLU HG2 H N N 165 GLU HG3 H N N 166 GLU HE2 H N N 167 GLU HXT H N N 168 GLY N N N N 169 GLY CA C N N 170 GLY C C N N 171 GLY O O N N 172 GLY OXT O N N 173 GLY H H N N 174 GLY H2 H N N 175 GLY HA2 H N N 176 GLY HA3 H N N 177 GLY HXT H N N 178 HIS N N N N 179 HIS CA C N S 180 HIS C C N N 181 HIS O O N N 182 HIS CB C N N 183 HIS CG C Y N 184 HIS ND1 N Y N 185 HIS CD2 C Y N 186 HIS CE1 C Y N 187 HIS NE2 N Y N 188 HIS OXT O N N 189 HIS H H N N 190 HIS H2 H N N 191 HIS HA H N N 192 HIS HB2 H N N 193 HIS HB3 H N N 194 HIS HD1 H N N 195 HIS HD2 H N N 196 HIS HE1 H N N 197 HIS HE2 H N N 198 HIS HXT H N N 199 ILE N N N N 200 ILE CA C N S 201 ILE C C N N 202 ILE O O N N 203 ILE CB C N S 204 ILE CG1 C N N 205 ILE CG2 C N N 206 ILE CD1 C N N 207 ILE OXT O N N 208 ILE H H N N 209 ILE H2 H N N 210 ILE HA H N N 211 ILE HB H N N 212 ILE HG12 H N N 213 ILE HG13 H N N 214 ILE HG21 H N N 215 ILE HG22 H N N 216 ILE HG23 H N N 217 ILE HD11 H N N 218 ILE HD12 H N N 219 ILE HD13 H N N 220 ILE HXT H N N 221 LEU N N N N 222 LEU CA C N S 223 LEU C C N N 224 LEU O O N N 225 LEU CB C N N 226 LEU CG C N N 227 LEU CD1 C N N 228 LEU CD2 C N N 229 LEU OXT O N N 230 LEU H H N N 231 LEU H2 H N N 232 LEU HA H N N 233 LEU HB2 H N N 234 LEU HB3 H N N 235 LEU HG H N N 236 LEU HD11 H N N 237 LEU HD12 H N N 238 LEU HD13 H N N 239 LEU HD21 H N N 240 LEU HD22 H N N 241 LEU HD23 H N N 242 LEU HXT H N N 243 LYS N N N N 244 LYS CA C N S 245 LYS C C N N 246 LYS O O N N 247 LYS CB C N N 248 LYS CG C N N 249 LYS CD C N N 250 LYS CE C N N 251 LYS NZ N N N 252 LYS OXT O N N 253 LYS H H N N 254 LYS H2 H N N 255 LYS HA H N N 256 LYS HB2 H N N 257 LYS HB3 H N N 258 LYS HG2 H N N 259 LYS HG3 H N N 260 LYS HD2 H N N 261 LYS HD3 H N N 262 LYS HE2 H N N 263 LYS HE3 H N N 264 LYS HZ1 H N N 265 LYS HZ2 H N N 266 LYS HZ3 H N N 267 LYS HXT H N N 268 MET N N N N 269 MET CA C N S 270 MET C C N N 271 MET O O N N 272 MET CB C N N 273 MET CG C N N 274 MET SD S N N 275 MET CE C N N 276 MET OXT O N N 277 MET H H N N 278 MET H2 H N N 279 MET HA H N N 280 MET HB2 H N N 281 MET HB3 H N N 282 MET HG2 H N N 283 MET HG3 H N N 284 MET HE1 H N N 285 MET HE2 H N N 286 MET HE3 H N N 287 MET HXT H N N 288 MG MG MG N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ADP PB O1B doub N N 1 ADP PB O2B sing N N 2 ADP PB O3B sing N N 3 ADP PB O3A sing N N 4 ADP O2B HOB2 sing N N 5 ADP O3B HOB3 sing N N 6 ADP PA O1A doub N N 7 ADP PA O2A sing N N 8 ADP PA O3A sing N N 9 ADP PA "O5'" sing N N 10 ADP O2A HOA2 sing N N 11 ADP "O5'" "C5'" sing N N 12 ADP "C5'" "C4'" sing N N 13 ADP "C5'" "H5'1" sing N N 14 ADP "C5'" "H5'2" sing N N 15 ADP "C4'" "O4'" sing N N 16 ADP "C4'" "C3'" sing N N 17 ADP "C4'" "H4'" sing N N 18 ADP "O4'" "C1'" sing N N 19 ADP "C3'" "O3'" sing N N 20 ADP "C3'" "C2'" sing N N 21 ADP "C3'" "H3'" sing N N 22 ADP "O3'" "HO3'" sing N N 23 ADP "C2'" "O2'" sing N N 24 ADP "C2'" "C1'" sing N N 25 ADP "C2'" "H2'" sing N N 26 ADP "O2'" "HO2'" sing N N 27 ADP "C1'" N9 sing N N 28 ADP "C1'" "H1'" sing N N 29 ADP N9 C8 sing Y N 30 ADP N9 C4 sing Y N 31 ADP C8 N7 doub Y N 32 ADP C8 H8 sing N N 33 ADP N7 C5 sing Y N 34 ADP C5 C6 sing Y N 35 ADP C5 C4 doub Y N 36 ADP C6 N6 sing N N 37 ADP C6 N1 doub Y N 38 ADP N6 HN61 sing N N 39 ADP N6 HN62 sing N N 40 ADP N1 C2 sing Y N 41 ADP C2 N3 doub Y N 42 ADP C2 H2 sing N N 43 ADP N3 C4 sing Y N 44 ALA N CA sing N N 45 ALA N H sing N N 46 ALA N H2 sing N N 47 ALA CA C sing N N 48 ALA CA CB sing N N 49 ALA CA HA sing N N 50 ALA C O doub N N 51 ALA C OXT sing N N 52 ALA CB HB1 sing N N 53 ALA CB HB2 sing N N 54 ALA CB HB3 sing N N 55 ALA OXT HXT sing N N 56 ARG N CA sing N N 57 ARG N H sing N N 58 ARG N H2 sing N N 59 ARG CA C sing N N 60 ARG CA CB sing N N 61 ARG CA HA sing N N 62 ARG C O doub N N 63 ARG C OXT sing N N 64 ARG CB CG sing N N 65 ARG CB HB2 sing N N 66 ARG CB HB3 sing N N 67 ARG CG CD sing N N 68 ARG CG HG2 sing N N 69 ARG CG HG3 sing N N 70 ARG CD NE sing N N 71 ARG CD HD2 sing N N 72 ARG CD HD3 sing N N 73 ARG NE CZ sing N N 74 ARG NE HE sing N N 75 ARG CZ NH1 sing N N 76 ARG CZ NH2 doub N N 77 ARG NH1 HH11 sing N N 78 ARG NH1 HH12 sing N N 79 ARG NH2 HH21 sing N N 80 ARG NH2 HH22 sing N N 81 ARG OXT HXT sing N N 82 ASN N CA sing N N 83 ASN N H sing N N 84 ASN N H2 sing N N 85 ASN CA C sing N N 86 ASN CA CB sing N N 87 ASN CA HA sing N N 88 ASN C O doub N N 89 ASN C OXT sing N N 90 ASN CB CG sing N N 91 ASN CB HB2 sing N N 92 ASN CB HB3 sing N N 93 ASN CG OD1 doub N N 94 ASN CG ND2 sing N N 95 ASN ND2 HD21 sing N N 96 ASN ND2 HD22 sing N N 97 ASN OXT HXT sing N N 98 ASP N CA sing N N 99 ASP N H sing N N 100 ASP N H2 sing N N 101 ASP CA C sing N N 102 ASP CA CB sing N N 103 ASP CA HA sing N N 104 ASP C O doub N N 105 ASP C OXT sing N N 106 ASP CB CG sing N N 107 ASP CB HB2 sing N N 108 ASP CB HB3 sing N N 109 ASP CG OD1 doub N N 110 ASP CG OD2 sing N N 111 ASP OD2 HD2 sing N N 112 ASP OXT HXT sing N N 113 CYS N CA sing N N 114 CYS N H sing N N 115 CYS N H2 sing N N 116 CYS CA C sing N N 117 CYS CA CB sing N N 118 CYS CA HA sing N N 119 CYS C O doub N N 120 CYS C OXT sing N N 121 CYS CB SG sing N N 122 CYS CB HB2 sing N N 123 CYS CB HB3 sing N N 124 CYS SG HG sing N N 125 CYS OXT HXT sing N N 126 GLN N CA sing N N 127 GLN N H sing N N 128 GLN N H2 sing N N 129 GLN CA C sing N N 130 GLN CA CB sing N N 131 GLN CA HA sing N N 132 GLN C O doub N N 133 GLN C OXT sing N N 134 GLN CB CG sing N N 135 GLN CB HB2 sing N N 136 GLN CB HB3 sing N N 137 GLN CG CD sing N N 138 GLN CG HG2 sing N N 139 GLN CG HG3 sing N N 140 GLN CD OE1 doub N N 141 GLN CD NE2 sing N N 142 GLN NE2 HE21 sing N N 143 GLN NE2 HE22 sing N N 144 GLN OXT HXT sing N N 145 GLU N CA sing N N 146 GLU N H sing N N 147 GLU N H2 sing N N 148 GLU CA C sing N N 149 GLU CA CB sing N N 150 GLU CA HA sing N N 151 GLU C O doub N N 152 GLU C OXT sing N N 153 GLU CB CG sing N N 154 GLU CB HB2 sing N N 155 GLU CB HB3 sing N N 156 GLU CG CD sing N N 157 GLU CG HG2 sing N N 158 GLU CG HG3 sing N N 159 GLU CD OE1 doub N N 160 GLU CD OE2 sing N N 161 GLU OE2 HE2 sing N N 162 GLU OXT HXT sing N N 163 GLY N CA sing N N 164 GLY N H sing N N 165 GLY N H2 sing N N 166 GLY CA C sing N N 167 GLY CA HA2 sing N N 168 GLY CA HA3 sing N N 169 GLY C O doub N N 170 GLY C OXT sing N N 171 GLY OXT HXT sing N N 172 HIS N CA sing N N 173 HIS N H sing N N 174 HIS N H2 sing N N 175 HIS CA C sing N N 176 HIS CA CB sing N N 177 HIS CA HA sing N N 178 HIS C O doub N N 179 HIS C OXT sing N N 180 HIS CB CG sing N N 181 HIS CB HB2 sing N N 182 HIS CB HB3 sing N N 183 HIS CG ND1 sing Y N 184 HIS CG CD2 doub Y N 185 HIS ND1 CE1 doub Y N 186 HIS ND1 HD1 sing N N 187 HIS CD2 NE2 sing Y N 188 HIS CD2 HD2 sing N N 189 HIS CE1 NE2 sing Y N 190 HIS CE1 HE1 sing N N 191 HIS NE2 HE2 sing N N 192 HIS OXT HXT sing N N 193 ILE N CA sing N N 194 ILE N H sing N N 195 ILE N H2 sing N N 196 ILE CA C sing N N 197 ILE CA CB sing N N 198 ILE CA HA sing N N 199 ILE C O doub N N 200 ILE C OXT sing N N 201 ILE CB CG1 sing N N 202 ILE CB CG2 sing N N 203 ILE CB HB sing N N 204 ILE CG1 CD1 sing N N 205 ILE CG1 HG12 sing N N 206 ILE CG1 HG13 sing N N 207 ILE CG2 HG21 sing N N 208 ILE CG2 HG22 sing N N 209 ILE CG2 HG23 sing N N 210 ILE CD1 HD11 sing N N 211 ILE CD1 HD12 sing N N 212 ILE CD1 HD13 sing N N 213 ILE OXT HXT sing N N 214 LEU N CA sing N N 215 LEU N H sing N N 216 LEU N H2 sing N N 217 LEU CA C sing N N 218 LEU CA CB sing N N 219 LEU CA HA sing N N 220 LEU C O doub N N 221 LEU C OXT sing N N 222 LEU CB CG sing N N 223 LEU CB HB2 sing N N 224 LEU CB HB3 sing N N 225 LEU CG CD1 sing N N 226 LEU CG CD2 sing N N 227 LEU CG HG sing N N 228 LEU CD1 HD11 sing N N 229 LEU CD1 HD12 sing N N 230 LEU CD1 HD13 sing N N 231 LEU CD2 HD21 sing N N 232 LEU CD2 HD22 sing N N 233 LEU CD2 HD23 sing N N 234 LEU OXT HXT sing N N 235 LYS N CA sing N N 236 LYS N H sing N N 237 LYS N H2 sing N N 238 LYS CA C sing N N 239 LYS CA CB sing N N 240 LYS CA HA sing N N 241 LYS C O doub N N 242 LYS C OXT sing N N 243 LYS CB CG sing N N 244 LYS CB HB2 sing N N 245 LYS CB HB3 sing N N 246 LYS CG CD sing N N 247 LYS CG HG2 sing N N 248 LYS CG HG3 sing N N 249 LYS CD CE sing N N 250 LYS CD HD2 sing N N 251 LYS CD HD3 sing N N 252 LYS CE NZ sing N N 253 LYS CE HE2 sing N N 254 LYS CE HE3 sing N N 255 LYS NZ HZ1 sing N N 256 LYS NZ HZ2 sing N N 257 LYS NZ HZ3 sing N N 258 LYS OXT HXT sing N N 259 MET N CA sing N N 260 MET N H sing N N 261 MET N H2 sing N N 262 MET CA C sing N N 263 MET CA CB sing N N 264 MET CA HA sing N N 265 MET C O doub N N 266 MET C OXT sing N N 267 MET CB CG sing N N 268 MET CB HB2 sing N N 269 MET CB HB3 sing N N 270 MET CG SD sing N N 271 MET CG HG2 sing N N 272 MET CG HG3 sing N N 273 MET SD CE sing N N 274 MET CE HE1 sing N N 275 MET CE HE2 sing N N 276 MET CE HE3 sing N N 277 MET OXT HXT sing N N 278 PHE N CA sing N N 279 PHE N H sing N N 280 PHE N H2 sing N N 281 PHE CA C sing N N 282 PHE CA CB sing N N 283 PHE CA HA sing N N 284 PHE C O doub N N 285 PHE C OXT sing N N 286 PHE CB CG sing N N 287 PHE CB HB2 sing N N 288 PHE CB HB3 sing N N 289 PHE CG CD1 doub Y N 290 PHE CG CD2 sing Y N 291 PHE CD1 CE1 sing Y N 292 PHE CD1 HD1 sing N N 293 PHE CD2 CE2 doub Y N 294 PHE CD2 HD2 sing N N 295 PHE CE1 CZ doub Y N 296 PHE CE1 HE1 sing N N 297 PHE CE2 CZ sing Y N 298 PHE CE2 HE2 sing N N 299 PHE CZ HZ sing N N 300 PHE OXT HXT sing N N 301 PRO N CA sing N N 302 PRO N CD sing N N 303 PRO N H sing N N 304 PRO CA C sing N N 305 PRO CA CB sing N N 306 PRO CA HA sing N N 307 PRO C O doub N N 308 PRO C OXT sing N N 309 PRO CB CG sing N N 310 PRO CB HB2 sing N N 311 PRO CB HB3 sing N N 312 PRO CG CD sing N N 313 PRO CG HG2 sing N N 314 PRO CG HG3 sing N N 315 PRO CD HD2 sing N N 316 PRO CD HD3 sing N N 317 PRO OXT HXT sing N N 318 SER N CA sing N N 319 SER N H sing N N 320 SER N H2 sing N N 321 SER CA C sing N N 322 SER CA CB sing N N 323 SER CA HA sing N N 324 SER C O doub N N 325 SER C OXT sing N N 326 SER CB OG sing N N 327 SER CB HB2 sing N N 328 SER CB HB3 sing N N 329 SER OG HG sing N N 330 SER OXT HXT sing N N 331 THR N CA sing N N 332 THR N H sing N N 333 THR N H2 sing N N 334 THR CA C sing N N 335 THR CA CB sing N N 336 THR CA HA sing N N 337 THR C O doub N N 338 THR C OXT sing N N 339 THR CB OG1 sing N N 340 THR CB CG2 sing N N 341 THR CB HB sing N N 342 THR OG1 HG1 sing N N 343 THR CG2 HG21 sing N N 344 THR CG2 HG22 sing N N 345 THR CG2 HG23 sing N N 346 THR OXT HXT sing N N 347 TRP N CA sing N N 348 TRP N H sing N N 349 TRP N H2 sing N N 350 TRP CA C sing N N 351 TRP CA CB sing N N 352 TRP CA HA sing N N 353 TRP C O doub N N 354 TRP C OXT sing N N 355 TRP CB CG sing N N 356 TRP CB HB2 sing N N 357 TRP CB HB3 sing N N 358 TRP CG CD1 doub Y N 359 TRP CG CD2 sing Y N 360 TRP CD1 NE1 sing Y N 361 TRP CD1 HD1 sing N N 362 TRP CD2 CE2 doub Y N 363 TRP CD2 CE3 sing Y N 364 TRP NE1 CE2 sing Y N 365 TRP NE1 HE1 sing N N 366 TRP CE2 CZ2 sing Y N 367 TRP CE3 CZ3 doub Y N 368 TRP CE3 HE3 sing N N 369 TRP CZ2 CH2 doub Y N 370 TRP CZ2 HZ2 sing N N 371 TRP CZ3 CH2 sing Y N 372 TRP CZ3 HZ3 sing N N 373 TRP CH2 HH2 sing N N 374 TRP OXT HXT sing N N 375 TYR N CA sing N N 376 TYR N H sing N N 377 TYR N H2 sing N N 378 TYR CA C sing N N 379 TYR CA CB sing N N 380 TYR CA HA sing N N 381 TYR C O doub N N 382 TYR C OXT sing N N 383 TYR CB CG sing N N 384 TYR CB HB2 sing N N 385 TYR CB HB3 sing N N 386 TYR CG CD1 doub Y N 387 TYR CG CD2 sing Y N 388 TYR CD1 CE1 sing Y N 389 TYR CD1 HD1 sing N N 390 TYR CD2 CE2 doub Y N 391 TYR CD2 HD2 sing N N 392 TYR CE1 CZ doub Y N 393 TYR CE1 HE1 sing N N 394 TYR CE2 CZ sing Y N 395 TYR CE2 HE2 sing N N 396 TYR CZ OH sing N N 397 TYR OH HH sing N N 398 TYR OXT HXT sing N N 399 VAL N CA sing N N 400 VAL N H sing N N 401 VAL N H2 sing N N 402 VAL CA C sing N N 403 VAL CA CB sing N N 404 VAL CA HA sing N N 405 VAL C O doub N N 406 VAL C OXT sing N N 407 VAL CB CG1 sing N N 408 VAL CB CG2 sing N N 409 VAL CB HB sing N N 410 VAL CG1 HG11 sing N N 411 VAL CG1 HG12 sing N N 412 VAL CG1 HG13 sing N N 413 VAL CG2 HG21 sing N N 414 VAL CG2 HG22 sing N N 415 VAL CG2 HG23 sing N N 416 VAL OXT HXT sing N N 417 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-DIPHOSPHATE" ADP 3 'MAGNESIUM ION' MG # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5ZCT _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #