data_5ZQH # _entry.id 5ZQH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZQH pdb_00005zqh 10.2210/pdb5zqh/pdb WWPDB D_1300007490 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZQH _pdbx_database_status.recvd_initial_deposition_date 2018-04-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, M.' 1 ? 'Hong, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 532 _citation.language ? _citation.page_first 251 _citation.page_last 257 _citation.title ;Structure-based functional analysis of a PadR transcription factor from Streptococcus pneumoniae and characteristic features in the PadR subfamily-2. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2020.08.035 _citation.pdbx_database_id_PubMed 32868077 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, C.' 1 ? primary 'Kim, M.I.' 2 ? primary 'Park, J.' 3 ? primary 'Oh, H.' 4 ? primary 'Kim, J.' 5 ? primary 'Hong, J.' 6 ? primary 'Jeon, B.Y.' 7 ? primary 'Ka, H.' 8 ? primary 'Hong, M.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 127.890 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5ZQH _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.301 _cell.length_a_esd ? _cell.length_b 30.612 _cell.length_b_esd ? _cell.length_c 51.481 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZQH _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PadR family transcriptional regulator' 11878.516 1 ? ? ? ? 2 water nat water 18.015 16 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'putative PadR-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ETQLLKGVLEGCVLDMIGQKERYGYELVQTLREAGFDTIVPGTIYPLLQKLEKNQWIRGDMRPSPDGPDRKYFSLMKEGE ERVSVFWQQWDDLSQKVEGIKN ; _entity_poly.pdbx_seq_one_letter_code_can ;ETQLLKGVLEGCVLDMIGQKERYGYELVQTLREAGFDTIVPGTIYPLLQKLEKNQWIRGDMRPSPDGPDRKYFSLMKEGE ERVSVFWQQWDDLSQKVEGIKN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 THR n 1 3 GLN n 1 4 LEU n 1 5 LEU n 1 6 LYS n 1 7 GLY n 1 8 VAL n 1 9 LEU n 1 10 GLU n 1 11 GLY n 1 12 CYS n 1 13 VAL n 1 14 LEU n 1 15 ASP n 1 16 MET n 1 17 ILE n 1 18 GLY n 1 19 GLN n 1 20 LYS n 1 21 GLU n 1 22 ARG n 1 23 TYR n 1 24 GLY n 1 25 TYR n 1 26 GLU n 1 27 LEU n 1 28 VAL n 1 29 GLN n 1 30 THR n 1 31 LEU n 1 32 ARG n 1 33 GLU n 1 34 ALA n 1 35 GLY n 1 36 PHE n 1 37 ASP n 1 38 THR n 1 39 ILE n 1 40 VAL n 1 41 PRO n 1 42 GLY n 1 43 THR n 1 44 ILE n 1 45 TYR n 1 46 PRO n 1 47 LEU n 1 48 LEU n 1 49 GLN n 1 50 LYS n 1 51 LEU n 1 52 GLU n 1 53 LYS n 1 54 ASN n 1 55 GLN n 1 56 TRP n 1 57 ILE n 1 58 ARG n 1 59 GLY n 1 60 ASP n 1 61 MET n 1 62 ARG n 1 63 PRO n 1 64 SER n 1 65 PRO n 1 66 ASP n 1 67 GLY n 1 68 PRO n 1 69 ASP n 1 70 ARG n 1 71 LYS n 1 72 TYR n 1 73 PHE n 1 74 SER n 1 75 LEU n 1 76 MET n 1 77 LYS n 1 78 GLU n 1 79 GLY n 1 80 GLU n 1 81 GLU n 1 82 ARG n 1 83 VAL n 1 84 SER n 1 85 VAL n 1 86 PHE n 1 87 TRP n 1 88 GLN n 1 89 GLN n 1 90 TRP n 1 91 ASP n 1 92 ASP n 1 93 LEU n 1 94 SER n 1 95 GLN n 1 96 LYS n 1 97 VAL n 1 98 GLU n 1 99 GLY n 1 100 ILE n 1 101 LYS n 1 102 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 102 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1313 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A229FJD3_STREE _struct_ref.pdbx_db_accession A0A229FJD3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ETQLLKGVLEGCVLDMIGQKERYGYELVQTLREAGFDTIVPGTIYPLLQKLEKNQWIRGDMRPSPDGPDRKYFSLMKEGE ERVSVFWQQWDDLSQKVEGIKN ; _struct_ref.pdbx_align_begin 4 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ZQH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A229FJD3 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZQH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Ammonium sulfate, 25% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-12-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00003 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00003 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5ZQH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.400 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4026 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.000 _reflns.pdbx_Rmerge_I_obs 0.038 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 30.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.556 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.047 _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.400 2.440 ? ? ? ? ? ? 200 100.000 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 3.100 ? 3.002 ? ? 0.091 0.051 ? 1 1 0.994 ? 2.440 2.490 ? ? ? ? ? ? 212 99.500 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 3.000 ? 2.900 ? ? 0.077 0.044 ? 2 1 0.995 ? 2.490 2.530 ? ? ? ? ? ? 180 98.900 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 3.100 ? 2.627 ? ? 0.076 0.043 ? 3 1 0.994 ? 2.530 2.590 ? ? ? ? ? ? 231 99.600 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 3.000 ? 2.874 ? ? 0.071 0.041 ? 4 1 0.992 ? 2.590 2.640 ? ? ? ? ? ? 182 99.500 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 3.000 ? 2.830 ? ? 0.065 0.037 ? 5 1 0.996 ? 2.640 2.700 ? ? ? ? ? ? 199 98.500 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 2.900 ? 2.806 ? ? 0.069 0.040 ? 6 1 0.990 ? 2.700 2.770 ? ? ? ? ? ? 214 99.500 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 3.000 ? 2.814 ? ? 0.066 0.037 ? 7 1 0.995 ? 2.770 2.850 ? ? ? ? ? ? 189 99.000 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 3.000 ? 2.699 ? ? 0.060 0.034 ? 8 1 0.995 ? 2.850 2.930 ? ? ? ? ? ? 204 99.000 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 3.000 ? 2.646 ? ? 0.059 0.034 ? 9 1 0.994 ? 2.930 3.020 ? ? ? ? ? ? 198 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 3.000 ? 2.597 ? ? 0.055 0.031 ? 10 1 0.996 ? 3.020 3.130 ? ? ? ? ? ? 212 99.100 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 3.100 ? 2.896 ? ? 0.054 0.030 ? 11 1 0.995 ? 3.130 3.260 ? ? ? ? ? ? 198 100.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 2.900 ? 2.750 ? ? 0.052 0.030 ? 12 1 0.997 ? 3.260 3.410 ? ? ? ? ? ? 220 100.000 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 3.000 ? 2.346 ? ? 0.046 0.026 ? 13 1 0.997 ? 3.410 3.580 ? ? ? ? ? ? 188 99.500 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 3.000 ? 2.389 ? ? 0.045 0.026 ? 14 1 0.996 ? 3.580 3.810 ? ? ? ? ? ? 214 99.100 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 2.900 ? 2.287 ? ? 0.046 0.026 ? 15 1 0.995 ? 3.810 4.100 ? ? ? ? ? ? 197 98.500 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 3.000 ? 2.450 ? ? 0.042 0.024 ? 16 1 0.996 ? 4.100 4.520 ? ? ? ? ? ? 199 95.200 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 3.000 ? 1.838 ? ? 0.038 0.021 ? 17 1 0.997 ? 4.520 5.170 ? ? ? ? ? ? 204 96.200 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 2.800 ? 1.939 ? ? 0.039 0.022 ? 18 1 0.997 ? 5.170 6.510 ? ? ? ? ? ? 207 98.600 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 2.900 ? 2.000 ? ? 0.037 0.021 ? 19 1 0.997 ? 6.510 50.000 ? ? ? ? ? ? 178 78.100 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 2.700 ? 2.209 ? ? 0.043 0.025 ? 20 1 0.993 ? # _refine.aniso_B[1][1] -0.4900 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -1.7900 _refine.aniso_B[2][2] 4.1200 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.3800 _refine.B_iso_max 36.560 _refine.B_iso_mean 10.4300 _refine.B_iso_min 4.710 _refine.correlation_coeff_Fo_to_Fc 0.8650 _refine.correlation_coeff_Fo_to_Fc_free 0.8620 _refine.details 'U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZQH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4000 _refine.ls_d_res_low 40.6300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3820 _refine.ls_number_reflns_R_free 203 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.7600 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2912 _refine.ls_R_factor_R_free 0.2982 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2909 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4esf _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.9620 _refine.pdbx_overall_ESU_R_Free 0.3440 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.4000 _refine_hist.d_res_low 40.6300 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 843 _refine_hist.pdbx_number_residues_total 101 _refine_hist.pdbx_B_iso_mean_solvent 20.69 _refine_hist.pdbx_number_atoms_protein 827 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.020 838 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.560 1.973 1127 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.235 5.000 99 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 45.975 24.884 43 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 20.156 15.000 158 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.513 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.101 0.200 118 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 633 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.4000 _refine_ls_shell.d_res_low 2.4620 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 19 _refine_ls_shell.number_reflns_R_work 288 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4190 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5ZQH _struct.title 'Crystal structure of Streptococcus transcriptional regulator' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZQH _struct_keywords.text 'Bacteria, PadR, antibiotic resistance, regulator, transcription, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 2 ? LYS A 20 ? THR A 5 LYS A 23 1 ? 19 HELX_P HELX_P2 AA2 GLY A 24 ? ALA A 34 ? GLY A 27 ALA A 37 1 ? 11 HELX_P HELX_P3 AA3 ILE A 44 ? ASN A 54 ? ILE A 47 ASN A 57 1 ? 11 HELX_P HELX_P4 AA4 MET A 76 ? ASN A 102 ? MET A 79 ASN A 105 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 22 ? TYR A 23 ? ARG A 25 TYR A 26 AA1 2 ASP A 69 ? LEU A 75 ? ASP A 72 LEU A 78 AA1 3 ILE A 57 ? PRO A 63 ? ILE A 60 PRO A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 22 ? N ARG A 25 O PHE A 73 ? O PHE A 76 AA1 2 3 O SER A 74 ? O SER A 77 N ARG A 58 ? N ARG A 61 # _atom_sites.entry_id 5ZQH _atom_sites.fract_transf_matrix[1][1] 0.012151 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.009454 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.032667 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024612 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 4 4 GLU GLU A . n A 1 2 THR 2 5 5 THR THR A . n A 1 3 GLN 3 6 6 GLN GLN A . n A 1 4 LEU 4 7 7 LEU LEU A . n A 1 5 LEU 5 8 8 LEU LEU A . n A 1 6 LYS 6 9 9 LYS LYS A . n A 1 7 GLY 7 10 10 GLY GLY A . n A 1 8 VAL 8 11 11 VAL VAL A . n A 1 9 LEU 9 12 12 LEU LEU A . n A 1 10 GLU 10 13 13 GLU GLU A . n A 1 11 GLY 11 14 14 GLY GLY A . n A 1 12 CYS 12 15 15 CYS CYS A . n A 1 13 VAL 13 16 16 VAL VAL A . n A 1 14 LEU 14 17 17 LEU LEU A . n A 1 15 ASP 15 18 18 ASP ASP A . n A 1 16 MET 16 19 19 MET MET A . n A 1 17 ILE 17 20 20 ILE ILE A . n A 1 18 GLY 18 21 21 GLY GLY A . n A 1 19 GLN 19 22 22 GLN GLN A . n A 1 20 LYS 20 23 23 LYS LYS A . n A 1 21 GLU 21 24 24 GLU GLU A . n A 1 22 ARG 22 25 25 ARG ARG A . n A 1 23 TYR 23 26 26 TYR TYR A . n A 1 24 GLY 24 27 27 GLY GLY A . n A 1 25 TYR 25 28 28 TYR TYR A . n A 1 26 GLU 26 29 29 GLU GLU A . n A 1 27 LEU 27 30 30 LEU LEU A . n A 1 28 VAL 28 31 31 VAL VAL A . n A 1 29 GLN 29 32 32 GLN GLN A . n A 1 30 THR 30 33 33 THR THR A . n A 1 31 LEU 31 34 34 LEU LEU A . n A 1 32 ARG 32 35 35 ARG ARG A . n A 1 33 GLU 33 36 36 GLU GLU A . n A 1 34 ALA 34 37 37 ALA ALA A . n A 1 35 GLY 35 38 38 GLY GLY A . n A 1 36 PHE 36 39 39 PHE PHE A . n A 1 37 ASP 37 40 40 ASP ASP A . n A 1 38 THR 38 41 41 THR THR A . n A 1 39 ILE 39 42 42 ILE ILE A . n A 1 40 VAL 40 43 43 VAL VAL A . n A 1 41 PRO 41 44 ? ? ? A . n A 1 42 GLY 42 45 45 GLY GLY A . n A 1 43 THR 43 46 46 THR THR A . n A 1 44 ILE 44 47 47 ILE ILE A . n A 1 45 TYR 45 48 48 TYR TYR A . n A 1 46 PRO 46 49 49 PRO PRO A . n A 1 47 LEU 47 50 50 LEU LEU A . n A 1 48 LEU 48 51 51 LEU LEU A . n A 1 49 GLN 49 52 52 GLN GLN A . n A 1 50 LYS 50 53 53 LYS LYS A . n A 1 51 LEU 51 54 54 LEU LEU A . n A 1 52 GLU 52 55 55 GLU GLU A . n A 1 53 LYS 53 56 56 LYS LYS A . n A 1 54 ASN 54 57 57 ASN ASN A . n A 1 55 GLN 55 58 58 GLN GLN A . n A 1 56 TRP 56 59 59 TRP TRP A . n A 1 57 ILE 57 60 60 ILE ILE A . n A 1 58 ARG 58 61 61 ARG ARG A . n A 1 59 GLY 59 62 62 GLY GLY A . n A 1 60 ASP 60 63 63 ASP ASP A . n A 1 61 MET 61 64 64 MET MET A . n A 1 62 ARG 62 65 65 ARG ARG A . n A 1 63 PRO 63 66 66 PRO PRO A . n A 1 64 SER 64 67 67 SER SER A . n A 1 65 PRO 65 68 68 PRO PRO A . n A 1 66 ASP 66 69 69 ASP ASP A . n A 1 67 GLY 67 70 70 GLY GLY A . n A 1 68 PRO 68 71 71 PRO PRO A . n A 1 69 ASP 69 72 72 ASP ASP A . n A 1 70 ARG 70 73 73 ARG ARG A . n A 1 71 LYS 71 74 74 LYS LYS A . n A 1 72 TYR 72 75 75 TYR TYR A . n A 1 73 PHE 73 76 76 PHE PHE A . n A 1 74 SER 74 77 77 SER SER A . n A 1 75 LEU 75 78 78 LEU LEU A . n A 1 76 MET 76 79 79 MET MET A . n A 1 77 LYS 77 80 80 LYS LYS A . n A 1 78 GLU 78 81 81 GLU GLU A . n A 1 79 GLY 79 82 82 GLY GLY A . n A 1 80 GLU 80 83 83 GLU GLU A . n A 1 81 GLU 81 84 84 GLU GLU A . n A 1 82 ARG 82 85 85 ARG ARG A . n A 1 83 VAL 83 86 86 VAL VAL A . n A 1 84 SER 84 87 87 SER SER A . n A 1 85 VAL 85 88 88 VAL VAL A . n A 1 86 PHE 86 89 89 PHE PHE A . n A 1 87 TRP 87 90 90 TRP TRP A . n A 1 88 GLN 88 91 91 GLN GLN A . n A 1 89 GLN 89 92 92 GLN GLN A . n A 1 90 TRP 90 93 93 TRP TRP A . n A 1 91 ASP 91 94 94 ASP ASP A . n A 1 92 ASP 92 95 95 ASP ASP A . n A 1 93 LEU 93 96 96 LEU LEU A . n A 1 94 SER 94 97 97 SER SER A . n A 1 95 GLN 95 98 98 GLN GLN A . n A 1 96 LYS 96 99 99 LYS LYS A . n A 1 97 VAL 97 100 100 VAL VAL A . n A 1 98 GLU 98 101 101 GLU GLU A . n A 1 99 GLY 99 102 102 GLY GLY A . n A 1 100 ILE 100 103 103 ILE ILE A . n A 1 101 LYS 101 104 104 LYS LYS A . n A 1 102 ASN 102 105 105 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 16 HOH HOH A . B 2 HOH 2 202 14 HOH HOH A . B 2 HOH 3 203 7 HOH HOH A . B 2 HOH 4 204 4 HOH HOH A . B 2 HOH 5 205 11 HOH HOH A . B 2 HOH 6 206 5 HOH HOH A . B 2 HOH 7 207 12 HOH HOH A . B 2 HOH 8 208 15 HOH HOH A . B 2 HOH 9 209 9 HOH HOH A . B 2 HOH 10 210 1 HOH HOH A . B 2 HOH 11 211 6 HOH HOH A . B 2 HOH 12 212 8 HOH HOH A . B 2 HOH 13 213 2 HOH HOH A . B 2 HOH 14 214 17 HOH HOH A . B 2 HOH 15 215 13 HOH HOH A . B 2 HOH 16 216 3 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2690 ? 1 MORE -22 ? 1 'SSA (A^2)' 11550 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 50.6840741180 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 40.6283565847 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-01 2 'Structure model' 1 1 2020-11-11 3 'Structure model' 1 2 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' Advisory 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' struct 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_initial_refinement_model 8 3 'Structure model' pdbx_unobs_or_zero_occ_atoms # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_struct.pdbx_descriptor' 14 3 'Structure model' '_database_2.pdbx_DOI' 15 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 12 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 12 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 12 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 130.83 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 15.53 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LYS 80 ? CG ? A LYS 77 CG 2 1 Y 0 A LYS 80 ? CD ? A LYS 77 CD 3 1 Y 0 A LYS 80 ? CE ? A LYS 77 CE 4 1 Y 0 A LYS 80 ? NZ ? A LYS 77 NZ # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id PRO _pdbx_unobs_or_zero_occ_residues.auth_seq_id 44 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id PRO _pdbx_unobs_or_zero_occ_residues.label_seq_id 41 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 ILE N N N N 140 ILE CA C N S 141 ILE C C N N 142 ILE O O N N 143 ILE CB C N S 144 ILE CG1 C N N 145 ILE CG2 C N N 146 ILE CD1 C N N 147 ILE OXT O N N 148 ILE H H N N 149 ILE H2 H N N 150 ILE HA H N N 151 ILE HB H N N 152 ILE HG12 H N N 153 ILE HG13 H N N 154 ILE HG21 H N N 155 ILE HG22 H N N 156 ILE HG23 H N N 157 ILE HD11 H N N 158 ILE HD12 H N N 159 ILE HD13 H N N 160 ILE HXT H N N 161 LEU N N N N 162 LEU CA C N S 163 LEU C C N N 164 LEU O O N N 165 LEU CB C N N 166 LEU CG C N N 167 LEU CD1 C N N 168 LEU CD2 C N N 169 LEU OXT O N N 170 LEU H H N N 171 LEU H2 H N N 172 LEU HA H N N 173 LEU HB2 H N N 174 LEU HB3 H N N 175 LEU HG H N N 176 LEU HD11 H N N 177 LEU HD12 H N N 178 LEU HD13 H N N 179 LEU HD21 H N N 180 LEU HD22 H N N 181 LEU HD23 H N N 182 LEU HXT H N N 183 LYS N N N N 184 LYS CA C N S 185 LYS C C N N 186 LYS O O N N 187 LYS CB C N N 188 LYS CG C N N 189 LYS CD C N N 190 LYS CE C N N 191 LYS NZ N N N 192 LYS OXT O N N 193 LYS H H N N 194 LYS H2 H N N 195 LYS HA H N N 196 LYS HB2 H N N 197 LYS HB3 H N N 198 LYS HG2 H N N 199 LYS HG3 H N N 200 LYS HD2 H N N 201 LYS HD3 H N N 202 LYS HE2 H N N 203 LYS HE3 H N N 204 LYS HZ1 H N N 205 LYS HZ2 H N N 206 LYS HZ3 H N N 207 LYS HXT H N N 208 MET N N N N 209 MET CA C N S 210 MET C C N N 211 MET O O N N 212 MET CB C N N 213 MET CG C N N 214 MET SD S N N 215 MET CE C N N 216 MET OXT O N N 217 MET H H N N 218 MET H2 H N N 219 MET HA H N N 220 MET HB2 H N N 221 MET HB3 H N N 222 MET HG2 H N N 223 MET HG3 H N N 224 MET HE1 H N N 225 MET HE2 H N N 226 MET HE3 H N N 227 MET HXT H N N 228 PHE N N N N 229 PHE CA C N S 230 PHE C C N N 231 PHE O O N N 232 PHE CB C N N 233 PHE CG C Y N 234 PHE CD1 C Y N 235 PHE CD2 C Y N 236 PHE CE1 C Y N 237 PHE CE2 C Y N 238 PHE CZ C Y N 239 PHE OXT O N N 240 PHE H H N N 241 PHE H2 H N N 242 PHE HA H N N 243 PHE HB2 H N N 244 PHE HB3 H N N 245 PHE HD1 H N N 246 PHE HD2 H N N 247 PHE HE1 H N N 248 PHE HE2 H N N 249 PHE HZ H N N 250 PHE HXT H N N 251 PRO N N N N 252 PRO CA C N S 253 PRO C C N N 254 PRO O O N N 255 PRO CB C N N 256 PRO CG C N N 257 PRO CD C N N 258 PRO OXT O N N 259 PRO H H N N 260 PRO HA H N N 261 PRO HB2 H N N 262 PRO HB3 H N N 263 PRO HG2 H N N 264 PRO HG3 H N N 265 PRO HD2 H N N 266 PRO HD3 H N N 267 PRO HXT H N N 268 SER N N N N 269 SER CA C N S 270 SER C C N N 271 SER O O N N 272 SER CB C N N 273 SER OG O N N 274 SER OXT O N N 275 SER H H N N 276 SER H2 H N N 277 SER HA H N N 278 SER HB2 H N N 279 SER HB3 H N N 280 SER HG H N N 281 SER HXT H N N 282 THR N N N N 283 THR CA C N S 284 THR C C N N 285 THR O O N N 286 THR CB C N R 287 THR OG1 O N N 288 THR CG2 C N N 289 THR OXT O N N 290 THR H H N N 291 THR H2 H N N 292 THR HA H N N 293 THR HB H N N 294 THR HG1 H N N 295 THR HG21 H N N 296 THR HG22 H N N 297 THR HG23 H N N 298 THR HXT H N N 299 TRP N N N N 300 TRP CA C N S 301 TRP C C N N 302 TRP O O N N 303 TRP CB C N N 304 TRP CG C Y N 305 TRP CD1 C Y N 306 TRP CD2 C Y N 307 TRP NE1 N Y N 308 TRP CE2 C Y N 309 TRP CE3 C Y N 310 TRP CZ2 C Y N 311 TRP CZ3 C Y N 312 TRP CH2 C Y N 313 TRP OXT O N N 314 TRP H H N N 315 TRP H2 H N N 316 TRP HA H N N 317 TRP HB2 H N N 318 TRP HB3 H N N 319 TRP HD1 H N N 320 TRP HE1 H N N 321 TRP HE3 H N N 322 TRP HZ2 H N N 323 TRP HZ3 H N N 324 TRP HH2 H N N 325 TRP HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # _pdbx_audit_support.funding_organization 'National Research Foundation (Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number 2015R1D1A1A01057574 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ESF _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #