data_5ZQA # _entry.id 5ZQA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZQA pdb_00005zqa 10.2210/pdb5zqa/pdb WWPDB D_1300007466 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZQA _pdbx_database_status.recvd_initial_deposition_date 2018-04-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jeong, J.H.' 1 ? 'Kim, Y.G.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Antimicrob. Agents Chemother.' _citation.journal_id_ASTM AMACCQ _citation.journal_id_CSD 0788 _citation.journal_id_ISSN 1098-6596 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structures of Penicillin-Binding Protein D2 from Listeria monocytogenes and Structural Basis for Antibiotic Specificity' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/AAC.00796-18 _citation.pdbx_database_id_PubMed 30082290 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jeong, J.H.' 1 ? primary 'Cha, H.J.' 2 ? primary 'Kim, Y.G.' 3 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5ZQA _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.669 _cell.length_a_esd ? _cell.length_b 74.582 _cell.length_b_esd ? _cell.length_c 74.955 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZQA _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lmo2812 protein' 30091.605 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? 3 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 4 water nat water 18.015 164 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHDYDIPTTENLYFQGAMGSSTEQPNLYLSANAAAVYSVENGEALYEQNADKVMPIASLSKLMTAFLVLEAVDNNE LSWDEKLDLVRLDDPSAVSLYAITQKRTWSVRDLYSAMLTMSANDAAETLGDRLDGADFPKEMNNQAKKLGMSSKTTFVS ASGLDVDGKSAVSTTKDLFLLSSKLISTHPEVLETTSKPTVTTDKGAKLESTNDLLGSIQGLDGLKTGFTDEAGYCFIGT AERGGKRVISIVLDAGTAEKRFKDTEKLMEVGFKED ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHDYDIPTTENLYFQGAMGSSTEQPNLYLSANAAAVYSVENGEALYEQNADKVMPIASLSKLMTAFLVLEAVDNNE LSWDEKLDLVRLDDPSAVSLYAITQKRTWSVRDLYSAMLTMSANDAAETLGDRLDGADFPKEMNNQAKKLGMSSKTTFVS ASGLDVDGKSAVSTTKDLFLLSSKLISTHPEVLETTSKPTVTTDKGAKLESTNDLLGSIQGLDGLKTGFTDEAGYCFIGT AERGGKRVISIVLDAGTAEKRFKDTEKLMEVGFKED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 ASP n 1 8 TYR n 1 9 ASP n 1 10 ILE n 1 11 PRO n 1 12 THR n 1 13 THR n 1 14 GLU n 1 15 ASN n 1 16 LEU n 1 17 TYR n 1 18 PHE n 1 19 GLN n 1 20 GLY n 1 21 ALA n 1 22 MET n 1 23 GLY n 1 24 SER n 1 25 SER n 1 26 THR n 1 27 GLU n 1 28 GLN n 1 29 PRO n 1 30 ASN n 1 31 LEU n 1 32 TYR n 1 33 LEU n 1 34 SER n 1 35 ALA n 1 36 ASN n 1 37 ALA n 1 38 ALA n 1 39 ALA n 1 40 VAL n 1 41 TYR n 1 42 SER n 1 43 VAL n 1 44 GLU n 1 45 ASN n 1 46 GLY n 1 47 GLU n 1 48 ALA n 1 49 LEU n 1 50 TYR n 1 51 GLU n 1 52 GLN n 1 53 ASN n 1 54 ALA n 1 55 ASP n 1 56 LYS n 1 57 VAL n 1 58 MET n 1 59 PRO n 1 60 ILE n 1 61 ALA n 1 62 SER n 1 63 LEU n 1 64 SER n 1 65 LYS n 1 66 LEU n 1 67 MET n 1 68 THR n 1 69 ALA n 1 70 PHE n 1 71 LEU n 1 72 VAL n 1 73 LEU n 1 74 GLU n 1 75 ALA n 1 76 VAL n 1 77 ASP n 1 78 ASN n 1 79 ASN n 1 80 GLU n 1 81 LEU n 1 82 SER n 1 83 TRP n 1 84 ASP n 1 85 GLU n 1 86 LYS n 1 87 LEU n 1 88 ASP n 1 89 LEU n 1 90 VAL n 1 91 ARG n 1 92 LEU n 1 93 ASP n 1 94 ASP n 1 95 PRO n 1 96 SER n 1 97 ALA n 1 98 VAL n 1 99 SER n 1 100 LEU n 1 101 TYR n 1 102 ALA n 1 103 ILE n 1 104 THR n 1 105 GLN n 1 106 LYS n 1 107 ARG n 1 108 THR n 1 109 TRP n 1 110 SER n 1 111 VAL n 1 112 ARG n 1 113 ASP n 1 114 LEU n 1 115 TYR n 1 116 SER n 1 117 ALA n 1 118 MET n 1 119 LEU n 1 120 THR n 1 121 MET n 1 122 SER n 1 123 ALA n 1 124 ASN n 1 125 ASP n 1 126 ALA n 1 127 ALA n 1 128 GLU n 1 129 THR n 1 130 LEU n 1 131 GLY n 1 132 ASP n 1 133 ARG n 1 134 LEU n 1 135 ASP n 1 136 GLY n 1 137 ALA n 1 138 ASP n 1 139 PHE n 1 140 PRO n 1 141 LYS n 1 142 GLU n 1 143 MET n 1 144 ASN n 1 145 ASN n 1 146 GLN n 1 147 ALA n 1 148 LYS n 1 149 LYS n 1 150 LEU n 1 151 GLY n 1 152 MET n 1 153 SER n 1 154 SER n 1 155 LYS n 1 156 THR n 1 157 THR n 1 158 PHE n 1 159 VAL n 1 160 SER n 1 161 ALA n 1 162 SER n 1 163 GLY n 1 164 LEU n 1 165 ASP n 1 166 VAL n 1 167 ASP n 1 168 GLY n 1 169 LYS n 1 170 SER n 1 171 ALA n 1 172 VAL n 1 173 SER n 1 174 THR n 1 175 THR n 1 176 LYS n 1 177 ASP n 1 178 LEU n 1 179 PHE n 1 180 LEU n 1 181 LEU n 1 182 SER n 1 183 SER n 1 184 LYS n 1 185 LEU n 1 186 ILE n 1 187 SER n 1 188 THR n 1 189 HIS n 1 190 PRO n 1 191 GLU n 1 192 VAL n 1 193 LEU n 1 194 GLU n 1 195 THR n 1 196 THR n 1 197 SER n 1 198 LYS n 1 199 PRO n 1 200 THR n 1 201 VAL n 1 202 THR n 1 203 THR n 1 204 ASP n 1 205 LYS n 1 206 GLY n 1 207 ALA n 1 208 LYS n 1 209 LEU n 1 210 GLU n 1 211 SER n 1 212 THR n 1 213 ASN n 1 214 ASP n 1 215 LEU n 1 216 LEU n 1 217 GLY n 1 218 SER n 1 219 ILE n 1 220 GLN n 1 221 GLY n 1 222 LEU n 1 223 ASP n 1 224 GLY n 1 225 LEU n 1 226 LYS n 1 227 THR n 1 228 GLY n 1 229 PHE n 1 230 THR n 1 231 ASP n 1 232 GLU n 1 233 ALA n 1 234 GLY n 1 235 TYR n 1 236 CYS n 1 237 PHE n 1 238 ILE n 1 239 GLY n 1 240 THR n 1 241 ALA n 1 242 GLU n 1 243 ARG n 1 244 GLY n 1 245 GLY n 1 246 LYS n 1 247 ARG n 1 248 VAL n 1 249 ILE n 1 250 SER n 1 251 ILE n 1 252 VAL n 1 253 LEU n 1 254 ASP n 1 255 ALA n 1 256 GLY n 1 257 THR n 1 258 ALA n 1 259 GLU n 1 260 LYS n 1 261 ARG n 1 262 PHE n 1 263 LYS n 1 264 ASP n 1 265 THR n 1 266 GLU n 1 267 LYS n 1 268 LEU n 1 269 MET n 1 270 GLU n 1 271 VAL n 1 272 GLY n 1 273 PHE n 1 274 LYS n 1 275 GLU n 1 276 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 276 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene lmo2812 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain EGD-e _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Listeria monocytogenes EGD-e' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 169963 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8Y3M3_LISMO _struct_ref.pdbx_db_accession Q8Y3M3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;STEQPNLYLSANAAAVYSVENGEALYEQNADKVMPIASLSKLMTAFLVLEAVDNNELSWDEKLDLVRLDDPSAVSLYAIT QKRTWSVRDLYSAMLTMSANDAAETLGDRLDGADFPKEMNNQAKKLGMSSKTTFVSASGLDVDGKSAVSTTKDLFLLSSK LISTHPEVLETTSKPTVTTDKGAKLESTNDLLGSIQGLDGLKTGFTDEAGYCFIGTAERGGKRVISIVLDAGTAEKRFKD TEKLMEVGFKED ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ZQA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 25 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 276 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8Y3M3 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 272 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 272 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZQA HIS A 1 ? UNP Q8Y3M3 ? ? 'expression tag' -3 1 1 5ZQA HIS A 2 ? UNP Q8Y3M3 ? ? 'expression tag' -2 2 1 5ZQA HIS A 3 ? UNP Q8Y3M3 ? ? 'expression tag' -1 3 1 5ZQA HIS A 4 ? UNP Q8Y3M3 ? ? 'expression tag' 0 4 1 5ZQA HIS A 5 ? UNP Q8Y3M3 ? ? 'expression tag' 1 5 1 5ZQA HIS A 6 ? UNP Q8Y3M3 ? ? 'expression tag' 2 6 1 5ZQA ASP A 7 ? UNP Q8Y3M3 ? ? 'expression tag' 3 7 1 5ZQA TYR A 8 ? UNP Q8Y3M3 ? ? 'expression tag' 4 8 1 5ZQA ASP A 9 ? UNP Q8Y3M3 ? ? 'expression tag' 5 9 1 5ZQA ILE A 10 ? UNP Q8Y3M3 ? ? 'expression tag' 6 10 1 5ZQA PRO A 11 ? UNP Q8Y3M3 ? ? 'expression tag' 7 11 1 5ZQA THR A 12 ? UNP Q8Y3M3 ? ? 'expression tag' 8 12 1 5ZQA THR A 13 ? UNP Q8Y3M3 ? ? 'expression tag' 9 13 1 5ZQA GLU A 14 ? UNP Q8Y3M3 ? ? 'expression tag' 10 14 1 5ZQA ASN A 15 ? UNP Q8Y3M3 ? ? 'expression tag' 11 15 1 5ZQA LEU A 16 ? UNP Q8Y3M3 ? ? 'expression tag' 12 16 1 5ZQA TYR A 17 ? UNP Q8Y3M3 ? ? 'expression tag' 13 17 1 5ZQA PHE A 18 ? UNP Q8Y3M3 ? ? 'expression tag' 14 18 1 5ZQA GLN A 19 ? UNP Q8Y3M3 ? ? 'expression tag' 15 19 1 5ZQA GLY A 20 ? UNP Q8Y3M3 ? ? 'expression tag' 16 20 1 5ZQA ALA A 21 ? UNP Q8Y3M3 ? ? 'expression tag' 17 21 1 5ZQA MET A 22 ? UNP Q8Y3M3 ? ? 'expression tag' 18 22 1 5ZQA GLY A 23 ? UNP Q8Y3M3 ? ? 'expression tag' 19 23 1 5ZQA SER A 24 ? UNP Q8Y3M3 ? ? 'expression tag' 20 24 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZQA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.78 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Potassium chloride, 20%(w/v) Polyethylene glycol 3,350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 200 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-01-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Cryo-cooled channel-cut Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-1A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-1A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 12.61 _reflns.entry_id 5ZQA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.55 _reflns.d_resolution_low 37.291 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 30734 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 0 _reflns.percent_possible_obs 97.83 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_Rmerge_I_obs 0.08823 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.09664 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.55 _reflns_shell.d_res_low 1.605 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2508 _reflns_shell.percent_possible_all 81.09 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.3248 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.861 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZQA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.550 _refine.ls_d_res_low 37.291 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 30733 _refine.ls_number_reflns_R_free 1998 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.82 _refine.ls_percent_reflns_R_free 6.50 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1660 _refine.ls_R_factor_R_free 0.1885 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1645 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3it9 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 16.66 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.12 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1879 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 164 _refine_hist.number_atoms_total 2053 _refine_hist.d_res_high 1.550 _refine_hist.d_res_low 37.291 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1909 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.010 ? 2577 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.225 ? 706 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 305 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 330 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.5501 1.5888 . . 118 1578 77.00 . . . 0.2150 . 0.1725 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5888 1.6318 . . 135 1971 94.00 . . . 0.1897 . 0.1518 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6318 1.6798 . . 142 2031 99.00 . . . 0.1948 . 0.1487 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6798 1.7340 . . 145 2069 100.00 . . . 0.1990 . 0.1577 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7340 1.7960 . . 145 2065 100.00 . . . 0.2190 . 0.1551 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7960 1.8679 . . 143 2075 100.00 . . . 0.1781 . 0.1619 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8679 1.9529 . . 143 2064 100.00 . . . 0.1862 . 0.1605 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9529 2.0559 . . 143 2070 100.00 . . . 0.1766 . 0.1571 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0559 2.1847 . . 147 2090 100.00 . . . 0.1652 . 0.1541 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1847 2.3533 . . 141 2116 100.00 . . . 0.1751 . 0.1610 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3533 2.5901 . . 145 2092 100.00 . . . 0.1976 . 0.1841 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5901 2.9648 . . 143 2120 100.00 . . . 0.2004 . 0.1824 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9648 3.7347 . . 151 2143 100.00 . . . 0.2068 . 0.1683 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7347 37.3018 . . 157 2251 100.00 . . . 0.1730 . 0.1593 . . . . . . . . . . # _struct.entry_id 5ZQA _struct.title 'Crystal Structure of Penicillin-Binding Protein D2 from Listeria monocytogenes in the apo form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZQA _struct_keywords.text 'Listeria monocytogenes, hypothetical, penicillin-binding protein, LmPBPD2, lmo2812, ANTIBIOTIC' _struct_keywords.pdbx_keywords ANTIBIOTIC # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 61 ? LEU A 63 ? ALA A 57 LEU A 59 5 ? 3 HELX_P HELX_P2 AA2 SER A 64 ? ASN A 78 ? SER A 60 ASN A 74 1 ? 15 HELX_P HELX_P3 AA3 SER A 99 ? GLN A 105 ? SER A 95 GLN A 101 1 ? 7 HELX_P HELX_P4 AA4 VAL A 111 ? MET A 121 ? VAL A 107 MET A 117 1 ? 11 HELX_P HELX_P5 AA5 ALA A 123 ? GLY A 136 ? ALA A 119 GLY A 132 1 ? 14 HELX_P HELX_P6 AA6 ASP A 138 ? GLY A 151 ? ASP A 134 GLY A 147 1 ? 14 HELX_P HELX_P7 AA7 THR A 174 ? HIS A 189 ? THR A 170 HIS A 185 1 ? 16 HELX_P HELX_P8 AA8 GLU A 191 ? SER A 197 ? GLU A 187 SER A 193 1 ? 7 HELX_P HELX_P9 AA9 THR A 257 ? PHE A 273 ? THR A 253 PHE A 269 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 74 OE1 ? ? ? 1_555 B MG . MG ? ? A GLU 70 A MG 301 1_555 ? ? ? ? ? ? ? 2.142 ? ? metalc2 metalc ? ? A GLU 191 OE2 ? ? ? 1_555 C MG . MG ? ? A GLU 187 A MG 302 1_555 ? ? ? ? ? ? ? 1.892 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 403 3_455 ? ? ? ? ? ? ? 2.181 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 406 1_555 ? ? ? ? ? ? ? 2.113 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 479 1_555 ? ? ? ? ? ? ? 2.077 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 484 1_555 ? ? ? ? ? ? ? 2.140 ? ? metalc7 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 532 1_555 ? ? ? ? ? ? ? 1.962 ? ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 405 1_555 ? ? ? ? ? ? ? 2.042 ? ? metalc9 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 303 A HOH 410 1_555 ? ? ? ? ? ? ? 2.073 ? ? metalc10 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 303 A HOH 427 1_555 ? ? ? ? ? ? ? 2.253 ? ? metalc11 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 303 A HOH 542 1_555 ? ? ? ? ? ? ? 2.229 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 224 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 220 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 LEU _struct_mon_prot_cis.pdbx_label_seq_id_2 225 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 LEU _struct_mon_prot_cis.pdbx_auth_seq_id_2 221 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 9.90 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 48 ? GLN A 52 ? ALA A 44 GLN A 48 AA1 2 ALA A 37 ? SER A 42 ? ALA A 33 SER A 38 AA1 3 LYS A 246 ? ALA A 255 ? LYS A 242 ALA A 251 AA1 4 GLY A 234 ? ARG A 243 ? GLY A 230 ARG A 239 AA1 5 LEU A 222 ? THR A 230 ? LEU A 218 THR A 226 AA2 1 MET A 58 ? PRO A 59 ? MET A 54 PRO A 55 AA2 2 VAL A 172 ? SER A 173 ? VAL A 168 SER A 169 AA3 1 LYS A 86 ? ASP A 88 ? LYS A 82 ASP A 84 AA3 2 THR A 108 ? SER A 110 ? THR A 104 SER A 106 AA4 1 THR A 200 ? THR A 202 ? THR A 196 THR A 198 AA4 2 LYS A 208 ? GLU A 210 ? LYS A 204 GLU A 206 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 49 ? O LEU A 45 N VAL A 40 ? N VAL A 36 AA1 2 3 N ALA A 39 ? N ALA A 35 O ILE A 251 ? O ILE A 247 AA1 3 4 O ALA A 255 ? O ALA A 251 N TYR A 235 ? N TYR A 231 AA1 4 5 O CYS A 236 ? O CYS A 232 N GLY A 228 ? N GLY A 224 AA2 1 2 N MET A 58 ? N MET A 54 O SER A 173 ? O SER A 169 AA3 1 2 N LEU A 87 ? N LEU A 83 O TRP A 109 ? O TRP A 105 AA4 1 2 N VAL A 201 ? N VAL A 197 O LEU A 209 ? O LEU A 205 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 301 ? 6 'binding site for residue MG A 301' AC2 Software A MG 302 ? 5 'binding site for residue MG A 302' AC3 Software A MG 303 ? 3 'binding site for residue MG A 303' AC4 Software A PEG 304 ? 4 'binding site for residue PEG A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 74 ? GLU A 70 . ? 1_555 ? 2 AC1 6 HOH F . ? HOH A 403 . ? 3_455 ? 3 AC1 6 HOH F . ? HOH A 406 . ? 1_555 ? 4 AC1 6 HOH F . ? HOH A 479 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 484 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 532 . ? 1_555 ? 7 AC2 5 ASP A 77 ? ASP A 73 . ? 1_555 ? 8 AC2 5 HIS A 189 ? HIS A 185 . ? 1_555 ? 9 AC2 5 GLU A 191 ? GLU A 187 . ? 1_555 ? 10 AC2 5 LYS A 260 ? LYS A 256 . ? 3_455 ? 11 AC2 5 HOH F . ? HOH A 405 . ? 1_555 ? 12 AC3 3 HOH F . ? HOH A 410 . ? 1_555 ? 13 AC3 3 HOH F . ? HOH A 427 . ? 1_555 ? 14 AC3 3 HOH F . ? HOH A 542 . ? 1_555 ? 15 AC4 4 ARG A 112 ? ARG A 108 . ? 1_555 ? 16 AC4 4 ASP A 204 ? ASP A 200 . ? 1_555 ? 17 AC4 4 HOH F . ? HOH A 455 . ? 1_555 ? 18 AC4 4 HOH F . ? HOH A 490 . ? 1_555 ? # _atom_sites.entry_id 5ZQA _atom_sites.fract_transf_matrix[1][1] 0.026547 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013408 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013341 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -3 ? ? ? A . n A 1 2 HIS 2 -2 ? ? ? A . n A 1 3 HIS 3 -1 ? ? ? A . n A 1 4 HIS 4 0 ? ? ? A . n A 1 5 HIS 5 1 ? ? ? A . n A 1 6 HIS 6 2 ? ? ? A . n A 1 7 ASP 7 3 ? ? ? A . n A 1 8 TYR 8 4 ? ? ? A . n A 1 9 ASP 9 5 ? ? ? A . n A 1 10 ILE 10 6 ? ? ? A . n A 1 11 PRO 11 7 ? ? ? A . n A 1 12 THR 12 8 ? ? ? A . n A 1 13 THR 13 9 ? ? ? A . n A 1 14 GLU 14 10 ? ? ? A . n A 1 15 ASN 15 11 ? ? ? A . n A 1 16 LEU 16 12 ? ? ? A . n A 1 17 TYR 17 13 ? ? ? A . n A 1 18 PHE 18 14 ? ? ? A . n A 1 19 GLN 19 15 ? ? ? A . n A 1 20 GLY 20 16 ? ? ? A . n A 1 21 ALA 21 17 ? ? ? A . n A 1 22 MET 22 18 ? ? ? A . n A 1 23 GLY 23 19 ? ? ? A . n A 1 24 SER 24 20 ? ? ? A . n A 1 25 SER 25 21 ? ? ? A . n A 1 26 THR 26 22 ? ? ? A . n A 1 27 GLU 27 23 23 GLU GLU A . n A 1 28 GLN 28 24 24 GLN GLN A . n A 1 29 PRO 29 25 25 PRO PRO A . n A 1 30 ASN 30 26 26 ASN ASN A . n A 1 31 LEU 31 27 27 LEU LEU A . n A 1 32 TYR 32 28 28 TYR TYR A . n A 1 33 LEU 33 29 29 LEU LEU A . n A 1 34 SER 34 30 30 SER SER A . n A 1 35 ALA 35 31 31 ALA ALA A . n A 1 36 ASN 36 32 32 ASN ASN A . n A 1 37 ALA 37 33 33 ALA ALA A . n A 1 38 ALA 38 34 34 ALA ALA A . n A 1 39 ALA 39 35 35 ALA ALA A . n A 1 40 VAL 40 36 36 VAL VAL A . n A 1 41 TYR 41 37 37 TYR TYR A . n A 1 42 SER 42 38 38 SER SER A . n A 1 43 VAL 43 39 39 VAL VAL A . n A 1 44 GLU 44 40 40 GLU GLU A . n A 1 45 ASN 45 41 41 ASN ASN A . n A 1 46 GLY 46 42 42 GLY GLY A . n A 1 47 GLU 47 43 43 GLU GLU A . n A 1 48 ALA 48 44 44 ALA ALA A . n A 1 49 LEU 49 45 45 LEU LEU A . n A 1 50 TYR 50 46 46 TYR TYR A . n A 1 51 GLU 51 47 47 GLU GLU A . n A 1 52 GLN 52 48 48 GLN GLN A . n A 1 53 ASN 53 49 49 ASN ASN A . n A 1 54 ALA 54 50 50 ALA ALA A . n A 1 55 ASP 55 51 51 ASP ASP A . n A 1 56 LYS 56 52 52 LYS LYS A . n A 1 57 VAL 57 53 53 VAL VAL A . n A 1 58 MET 58 54 54 MET MET A . n A 1 59 PRO 59 55 55 PRO PRO A . n A 1 60 ILE 60 56 56 ILE ILE A . n A 1 61 ALA 61 57 57 ALA ALA A . n A 1 62 SER 62 58 58 SER SER A . n A 1 63 LEU 63 59 59 LEU LEU A . n A 1 64 SER 64 60 60 SER SER A . n A 1 65 LYS 65 61 61 LYS LYS A . n A 1 66 LEU 66 62 62 LEU LEU A . n A 1 67 MET 67 63 63 MET MET A . n A 1 68 THR 68 64 64 THR THR A . n A 1 69 ALA 69 65 65 ALA ALA A . n A 1 70 PHE 70 66 66 PHE PHE A . n A 1 71 LEU 71 67 67 LEU LEU A . n A 1 72 VAL 72 68 68 VAL VAL A . n A 1 73 LEU 73 69 69 LEU LEU A . n A 1 74 GLU 74 70 70 GLU GLU A . n A 1 75 ALA 75 71 71 ALA ALA A . n A 1 76 VAL 76 72 72 VAL VAL A . n A 1 77 ASP 77 73 73 ASP ASP A . n A 1 78 ASN 78 74 74 ASN ASN A . n A 1 79 ASN 79 75 75 ASN ASN A . n A 1 80 GLU 80 76 76 GLU GLU A . n A 1 81 LEU 81 77 77 LEU LEU A . n A 1 82 SER 82 78 78 SER SER A . n A 1 83 TRP 83 79 79 TRP TRP A . n A 1 84 ASP 84 80 80 ASP ASP A . n A 1 85 GLU 85 81 81 GLU GLU A . n A 1 86 LYS 86 82 82 LYS LYS A . n A 1 87 LEU 87 83 83 LEU LEU A . n A 1 88 ASP 88 84 84 ASP ASP A . n A 1 89 LEU 89 85 85 LEU LEU A . n A 1 90 VAL 90 86 86 VAL VAL A . n A 1 91 ARG 91 87 87 ARG ARG A . n A 1 92 LEU 92 88 88 LEU LEU A . n A 1 93 ASP 93 89 89 ASP ASP A . n A 1 94 ASP 94 90 90 ASP ASP A . n A 1 95 PRO 95 91 91 PRO PRO A . n A 1 96 SER 96 92 92 SER SER A . n A 1 97 ALA 97 93 93 ALA ALA A . n A 1 98 VAL 98 94 94 VAL VAL A . n A 1 99 SER 99 95 95 SER SER A . n A 1 100 LEU 100 96 96 LEU LEU A . n A 1 101 TYR 101 97 97 TYR TYR A . n A 1 102 ALA 102 98 98 ALA ALA A . n A 1 103 ILE 103 99 99 ILE ILE A . n A 1 104 THR 104 100 100 THR THR A . n A 1 105 GLN 105 101 101 GLN GLN A . n A 1 106 LYS 106 102 102 LYS LYS A . n A 1 107 ARG 107 103 103 ARG ARG A . n A 1 108 THR 108 104 104 THR THR A . n A 1 109 TRP 109 105 105 TRP TRP A . n A 1 110 SER 110 106 106 SER SER A . n A 1 111 VAL 111 107 107 VAL VAL A . n A 1 112 ARG 112 108 108 ARG ARG A . n A 1 113 ASP 113 109 109 ASP ASP A . n A 1 114 LEU 114 110 110 LEU LEU A . n A 1 115 TYR 115 111 111 TYR TYR A . n A 1 116 SER 116 112 112 SER SER A . n A 1 117 ALA 117 113 113 ALA ALA A . n A 1 118 MET 118 114 114 MET MET A . n A 1 119 LEU 119 115 115 LEU LEU A . n A 1 120 THR 120 116 116 THR THR A . n A 1 121 MET 121 117 117 MET MET A . n A 1 122 SER 122 118 118 SER SER A . n A 1 123 ALA 123 119 119 ALA ALA A . n A 1 124 ASN 124 120 120 ASN ASN A . n A 1 125 ASP 125 121 121 ASP ASP A . n A 1 126 ALA 126 122 122 ALA ALA A . n A 1 127 ALA 127 123 123 ALA ALA A . n A 1 128 GLU 128 124 124 GLU GLU A . n A 1 129 THR 129 125 125 THR THR A . n A 1 130 LEU 130 126 126 LEU LEU A . n A 1 131 GLY 131 127 127 GLY GLY A . n A 1 132 ASP 132 128 128 ASP ASP A . n A 1 133 ARG 133 129 129 ARG ARG A . n A 1 134 LEU 134 130 130 LEU LEU A . n A 1 135 ASP 135 131 131 ASP ASP A . n A 1 136 GLY 136 132 132 GLY GLY A . n A 1 137 ALA 137 133 133 ALA ALA A . n A 1 138 ASP 138 134 134 ASP ASP A . n A 1 139 PHE 139 135 135 PHE PHE A . n A 1 140 PRO 140 136 136 PRO PRO A . n A 1 141 LYS 141 137 137 LYS LYS A . n A 1 142 GLU 142 138 138 GLU GLU A . n A 1 143 MET 143 139 139 MET MET A . n A 1 144 ASN 144 140 140 ASN ASN A . n A 1 145 ASN 145 141 141 ASN ASN A . n A 1 146 GLN 146 142 142 GLN GLN A . n A 1 147 ALA 147 143 143 ALA ALA A . n A 1 148 LYS 148 144 144 LYS LYS A . n A 1 149 LYS 149 145 145 LYS LYS A . n A 1 150 LEU 150 146 146 LEU LEU A . n A 1 151 GLY 151 147 147 GLY GLY A . n A 1 152 MET 152 148 148 MET MET A . n A 1 153 SER 153 149 149 SER SER A . n A 1 154 SER 154 150 150 SER SER A . n A 1 155 LYS 155 151 151 LYS LYS A . n A 1 156 THR 156 152 152 THR THR A . n A 1 157 THR 157 153 153 THR THR A . n A 1 158 PHE 158 154 154 PHE PHE A . n A 1 159 VAL 159 155 155 VAL VAL A . n A 1 160 SER 160 156 156 SER SER A . n A 1 161 ALA 161 157 157 ALA ALA A . n A 1 162 SER 162 158 158 SER SER A . n A 1 163 GLY 163 159 159 GLY GLY A . n A 1 164 LEU 164 160 160 LEU LEU A . n A 1 165 ASP 165 161 161 ASP ASP A . n A 1 166 VAL 166 162 162 VAL VAL A . n A 1 167 ASP 167 163 163 ASP ASP A . n A 1 168 GLY 168 164 164 GLY GLY A . n A 1 169 LYS 169 165 165 LYS LYS A . n A 1 170 SER 170 166 166 SER SER A . n A 1 171 ALA 171 167 167 ALA ALA A . n A 1 172 VAL 172 168 168 VAL VAL A . n A 1 173 SER 173 169 169 SER SER A . n A 1 174 THR 174 170 170 THR THR A . n A 1 175 THR 175 171 171 THR THR A . n A 1 176 LYS 176 172 172 LYS LYS A . n A 1 177 ASP 177 173 173 ASP ASP A . n A 1 178 LEU 178 174 174 LEU LEU A . n A 1 179 PHE 179 175 175 PHE PHE A . n A 1 180 LEU 180 176 176 LEU LEU A . n A 1 181 LEU 181 177 177 LEU LEU A . n A 1 182 SER 182 178 178 SER SER A . n A 1 183 SER 183 179 179 SER SER A . n A 1 184 LYS 184 180 180 LYS LYS A . n A 1 185 LEU 185 181 181 LEU LEU A . n A 1 186 ILE 186 182 182 ILE ILE A . n A 1 187 SER 187 183 183 SER SER A . n A 1 188 THR 188 184 184 THR THR A . n A 1 189 HIS 189 185 185 HIS HIS A . n A 1 190 PRO 190 186 186 PRO PRO A . n A 1 191 GLU 191 187 187 GLU GLU A . n A 1 192 VAL 192 188 188 VAL VAL A . n A 1 193 LEU 193 189 189 LEU LEU A . n A 1 194 GLU 194 190 190 GLU GLU A . n A 1 195 THR 195 191 191 THR THR A . n A 1 196 THR 196 192 192 THR THR A . n A 1 197 SER 197 193 193 SER SER A . n A 1 198 LYS 198 194 194 LYS LYS A . n A 1 199 PRO 199 195 195 PRO PRO A . n A 1 200 THR 200 196 196 THR THR A . n A 1 201 VAL 201 197 197 VAL VAL A . n A 1 202 THR 202 198 198 THR THR A . n A 1 203 THR 203 199 199 THR THR A . n A 1 204 ASP 204 200 200 ASP ASP A . n A 1 205 LYS 205 201 201 LYS LYS A . n A 1 206 GLY 206 202 202 GLY GLY A . n A 1 207 ALA 207 203 203 ALA ALA A . n A 1 208 LYS 208 204 204 LYS LYS A . n A 1 209 LEU 209 205 205 LEU LEU A . n A 1 210 GLU 210 206 206 GLU GLU A . n A 1 211 SER 211 207 207 SER SER A . n A 1 212 THR 212 208 208 THR THR A . n A 1 213 ASN 213 209 209 ASN ASN A . n A 1 214 ASP 214 210 210 ASP ASP A . n A 1 215 LEU 215 211 211 LEU LEU A . n A 1 216 LEU 216 212 212 LEU LEU A . n A 1 217 GLY 217 213 213 GLY GLY A . n A 1 218 SER 218 214 214 SER SER A . n A 1 219 ILE 219 215 215 ILE ILE A . n A 1 220 GLN 220 216 216 GLN GLN A . n A 1 221 GLY 221 217 217 GLY GLY A . n A 1 222 LEU 222 218 218 LEU LEU A . n A 1 223 ASP 223 219 219 ASP ASP A . n A 1 224 GLY 224 220 220 GLY GLY A . n A 1 225 LEU 225 221 221 LEU LEU A . n A 1 226 LYS 226 222 222 LYS LYS A . n A 1 227 THR 227 223 223 THR THR A . n A 1 228 GLY 228 224 224 GLY GLY A . n A 1 229 PHE 229 225 225 PHE PHE A . n A 1 230 THR 230 226 226 THR THR A . n A 1 231 ASP 231 227 227 ASP ASP A . n A 1 232 GLU 232 228 228 GLU GLU A . n A 1 233 ALA 233 229 229 ALA ALA A . n A 1 234 GLY 234 230 230 GLY GLY A . n A 1 235 TYR 235 231 231 TYR TYR A . n A 1 236 CYS 236 232 232 CYS CYS A . n A 1 237 PHE 237 233 233 PHE PHE A . n A 1 238 ILE 238 234 234 ILE ILE A . n A 1 239 GLY 239 235 235 GLY GLY A . n A 1 240 THR 240 236 236 THR THR A . n A 1 241 ALA 241 237 237 ALA ALA A . n A 1 242 GLU 242 238 238 GLU GLU A . n A 1 243 ARG 243 239 239 ARG ARG A . n A 1 244 GLY 244 240 240 GLY GLY A . n A 1 245 GLY 245 241 241 GLY GLY A . n A 1 246 LYS 246 242 242 LYS LYS A . n A 1 247 ARG 247 243 243 ARG ARG A . n A 1 248 VAL 248 244 244 VAL VAL A . n A 1 249 ILE 249 245 245 ILE ILE A . n A 1 250 SER 250 246 246 SER SER A . n A 1 251 ILE 251 247 247 ILE ILE A . n A 1 252 VAL 252 248 248 VAL VAL A . n A 1 253 LEU 253 249 249 LEU LEU A . n A 1 254 ASP 254 250 250 ASP ASP A . n A 1 255 ALA 255 251 251 ALA ALA A . n A 1 256 GLY 256 252 252 GLY GLY A . n A 1 257 THR 257 253 253 THR THR A . n A 1 258 ALA 258 254 254 ALA ALA A . n A 1 259 GLU 259 255 255 GLU GLU A . n A 1 260 LYS 260 256 256 LYS LYS A . n A 1 261 ARG 261 257 257 ARG ARG A . n A 1 262 PHE 262 258 258 PHE PHE A . n A 1 263 LYS 263 259 259 LYS LYS A . n A 1 264 ASP 264 260 260 ASP ASP A . n A 1 265 THR 265 261 261 THR THR A . n A 1 266 GLU 266 262 262 GLU GLU A . n A 1 267 LYS 267 263 263 LYS LYS A . n A 1 268 LEU 268 264 264 LEU LEU A . n A 1 269 MET 269 265 265 MET MET A . n A 1 270 GLU 270 266 266 GLU GLU A . n A 1 271 VAL 271 267 267 VAL VAL A . n A 1 272 GLY 272 268 268 GLY GLY A . n A 1 273 PHE 273 269 269 PHE PHE A . n A 1 274 LYS 274 270 270 LYS LYS A . n A 1 275 GLU 275 271 ? ? ? A . n A 1 276 ASP 276 272 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 1 MG MG A . C 2 MG 1 302 2 MG MG A . D 2 MG 1 303 3 MG MG A . E 3 PEG 1 304 1 PEG PEG A . F 4 HOH 1 401 155 HOH HOH A . F 4 HOH 2 402 139 HOH HOH A . F 4 HOH 3 403 153 HOH HOH A . F 4 HOH 4 404 132 HOH HOH A . F 4 HOH 5 405 5 HOH HOH A . F 4 HOH 6 406 128 HOH HOH A . F 4 HOH 7 407 120 HOH HOH A . F 4 HOH 8 408 158 HOH HOH A . F 4 HOH 9 409 156 HOH HOH A . F 4 HOH 10 410 140 HOH HOH A . F 4 HOH 11 411 148 HOH HOH A . F 4 HOH 12 412 136 HOH HOH A . F 4 HOH 13 413 71 HOH HOH A . F 4 HOH 14 414 135 HOH HOH A . F 4 HOH 15 415 72 HOH HOH A . F 4 HOH 16 416 21 HOH HOH A . F 4 HOH 17 417 162 HOH HOH A . F 4 HOH 18 418 1 HOH HOH A . F 4 HOH 19 419 34 HOH HOH A . F 4 HOH 20 420 26 HOH HOH A . F 4 HOH 21 421 19 HOH HOH A . F 4 HOH 22 422 164 HOH HOH A . F 4 HOH 23 423 23 HOH HOH A . F 4 HOH 24 424 10 HOH HOH A . F 4 HOH 25 425 3 HOH HOH A . F 4 HOH 26 426 147 HOH HOH A . F 4 HOH 27 427 134 HOH HOH A . F 4 HOH 28 428 152 HOH HOH A . F 4 HOH 29 429 11 HOH HOH A . F 4 HOH 30 430 13 HOH HOH A . F 4 HOH 31 431 118 HOH HOH A . F 4 HOH 32 432 106 HOH HOH A . F 4 HOH 33 433 74 HOH HOH A . F 4 HOH 34 434 111 HOH HOH A . F 4 HOH 35 435 14 HOH HOH A . F 4 HOH 36 436 47 HOH HOH A . F 4 HOH 37 437 146 HOH HOH A . F 4 HOH 38 438 101 HOH HOH A . F 4 HOH 39 439 110 HOH HOH A . F 4 HOH 40 440 115 HOH HOH A . F 4 HOH 41 441 22 HOH HOH A . F 4 HOH 42 442 67 HOH HOH A . F 4 HOH 43 443 9 HOH HOH A . F 4 HOH 44 444 30 HOH HOH A . F 4 HOH 45 445 89 HOH HOH A . F 4 HOH 46 446 56 HOH HOH A . F 4 HOH 47 447 77 HOH HOH A . F 4 HOH 48 448 51 HOH HOH A . F 4 HOH 49 449 159 HOH HOH A . F 4 HOH 50 450 65 HOH HOH A . F 4 HOH 51 451 7 HOH HOH A . F 4 HOH 52 452 76 HOH HOH A . F 4 HOH 53 453 28 HOH HOH A . F 4 HOH 54 454 144 HOH HOH A . F 4 HOH 55 455 17 HOH HOH A . F 4 HOH 56 456 97 HOH HOH A . F 4 HOH 57 457 44 HOH HOH A . F 4 HOH 58 458 63 HOH HOH A . F 4 HOH 59 459 88 HOH HOH A . F 4 HOH 60 460 113 HOH HOH A . F 4 HOH 61 461 6 HOH HOH A . F 4 HOH 62 462 127 HOH HOH A . F 4 HOH 63 463 96 HOH HOH A . F 4 HOH 64 464 85 HOH HOH A . F 4 HOH 65 465 125 HOH HOH A . F 4 HOH 66 466 8 HOH HOH A . F 4 HOH 67 467 79 HOH HOH A . F 4 HOH 68 468 4 HOH HOH A . F 4 HOH 69 469 18 HOH HOH A . F 4 HOH 70 470 49 HOH HOH A . F 4 HOH 71 471 83 HOH HOH A . F 4 HOH 72 472 95 HOH HOH A . F 4 HOH 73 473 145 HOH HOH A . F 4 HOH 74 474 16 HOH HOH A . F 4 HOH 75 475 57 HOH HOH A . F 4 HOH 76 476 92 HOH HOH A . F 4 HOH 77 477 108 HOH HOH A . F 4 HOH 78 478 45 HOH HOH A . F 4 HOH 79 479 138 HOH HOH A . F 4 HOH 80 480 50 HOH HOH A . F 4 HOH 81 481 112 HOH HOH A . F 4 HOH 82 482 41 HOH HOH A . F 4 HOH 83 483 48 HOH HOH A . F 4 HOH 84 484 129 HOH HOH A . F 4 HOH 85 485 61 HOH HOH A . F 4 HOH 86 486 103 HOH HOH A . F 4 HOH 87 487 87 HOH HOH A . F 4 HOH 88 488 154 HOH HOH A . F 4 HOH 89 489 151 HOH HOH A . F 4 HOH 90 490 117 HOH HOH A . F 4 HOH 91 491 105 HOH HOH A . F 4 HOH 92 492 15 HOH HOH A . F 4 HOH 93 493 42 HOH HOH A . F 4 HOH 94 494 20 HOH HOH A . F 4 HOH 95 495 29 HOH HOH A . F 4 HOH 96 496 58 HOH HOH A . F 4 HOH 97 497 54 HOH HOH A . F 4 HOH 98 498 93 HOH HOH A . F 4 HOH 99 499 100 HOH HOH A . F 4 HOH 100 500 119 HOH HOH A . F 4 HOH 101 501 149 HOH HOH A . F 4 HOH 102 502 124 HOH HOH A . F 4 HOH 103 503 39 HOH HOH A . F 4 HOH 104 504 160 HOH HOH A . F 4 HOH 105 505 73 HOH HOH A . F 4 HOH 106 506 75 HOH HOH A . F 4 HOH 107 507 130 HOH HOH A . F 4 HOH 108 508 114 HOH HOH A . F 4 HOH 109 509 104 HOH HOH A . F 4 HOH 110 510 60 HOH HOH A . F 4 HOH 111 511 82 HOH HOH A . F 4 HOH 112 512 81 HOH HOH A . F 4 HOH 113 513 68 HOH HOH A . F 4 HOH 114 514 37 HOH HOH A . F 4 HOH 115 515 2 HOH HOH A . F 4 HOH 116 516 142 HOH HOH A . F 4 HOH 117 517 35 HOH HOH A . F 4 HOH 118 518 84 HOH HOH A . F 4 HOH 119 519 150 HOH HOH A . F 4 HOH 120 520 38 HOH HOH A . F 4 HOH 121 521 66 HOH HOH A . F 4 HOH 122 522 86 HOH HOH A . F 4 HOH 123 523 126 HOH HOH A . F 4 HOH 124 524 31 HOH HOH A . F 4 HOH 125 525 99 HOH HOH A . F 4 HOH 126 526 157 HOH HOH A . F 4 HOH 127 527 131 HOH HOH A . F 4 HOH 128 528 25 HOH HOH A . F 4 HOH 129 529 40 HOH HOH A . F 4 HOH 130 530 55 HOH HOH A . F 4 HOH 131 531 64 HOH HOH A . F 4 HOH 132 532 143 HOH HOH A . F 4 HOH 133 533 12 HOH HOH A . F 4 HOH 134 534 78 HOH HOH A . F 4 HOH 135 535 24 HOH HOH A . F 4 HOH 136 536 90 HOH HOH A . F 4 HOH 137 537 109 HOH HOH A . F 4 HOH 138 538 116 HOH HOH A . F 4 HOH 139 539 52 HOH HOH A . F 4 HOH 140 540 98 HOH HOH A . F 4 HOH 141 541 62 HOH HOH A . F 4 HOH 142 542 163 HOH HOH A . F 4 HOH 143 543 121 HOH HOH A . F 4 HOH 144 544 123 HOH HOH A . F 4 HOH 145 545 122 HOH HOH A . F 4 HOH 146 546 94 HOH HOH A . F 4 HOH 147 547 91 HOH HOH A . F 4 HOH 148 548 133 HOH HOH A . F 4 HOH 149 549 80 HOH HOH A . F 4 HOH 150 550 161 HOH HOH A . F 4 HOH 151 551 137 HOH HOH A . F 4 HOH 152 552 141 HOH HOH A . F 4 HOH 153 553 59 HOH HOH A . F 4 HOH 154 554 69 HOH HOH A . F 4 HOH 155 555 70 HOH HOH A . F 4 HOH 156 556 43 HOH HOH A . F 4 HOH 157 557 107 HOH HOH A . F 4 HOH 158 558 27 HOH HOH A . F 4 HOH 159 559 33 HOH HOH A . F 4 HOH 160 560 53 HOH HOH A . F 4 HOH 161 561 36 HOH HOH A . F 4 HOH 162 562 46 HOH HOH A . F 4 HOH 163 563 102 HOH HOH A . F 4 HOH 164 564 32 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 80 ? 1 MORE -7 ? 1 'SSA (A^2)' 10930 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 74 ? A GLU 70 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 403 ? 3_455 175.6 ? 2 OE1 ? A GLU 74 ? A GLU 70 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 406 ? 1_555 86.3 ? 3 O ? F HOH . ? A HOH 403 ? 3_455 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 406 ? 1_555 90.2 ? 4 OE1 ? A GLU 74 ? A GLU 70 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 479 ? 1_555 83.7 ? 5 O ? F HOH . ? A HOH 403 ? 3_455 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 479 ? 1_555 94.0 ? 6 O ? F HOH . ? A HOH 406 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 479 ? 1_555 94.8 ? 7 OE1 ? A GLU 74 ? A GLU 70 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 484 ? 1_555 91.3 ? 8 O ? F HOH . ? A HOH 403 ? 3_455 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 484 ? 1_555 91.3 ? 9 O ? F HOH . ? A HOH 406 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 484 ? 1_555 89.1 ? 10 O ? F HOH . ? A HOH 479 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 484 ? 1_555 173.4 ? 11 OE1 ? A GLU 74 ? A GLU 70 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 532 ? 1_555 93.1 ? 12 O ? F HOH . ? A HOH 403 ? 3_455 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 532 ? 1_555 90.6 ? 13 O ? F HOH . ? A HOH 406 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 532 ? 1_555 177.3 ? 14 O ? F HOH . ? A HOH 479 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 532 ? 1_555 87.8 ? 15 O ? F HOH . ? A HOH 484 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 532 ? 1_555 88.2 ? 16 OE2 ? A GLU 191 ? A GLU 187 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 97.2 ? 17 O ? F HOH . ? A HOH 410 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 427 ? 1_555 82.6 ? 18 O ? F HOH . ? A HOH 410 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 542 ? 1_555 169.2 ? 19 O ? F HOH . ? A HOH 427 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 542 ? 1_555 89.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-07-25 2 'Structure model' 1 1 2018-08-22 3 'Structure model' 1 2 2018-09-12 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.pdbx_database_id_DOI' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.title' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1690 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 57 ? ? 50.22 -128.93 2 1 ASP A 131 ? ? -147.78 17.02 3 1 SER A 169 ? ? -163.78 -168.12 4 1 LEU A 221 ? ? -132.36 -49.83 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS -3 ? A HIS 1 2 1 Y 1 A HIS -2 ? A HIS 2 3 1 Y 1 A HIS -1 ? A HIS 3 4 1 Y 1 A HIS 0 ? A HIS 4 5 1 Y 1 A HIS 1 ? A HIS 5 6 1 Y 1 A HIS 2 ? A HIS 6 7 1 Y 1 A ASP 3 ? A ASP 7 8 1 Y 1 A TYR 4 ? A TYR 8 9 1 Y 1 A ASP 5 ? A ASP 9 10 1 Y 1 A ILE 6 ? A ILE 10 11 1 Y 1 A PRO 7 ? A PRO 11 12 1 Y 1 A THR 8 ? A THR 12 13 1 Y 1 A THR 9 ? A THR 13 14 1 Y 1 A GLU 10 ? A GLU 14 15 1 Y 1 A ASN 11 ? A ASN 15 16 1 Y 1 A LEU 12 ? A LEU 16 17 1 Y 1 A TYR 13 ? A TYR 17 18 1 Y 1 A PHE 14 ? A PHE 18 19 1 Y 1 A GLN 15 ? A GLN 19 20 1 Y 1 A GLY 16 ? A GLY 20 21 1 Y 1 A ALA 17 ? A ALA 21 22 1 Y 1 A MET 18 ? A MET 22 23 1 Y 1 A GLY 19 ? A GLY 23 24 1 Y 1 A SER 20 ? A SER 24 25 1 Y 1 A SER 21 ? A SER 25 26 1 Y 1 A THR 22 ? A THR 26 27 1 Y 1 A GLU 271 ? A GLU 275 28 1 Y 1 A ASP 272 ? A ASP 276 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MG MG MG N N 250 PEG C1 C N N 251 PEG O1 O N N 252 PEG C2 C N N 253 PEG O2 O N N 254 PEG C3 C N N 255 PEG C4 C N N 256 PEG O4 O N N 257 PEG H11 H N N 258 PEG H12 H N N 259 PEG HO1 H N N 260 PEG H21 H N N 261 PEG H22 H N N 262 PEG H31 H N N 263 PEG H32 H N N 264 PEG H41 H N N 265 PEG H42 H N N 266 PEG HO4 H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PEG C1 O1 sing N N 237 PEG C1 C2 sing N N 238 PEG C1 H11 sing N N 239 PEG C1 H12 sing N N 240 PEG O1 HO1 sing N N 241 PEG C2 O2 sing N N 242 PEG C2 H21 sing N N 243 PEG C2 H22 sing N N 244 PEG O2 C3 sing N N 245 PEG C3 C4 sing N N 246 PEG C3 H31 sing N N 247 PEG C3 H32 sing N N 248 PEG C4 O4 sing N N 249 PEG C4 H41 sing N N 250 PEG C4 H42 sing N N 251 PEG O4 HO4 sing N N 252 PHE N CA sing N N 253 PHE N H sing N N 254 PHE N H2 sing N N 255 PHE CA C sing N N 256 PHE CA CB sing N N 257 PHE CA HA sing N N 258 PHE C O doub N N 259 PHE C OXT sing N N 260 PHE CB CG sing N N 261 PHE CB HB2 sing N N 262 PHE CB HB3 sing N N 263 PHE CG CD1 doub Y N 264 PHE CG CD2 sing Y N 265 PHE CD1 CE1 sing Y N 266 PHE CD1 HD1 sing N N 267 PHE CD2 CE2 doub Y N 268 PHE CD2 HD2 sing N N 269 PHE CE1 CZ doub Y N 270 PHE CE1 HE1 sing N N 271 PHE CE2 CZ sing Y N 272 PHE CE2 HE2 sing N N 273 PHE CZ HZ sing N N 274 PHE OXT HXT sing N N 275 PRO N CA sing N N 276 PRO N CD sing N N 277 PRO N H sing N N 278 PRO CA C sing N N 279 PRO CA CB sing N N 280 PRO CA HA sing N N 281 PRO C O doub N N 282 PRO C OXT sing N N 283 PRO CB CG sing N N 284 PRO CB HB2 sing N N 285 PRO CB HB3 sing N N 286 PRO CG CD sing N N 287 PRO CG HG2 sing N N 288 PRO CG HG3 sing N N 289 PRO CD HD2 sing N N 290 PRO CD HD3 sing N N 291 PRO OXT HXT sing N N 292 SER N CA sing N N 293 SER N H sing N N 294 SER N H2 sing N N 295 SER CA C sing N N 296 SER CA CB sing N N 297 SER CA HA sing N N 298 SER C O doub N N 299 SER C OXT sing N N 300 SER CB OG sing N N 301 SER CB HB2 sing N N 302 SER CB HB3 sing N N 303 SER OG HG sing N N 304 SER OXT HXT sing N N 305 THR N CA sing N N 306 THR N H sing N N 307 THR N H2 sing N N 308 THR CA C sing N N 309 THR CA CB sing N N 310 THR CA HA sing N N 311 THR C O doub N N 312 THR C OXT sing N N 313 THR CB OG1 sing N N 314 THR CB CG2 sing N N 315 THR CB HB sing N N 316 THR OG1 HG1 sing N N 317 THR CG2 HG21 sing N N 318 THR CG2 HG22 sing N N 319 THR CG2 HG23 sing N N 320 THR OXT HXT sing N N 321 TRP N CA sing N N 322 TRP N H sing N N 323 TRP N H2 sing N N 324 TRP CA C sing N N 325 TRP CA CB sing N N 326 TRP CA HA sing N N 327 TRP C O doub N N 328 TRP C OXT sing N N 329 TRP CB CG sing N N 330 TRP CB HB2 sing N N 331 TRP CB HB3 sing N N 332 TRP CG CD1 doub Y N 333 TRP CG CD2 sing Y N 334 TRP CD1 NE1 sing Y N 335 TRP CD1 HD1 sing N N 336 TRP CD2 CE2 doub Y N 337 TRP CD2 CE3 sing Y N 338 TRP NE1 CE2 sing Y N 339 TRP NE1 HE1 sing N N 340 TRP CE2 CZ2 sing Y N 341 TRP CE3 CZ3 doub Y N 342 TRP CE3 HE3 sing N N 343 TRP CZ2 CH2 doub Y N 344 TRP CZ2 HZ2 sing N N 345 TRP CZ3 CH2 sing Y N 346 TRP CZ3 HZ3 sing N N 347 TRP CH2 HH2 sing N N 348 TRP OXT HXT sing N N 349 TYR N CA sing N N 350 TYR N H sing N N 351 TYR N H2 sing N N 352 TYR CA C sing N N 353 TYR CA CB sing N N 354 TYR CA HA sing N N 355 TYR C O doub N N 356 TYR C OXT sing N N 357 TYR CB CG sing N N 358 TYR CB HB2 sing N N 359 TYR CB HB3 sing N N 360 TYR CG CD1 doub Y N 361 TYR CG CD2 sing Y N 362 TYR CD1 CE1 sing Y N 363 TYR CD1 HD1 sing N N 364 TYR CD2 CE2 doub Y N 365 TYR CD2 HD2 sing N N 366 TYR CE1 CZ doub Y N 367 TYR CE1 HE1 sing N N 368 TYR CE2 CZ sing Y N 369 TYR CE2 HE2 sing N N 370 TYR CZ OH sing N N 371 TYR OH HH sing N N 372 TYR OXT HXT sing N N 373 VAL N CA sing N N 374 VAL N H sing N N 375 VAL N H2 sing N N 376 VAL CA C sing N N 377 VAL CA CB sing N N 378 VAL CA HA sing N N 379 VAL C O doub N N 380 VAL C OXT sing N N 381 VAL CB CG1 sing N N 382 VAL CB CG2 sing N N 383 VAL CB HB sing N N 384 VAL CG1 HG11 sing N N 385 VAL CG1 HG12 sing N N 386 VAL CG1 HG13 sing N N 387 VAL CG2 HG21 sing N N 388 VAL CG2 HG22 sing N N 389 VAL CG2 HG23 sing N N 390 VAL OXT HXT sing N N 391 # _pdbx_audit_support.funding_organization 'National Research Foundation (Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'DI(HYDROXYETHYL)ETHER' PEG 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3IT9 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #