data_5ZWF # _entry.id 5ZWF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.296 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5ZWF WWPDB D_1300007781 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZWF _pdbx_database_status.recvd_initial_deposition_date 2018-05-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yoshizawa, M.' 1 ? 'Itoh, T.' 2 ? 'Anami, Y.' 3 ? 'Kato, A.' 4 ? 'Yoshimoto, N.' 5 ? 'Yamamoto, K.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first 6339 _citation.page_last 6349 _citation.title 'Identification of the Histidine Residue in Vitamin D Receptor That Covalently Binds to Electrophilic Ligands' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.8b00774 _citation.pdbx_database_id_PubMed 29936834 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yoshizawa, M.' 1 ? primary 'Itoh, T.' 2 ? primary 'Hori, T.' 3 ? primary 'Kato, A.' 4 ? primary 'Anami, Y.' 5 0000-0001-5136-7708 primary 'Yoshimoto, N.' 6 ? primary 'Yamamoto, K.' 7 0000-0001-6642-7961 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 96.22 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5ZWF _cell.details ? _cell.formula_units_Z ? _cell.length_a 153.560 _cell.length_a_esd ? _cell.length_b 41.730 _cell.length_b_esd ? _cell.length_c 42.020 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZWF _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Vitamin D3 receptor' 30595.037 1 ? '165-211 deletion' ? ? 2 polymer man '13-meric peptide from DRIP205 NR2 BOX peptide' 1570.898 1 ? ? ? ? 3 non-polymer syn ;(E,7R)-7-[(1R,3aS,4E,7aR)-7a-methyl-4-[2-[(3R,5R)-4-methylidene-3,5-bis(oxidanyl)cyclohexylidene]ethylidene]-2,3,3a,5,6,7-hexahydro-1H-inden-1-yl]oct-2-en-4-one ; 412.605 1 ? ? ? ? 4 water nat water 18.015 74 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'VDR,1,25-dihydroxyvitamin D3 receptor,Nuclear receptor subfamily 1 group I member 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMGSPNSPLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSVTLDLSPLSMLPHLADLVSY SIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKF QVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEE HSKQYRSLSFQPENSMKLTPLVLEVFGNEIS ; ;GSHMGSPNSPLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSVTLDLSPLSMLPHLADLVSY SIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKF QVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEE HSKQYRSLSFQPENSMKLTPLVLEVFGNEIS ; A ? 2 'polypeptide(L)' no no KNHPMLMNLLKDN KNHPMLMNLLKDN C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 SER n 1 7 PRO n 1 8 ASN n 1 9 SER n 1 10 PRO n 1 11 LEU n 1 12 LYS n 1 13 ASP n 1 14 SER n 1 15 LEU n 1 16 ARG n 1 17 PRO n 1 18 LYS n 1 19 LEU n 1 20 SER n 1 21 GLU n 1 22 GLU n 1 23 GLN n 1 24 GLN n 1 25 HIS n 1 26 ILE n 1 27 ILE n 1 28 ALA n 1 29 ILE n 1 30 LEU n 1 31 LEU n 1 32 ASP n 1 33 ALA n 1 34 HIS n 1 35 HIS n 1 36 LYS n 1 37 THR n 1 38 TYR n 1 39 ASP n 1 40 PRO n 1 41 THR n 1 42 TYR n 1 43 ALA n 1 44 ASP n 1 45 PHE n 1 46 ARG n 1 47 ASP n 1 48 PHE n 1 49 ARG n 1 50 PRO n 1 51 PRO n 1 52 VAL n 1 53 ARG n 1 54 MET n 1 55 ASP n 1 56 GLY n 1 57 SER n 1 58 THR n 1 59 GLY n 1 60 SER n 1 61 VAL n 1 62 THR n 1 63 LEU n 1 64 ASP n 1 65 LEU n 1 66 SER n 1 67 PRO n 1 68 LEU n 1 69 SER n 1 70 MET n 1 71 LEU n 1 72 PRO n 1 73 HIS n 1 74 LEU n 1 75 ALA n 1 76 ASP n 1 77 LEU n 1 78 VAL n 1 79 SER n 1 80 TYR n 1 81 SER n 1 82 ILE n 1 83 GLN n 1 84 LYS n 1 85 VAL n 1 86 ILE n 1 87 GLY n 1 88 PHE n 1 89 ALA n 1 90 LYS n 1 91 MET n 1 92 ILE n 1 93 PRO n 1 94 GLY n 1 95 PHE n 1 96 ARG n 1 97 ASP n 1 98 LEU n 1 99 THR n 1 100 SER n 1 101 ASP n 1 102 ASP n 1 103 GLN n 1 104 ILE n 1 105 VAL n 1 106 LEU n 1 107 LEU n 1 108 LYS n 1 109 SER n 1 110 SER n 1 111 ALA n 1 112 ILE n 1 113 GLU n 1 114 VAL n 1 115 ILE n 1 116 MET n 1 117 LEU n 1 118 ARG n 1 119 SER n 1 120 ASN n 1 121 GLN n 1 122 SER n 1 123 PHE n 1 124 THR n 1 125 MET n 1 126 ASP n 1 127 ASP n 1 128 MET n 1 129 SER n 1 130 TRP n 1 131 ASP n 1 132 CYS n 1 133 GLY n 1 134 SER n 1 135 GLN n 1 136 ASP n 1 137 TYR n 1 138 LYS n 1 139 TYR n 1 140 ASP n 1 141 VAL n 1 142 THR n 1 143 ASP n 1 144 VAL n 1 145 SER n 1 146 LYS n 1 147 ALA n 1 148 GLY n 1 149 HIS n 1 150 THR n 1 151 LEU n 1 152 GLU n 1 153 LEU n 1 154 ILE n 1 155 GLU n 1 156 PRO n 1 157 LEU n 1 158 ILE n 1 159 LYS n 1 160 PHE n 1 161 GLN n 1 162 VAL n 1 163 GLY n 1 164 LEU n 1 165 LYS n 1 166 LYS n 1 167 LEU n 1 168 ASN n 1 169 LEU n 1 170 HIS n 1 171 GLU n 1 172 GLU n 1 173 GLU n 1 174 HIS n 1 175 VAL n 1 176 LEU n 1 177 LEU n 1 178 MET n 1 179 ALA n 1 180 ILE n 1 181 CYS n 1 182 ILE n 1 183 VAL n 1 184 SER n 1 185 PRO n 1 186 ASP n 1 187 ARG n 1 188 PRO n 1 189 GLY n 1 190 VAL n 1 191 GLN n 1 192 ASP n 1 193 ALA n 1 194 LYS n 1 195 LEU n 1 196 VAL n 1 197 GLU n 1 198 ALA n 1 199 ILE n 1 200 GLN n 1 201 ASP n 1 202 ARG n 1 203 LEU n 1 204 SER n 1 205 ASN n 1 206 THR n 1 207 LEU n 1 208 GLN n 1 209 THR n 1 210 TYR n 1 211 ILE n 1 212 ARG n 1 213 CYS n 1 214 ARG n 1 215 HIS n 1 216 PRO n 1 217 PRO n 1 218 PRO n 1 219 GLY n 1 220 SER n 1 221 HIS n 1 222 GLN n 1 223 LEU n 1 224 TYR n 1 225 ALA n 1 226 LYS n 1 227 MET n 1 228 ILE n 1 229 GLN n 1 230 LYS n 1 231 LEU n 1 232 ALA n 1 233 ASP n 1 234 LEU n 1 235 ARG n 1 236 SER n 1 237 LEU n 1 238 ASN n 1 239 GLU n 1 240 GLU n 1 241 HIS n 1 242 SER n 1 243 LYS n 1 244 GLN n 1 245 TYR n 1 246 ARG n 1 247 SER n 1 248 LEU n 1 249 SER n 1 250 PHE n 1 251 GLN n 1 252 PRO n 1 253 GLU n 1 254 ASN n 1 255 SER n 1 256 MET n 1 257 LYS n 1 258 LEU n 1 259 THR n 1 260 PRO n 1 261 LEU n 1 262 VAL n 1 263 LEU n 1 264 GLU n 1 265 VAL n 1 266 PHE n 1 267 GLY n 1 268 ASN n 1 269 GLU n 1 270 ILE n 1 271 SER n 2 1 LYS n 2 2 ASN n 2 3 HIS n 2 4 PRO n 2 5 MET n 2 6 LEU n 2 7 MET n 2 8 ASN n 2 9 LEU n 2 10 LEU n 2 11 LYS n 2 12 ASP n 2 13 ASN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 271 Rat ? 'Vdr, Nr1i1' ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 13 ? ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP VDR_RAT P13053 ? 1 ;LKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSYSPRPTLSFSGNSSSSSSDLYTTSLDMMEP SGFSNLDLNGEDSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSF TMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRL SNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNEIS ; 116 2 PDB 5ZWF 5ZWF ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5ZWF A 11 ? 271 ? P13053 116 ? 423 ? 116 423 2 2 5ZWF C 1 ? 13 ? 5ZWF 625 ? 637 ? 625 637 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZWF GLY A 1 ? UNP P13053 ? ? 'expression tag' 106 1 1 5ZWF SER A 2 ? UNP P13053 ? ? 'expression tag' 107 2 1 5ZWF HIS A 3 ? UNP P13053 ? ? 'expression tag' 108 3 1 5ZWF MET A 4 ? UNP P13053 ? ? 'expression tag' 109 4 1 5ZWF GLY A 5 ? UNP P13053 ? ? 'expression tag' 110 5 1 5ZWF SER A 6 ? UNP P13053 ? ? 'expression tag' 111 6 1 5ZWF PRO A 7 ? UNP P13053 ? ? 'expression tag' 112 7 1 5ZWF ASN A 8 ? UNP P13053 ? ? 'expression tag' 113 8 1 5ZWF SER A 9 ? UNP P13053 ? ? 'expression tag' 114 9 1 5ZWF PRO A 10 ? UNP P13053 ? ? 'expression tag' 115 10 1 5ZWF ? A ? ? UNP P13053 SER 165 deletion ? 11 1 5ZWF ? A ? ? UNP P13053 TYR 166 deletion ? 12 1 5ZWF ? A ? ? UNP P13053 SER 167 deletion ? 13 1 5ZWF ? A ? ? UNP P13053 PRO 168 deletion ? 14 1 5ZWF ? A ? ? UNP P13053 ARG 169 deletion ? 15 1 5ZWF ? A ? ? UNP P13053 PRO 170 deletion ? 16 1 5ZWF ? A ? ? UNP P13053 THR 171 deletion ? 17 1 5ZWF ? A ? ? UNP P13053 LEU 172 deletion ? 18 1 5ZWF ? A ? ? UNP P13053 SER 173 deletion ? 19 1 5ZWF ? A ? ? UNP P13053 PHE 174 deletion ? 20 1 5ZWF ? A ? ? UNP P13053 SER 175 deletion ? 21 1 5ZWF ? A ? ? UNP P13053 GLY 176 deletion ? 22 1 5ZWF ? A ? ? UNP P13053 ASN 177 deletion ? 23 1 5ZWF ? A ? ? UNP P13053 SER 178 deletion ? 24 1 5ZWF ? A ? ? UNP P13053 SER 179 deletion ? 25 1 5ZWF ? A ? ? UNP P13053 SER 180 deletion ? 26 1 5ZWF ? A ? ? UNP P13053 SER 181 deletion ? 27 1 5ZWF ? A ? ? UNP P13053 SER 182 deletion ? 28 1 5ZWF ? A ? ? UNP P13053 SER 183 deletion ? 29 1 5ZWF ? A ? ? UNP P13053 ASP 184 deletion ? 30 1 5ZWF ? A ? ? UNP P13053 LEU 185 deletion ? 31 1 5ZWF ? A ? ? UNP P13053 TYR 186 deletion ? 32 1 5ZWF ? A ? ? UNP P13053 THR 187 deletion ? 33 1 5ZWF ? A ? ? UNP P13053 THR 188 deletion ? 34 1 5ZWF ? A ? ? UNP P13053 SER 189 deletion ? 35 1 5ZWF ? A ? ? UNP P13053 LEU 190 deletion ? 36 1 5ZWF ? A ? ? UNP P13053 ASP 191 deletion ? 37 1 5ZWF ? A ? ? UNP P13053 MET 192 deletion ? 38 1 5ZWF ? A ? ? UNP P13053 MET 193 deletion ? 39 1 5ZWF ? A ? ? UNP P13053 GLU 194 deletion ? 40 1 5ZWF ? A ? ? UNP P13053 PRO 195 deletion ? 41 1 5ZWF ? A ? ? UNP P13053 SER 196 deletion ? 42 1 5ZWF ? A ? ? UNP P13053 GLY 197 deletion ? 43 1 5ZWF ? A ? ? UNP P13053 PHE 198 deletion ? 44 1 5ZWF ? A ? ? UNP P13053 SER 199 deletion ? 45 1 5ZWF ? A ? ? UNP P13053 ASN 200 deletion ? 46 1 5ZWF ? A ? ? UNP P13053 LEU 201 deletion ? 47 1 5ZWF ? A ? ? UNP P13053 ASP 202 deletion ? 48 1 5ZWF ? A ? ? UNP P13053 LEU 203 deletion ? 49 1 5ZWF ? A ? ? UNP P13053 ASN 204 deletion ? 50 1 5ZWF ? A ? ? UNP P13053 GLY 205 deletion ? 51 1 5ZWF ? A ? ? UNP P13053 GLU 206 deletion ? 52 1 5ZWF ? A ? ? UNP P13053 ASP 207 deletion ? 53 1 5ZWF ? A ? ? UNP P13053 SER 208 deletion ? 54 1 5ZWF ? A ? ? UNP P13053 ASP 209 deletion ? 55 1 5ZWF ? A ? ? UNP P13053 ASP 210 deletion ? 56 1 5ZWF ? A ? ? UNP P13053 PRO 211 deletion ? 57 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9KR non-polymer . ;(E,7R)-7-[(1R,3aS,4E,7aR)-7a-methyl-4-[2-[(3R,5R)-4-methylidene-3,5-bis(oxidanyl)cyclohexylidene]ethylidene]-2,3,3a,5,6,7-hexahydro-1H-inden-1-yl]oct-2-en-4-one ; ? 'C27 H40 O3' 412.605 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZWF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.08 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MOPS-Na, Na-Formate, PEG 4000, Ethyleneglycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-05-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5ZWF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 40.25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12943 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 82.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -2.92 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -1.85 _refine.aniso_B[2][2] 2.47 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.84 _refine.B_iso_max ? _refine.B_iso_mean 35.176 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.935 _refine.correlation_coeff_Fo_to_Fc_free 0.922 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZWF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 35.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12301 _refine.ls_number_reflns_R_free 635 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 82.40 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23455 _refine.ls_R_factor_R_free 0.25021 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.23377 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.377 _refine.pdbx_overall_ESU_R_Free 0.233 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1946 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 74 _refine_hist.number_atoms_total 2050 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 35.00 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.019 2018 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.000 0.020 1951 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.329 1.994 2736 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 3.679 3.000 4502 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.561 5.000 245 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.633 25.000 86 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.279 15.000 353 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.188 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 318 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.021 2218 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.033 0.020 428 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.126 3.455 989 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.121 3.454 988 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.992 5.170 1231 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.993 5.172 1232 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.607 3.659 1029 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.606 3.659 1029 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.910 5.390 1506 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.769 32.801 8656 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.769 32.801 8657 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.155 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 35 _refine_ls_shell.number_reflns_R_work 849 _refine_ls_shell.percent_reflns_obs 78.86 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.296 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.337 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5ZWF _struct.title ;Covalent bond formation between histidine of Vitamin D receptor (VDR) and a full agonist having a enone with a beta methyl group via conjugate addition reaction ; _struct.pdbx_descriptor 'Vitamin D3 receptor, 13-meric peptide from DRIP205 NR2 BOX peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZWF _struct_keywords.text 'HORMONE covalent modifier transcription factor VitaminD3 enone Michael addition electrophile, HORMONE' _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 20 ? TYR A 38 ? SER A 125 TYR A 143 1 ? 19 HELX_P HELX_P2 AA2 TYR A 42 ? ASP A 47 ? TYR A 147 ASP A 152 5 ? 6 HELX_P HELX_P3 AA3 MET A 70 ? ILE A 92 ? MET A 222 ILE A 244 1 ? 23 HELX_P HELX_P4 AA4 THR A 99 ? ASN A 120 ? THR A 251 ASN A 272 1 ? 22 HELX_P HELX_P5 AA5 ASP A 140 ? ALA A 147 ? ASP A 292 ALA A 299 1 ? 8 HELX_P HELX_P6 AA6 THR A 150 ? ASN A 168 ? THR A 302 ASN A 320 1 ? 19 HELX_P HELX_P7 AA7 HIS A 170 ? VAL A 183 ? HIS A 322 VAL A 335 1 ? 14 HELX_P HELX_P8 AA8 ASP A 192 ? HIS A 215 ? ASP A 344 HIS A 367 1 ? 24 HELX_P HELX_P9 AA9 GLN A 222 ? GLN A 251 ? GLN A 374 GLN A 403 1 ? 30 HELX_P HELX_P10 AB1 GLN A 251 ? LEU A 258 ? GLN A 403 LEU A 410 1 ? 8 HELX_P HELX_P11 AB2 THR A 259 ? GLY A 267 ? THR A 411 GLY A 419 1 ? 9 HELX_P HELX_P12 AB3 HIS B 3 ? LYS B 11 ? HIS C 627 LYS C 635 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id HIS _struct_conn.ptnr1_label_seq_id 149 _struct_conn.ptnr1_label_atom_id NE2 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id 9KR _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C25 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id HIS _struct_conn.ptnr1_auth_seq_id 301 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 9KR _struct_conn.ptnr2_auth_seq_id 501 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.358 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 217 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 369 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 218 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 370 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.45 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 123 ? THR A 124 ? PHE A 275 THR A 276 AA1 2 SER A 129 ? ASP A 131 ? SER A 281 ASP A 283 AA1 3 LYS A 138 ? TYR A 139 ? LYS A 290 TYR A 291 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 124 ? N THR A 276 O SER A 129 ? O SER A 281 AA1 2 3 N TRP A 130 ? N TRP A 282 O TYR A 139 ? O TYR A 291 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 9KR _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue 9KR A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 TYR A 38 ? TYR A 143 . ? 1_555 ? 2 AC1 9 SER A 81 ? SER A 233 . ? 1_555 ? 3 AC1 9 ARG A 118 ? ARG A 270 . ? 1_555 ? 4 AC1 9 SER A 119 ? SER A 271 . ? 1_555 ? 5 AC1 9 SER A 122 ? SER A 274 . ? 1_555 ? 6 AC1 9 TRP A 130 ? TRP A 282 . ? 1_555 ? 7 AC1 9 VAL A 144 ? VAL A 296 . ? 1_555 ? 8 AC1 9 HIS A 149 ? HIS A 301 . ? 1_555 ? 9 AC1 9 HIS A 241 ? HIS A 393 . ? 1_555 ? # _atom_sites.entry_id 5ZWF _atom_sites.fract_transf_matrix[1][1] 0.006512 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000710 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023964 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023939 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 106 ? ? ? A . n A 1 2 SER 2 107 ? ? ? A . n A 1 3 HIS 3 108 ? ? ? A . n A 1 4 MET 4 109 ? ? ? A . n A 1 5 GLY 5 110 ? ? ? A . n A 1 6 SER 6 111 ? ? ? A . n A 1 7 PRO 7 112 ? ? ? A . n A 1 8 ASN 8 113 ? ? ? A . n A 1 9 SER 9 114 ? ? ? A . n A 1 10 PRO 10 115 ? ? ? A . n A 1 11 LEU 11 116 ? ? ? A . n A 1 12 LYS 12 117 ? ? ? A . n A 1 13 ASP 13 118 ? ? ? A . n A 1 14 SER 14 119 ? ? ? A . n A 1 15 LEU 15 120 ? ? ? A . n A 1 16 ARG 16 121 ? ? ? A . n A 1 17 PRO 17 122 ? ? ? A . n A 1 18 LYS 18 123 123 LYS LYS A . n A 1 19 LEU 19 124 124 LEU LEU A . n A 1 20 SER 20 125 125 SER SER A . n A 1 21 GLU 21 126 126 GLU GLU A . n A 1 22 GLU 22 127 127 GLU GLU A . n A 1 23 GLN 23 128 128 GLN GLN A . n A 1 24 GLN 24 129 129 GLN GLN A . n A 1 25 HIS 25 130 130 HIS HIS A . n A 1 26 ILE 26 131 131 ILE ILE A . n A 1 27 ILE 27 132 132 ILE ILE A . n A 1 28 ALA 28 133 133 ALA ALA A . n A 1 29 ILE 29 134 134 ILE ILE A . n A 1 30 LEU 30 135 135 LEU LEU A . n A 1 31 LEU 31 136 136 LEU LEU A . n A 1 32 ASP 32 137 137 ASP ASP A . n A 1 33 ALA 33 138 138 ALA ALA A . n A 1 34 HIS 34 139 139 HIS HIS A . n A 1 35 HIS 35 140 140 HIS HIS A . n A 1 36 LYS 36 141 141 LYS LYS A . n A 1 37 THR 37 142 142 THR THR A . n A 1 38 TYR 38 143 143 TYR TYR A . n A 1 39 ASP 39 144 144 ASP ASP A . n A 1 40 PRO 40 145 145 PRO PRO A . n A 1 41 THR 41 146 146 THR THR A . n A 1 42 TYR 42 147 147 TYR TYR A . n A 1 43 ALA 43 148 148 ALA ALA A . n A 1 44 ASP 44 149 149 ASP ASP A . n A 1 45 PHE 45 150 150 PHE PHE A . n A 1 46 ARG 46 151 151 ARG ARG A . n A 1 47 ASP 47 152 152 ASP ASP A . n A 1 48 PHE 48 153 153 PHE PHE A . n A 1 49 ARG 49 154 154 ARG ARG A . n A 1 50 PRO 50 155 155 PRO PRO A . n A 1 51 PRO 51 156 156 PRO PRO A . n A 1 52 VAL 52 157 157 VAL VAL A . n A 1 53 ARG 53 158 158 ARG ARG A . n A 1 54 MET 54 206 ? ? ? A . n A 1 55 ASP 55 207 ? ? ? A . n A 1 56 GLY 56 208 ? ? ? A . n A 1 57 SER 57 209 ? ? ? A . n A 1 58 THR 58 210 ? ? ? A . n A 1 59 GLY 59 211 ? ? ? A . n A 1 60 SER 60 212 ? ? ? A . n A 1 61 VAL 61 213 ? ? ? A . n A 1 62 THR 62 214 ? ? ? A . n A 1 63 LEU 63 215 ? ? ? A . n A 1 64 ASP 64 216 ? ? ? A . n A 1 65 LEU 65 217 ? ? ? A . n A 1 66 SER 66 218 ? ? ? A . n A 1 67 PRO 67 219 ? ? ? A . n A 1 68 LEU 68 220 220 LEU LEU A . n A 1 69 SER 69 221 221 SER SER A . n A 1 70 MET 70 222 222 MET MET A . n A 1 71 LEU 71 223 223 LEU LEU A . n A 1 72 PRO 72 224 224 PRO PRO A . n A 1 73 HIS 73 225 225 HIS HIS A . n A 1 74 LEU 74 226 226 LEU LEU A . n A 1 75 ALA 75 227 227 ALA ALA A . n A 1 76 ASP 76 228 228 ASP ASP A . n A 1 77 LEU 77 229 229 LEU LEU A . n A 1 78 VAL 78 230 230 VAL VAL A . n A 1 79 SER 79 231 231 SER SER A . n A 1 80 TYR 80 232 232 TYR TYR A . n A 1 81 SER 81 233 233 SER SER A . n A 1 82 ILE 82 234 234 ILE ILE A . n A 1 83 GLN 83 235 235 GLN GLN A . n A 1 84 LYS 84 236 236 LYS LYS A . n A 1 85 VAL 85 237 237 VAL VAL A . n A 1 86 ILE 86 238 238 ILE ILE A . n A 1 87 GLY 87 239 239 GLY GLY A . n A 1 88 PHE 88 240 240 PHE PHE A . n A 1 89 ALA 89 241 241 ALA ALA A . n A 1 90 LYS 90 242 242 LYS LYS A . n A 1 91 MET 91 243 243 MET MET A . n A 1 92 ILE 92 244 244 ILE ILE A . n A 1 93 PRO 93 245 245 PRO PRO A . n A 1 94 GLY 94 246 246 GLY GLY A . n A 1 95 PHE 95 247 247 PHE PHE A . n A 1 96 ARG 96 248 248 ARG ARG A . n A 1 97 ASP 97 249 249 ASP ASP A . n A 1 98 LEU 98 250 250 LEU LEU A . n A 1 99 THR 99 251 251 THR THR A . n A 1 100 SER 100 252 252 SER SER A . n A 1 101 ASP 101 253 253 ASP ASP A . n A 1 102 ASP 102 254 254 ASP ASP A . n A 1 103 GLN 103 255 255 GLN GLN A . n A 1 104 ILE 104 256 256 ILE ILE A . n A 1 105 VAL 105 257 257 VAL VAL A . n A 1 106 LEU 106 258 258 LEU LEU A . n A 1 107 LEU 107 259 259 LEU LEU A . n A 1 108 LYS 108 260 260 LYS LYS A . n A 1 109 SER 109 261 261 SER SER A . n A 1 110 SER 110 262 262 SER SER A . n A 1 111 ALA 111 263 263 ALA ALA A . n A 1 112 ILE 112 264 264 ILE ILE A . n A 1 113 GLU 113 265 265 GLU GLU A . n A 1 114 VAL 114 266 266 VAL VAL A . n A 1 115 ILE 115 267 267 ILE ILE A . n A 1 116 MET 116 268 268 MET MET A . n A 1 117 LEU 117 269 269 LEU LEU A . n A 1 118 ARG 118 270 270 ARG ARG A . n A 1 119 SER 119 271 271 SER SER A . n A 1 120 ASN 120 272 272 ASN ASN A . n A 1 121 GLN 121 273 273 GLN GLN A . n A 1 122 SER 122 274 274 SER SER A . n A 1 123 PHE 123 275 275 PHE PHE A . n A 1 124 THR 124 276 276 THR THR A . n A 1 125 MET 125 277 277 MET MET A . n A 1 126 ASP 126 278 278 ASP ASP A . n A 1 127 ASP 127 279 279 ASP ASP A . n A 1 128 MET 128 280 280 MET MET A . n A 1 129 SER 129 281 281 SER SER A . n A 1 130 TRP 130 282 282 TRP TRP A . n A 1 131 ASP 131 283 283 ASP ASP A . n A 1 132 CYS 132 284 284 CYS CYS A . n A 1 133 GLY 133 285 285 GLY GLY A . n A 1 134 SER 134 286 286 SER SER A . n A 1 135 GLN 135 287 287 GLN GLN A . n A 1 136 ASP 136 288 288 ASP ASP A . n A 1 137 TYR 137 289 289 TYR TYR A . n A 1 138 LYS 138 290 290 LYS LYS A . n A 1 139 TYR 139 291 291 TYR TYR A . n A 1 140 ASP 140 292 292 ASP ASP A . n A 1 141 VAL 141 293 293 VAL VAL A . n A 1 142 THR 142 294 294 THR THR A . n A 1 143 ASP 143 295 295 ASP ASP A . n A 1 144 VAL 144 296 296 VAL VAL A . n A 1 145 SER 145 297 297 SER SER A . n A 1 146 LYS 146 298 298 LYS LYS A . n A 1 147 ALA 147 299 299 ALA ALA A . n A 1 148 GLY 148 300 300 GLY GLY A . n A 1 149 HIS 149 301 301 HIS HIS A . n A 1 150 THR 150 302 302 THR THR A . n A 1 151 LEU 151 303 303 LEU LEU A . n A 1 152 GLU 152 304 304 GLU GLU A . n A 1 153 LEU 153 305 305 LEU LEU A . n A 1 154 ILE 154 306 306 ILE ILE A . n A 1 155 GLU 155 307 307 GLU GLU A . n A 1 156 PRO 156 308 308 PRO PRO A . n A 1 157 LEU 157 309 309 LEU LEU A . n A 1 158 ILE 158 310 310 ILE ILE A . n A 1 159 LYS 159 311 311 LYS LYS A . n A 1 160 PHE 160 312 312 PHE PHE A . n A 1 161 GLN 161 313 313 GLN GLN A . n A 1 162 VAL 162 314 314 VAL VAL A . n A 1 163 GLY 163 315 315 GLY GLY A . n A 1 164 LEU 164 316 316 LEU LEU A . n A 1 165 LYS 165 317 317 LYS LYS A . n A 1 166 LYS 166 318 318 LYS LYS A . n A 1 167 LEU 167 319 319 LEU LEU A . n A 1 168 ASN 168 320 320 ASN ASN A . n A 1 169 LEU 169 321 321 LEU LEU A . n A 1 170 HIS 170 322 322 HIS HIS A . n A 1 171 GLU 171 323 323 GLU GLU A . n A 1 172 GLU 172 324 324 GLU GLU A . n A 1 173 GLU 173 325 325 GLU GLU A . n A 1 174 HIS 174 326 326 HIS HIS A . n A 1 175 VAL 175 327 327 VAL VAL A . n A 1 176 LEU 176 328 328 LEU LEU A . n A 1 177 LEU 177 329 329 LEU LEU A . n A 1 178 MET 178 330 330 MET MET A . n A 1 179 ALA 179 331 331 ALA ALA A . n A 1 180 ILE 180 332 332 ILE ILE A . n A 1 181 CYS 181 333 333 CYS CYS A . n A 1 182 ILE 182 334 334 ILE ILE A . n A 1 183 VAL 183 335 335 VAL VAL A . n A 1 184 SER 184 336 336 SER SER A . n A 1 185 PRO 185 337 337 PRO PRO A . n A 1 186 ASP 186 338 338 ASP ASP A . n A 1 187 ARG 187 339 339 ARG ARG A . n A 1 188 PRO 188 340 340 PRO PRO A . n A 1 189 GLY 189 341 341 GLY GLY A . n A 1 190 VAL 190 342 342 VAL VAL A . n A 1 191 GLN 191 343 343 GLN GLN A . n A 1 192 ASP 192 344 344 ASP ASP A . n A 1 193 ALA 193 345 345 ALA ALA A . n A 1 194 LYS 194 346 346 LYS LYS A . n A 1 195 LEU 195 347 347 LEU LEU A . n A 1 196 VAL 196 348 348 VAL VAL A . n A 1 197 GLU 197 349 349 GLU GLU A . n A 1 198 ALA 198 350 350 ALA ALA A . n A 1 199 ILE 199 351 351 ILE ILE A . n A 1 200 GLN 200 352 352 GLN GLN A . n A 1 201 ASP 201 353 353 ASP ASP A . n A 1 202 ARG 202 354 354 ARG ARG A . n A 1 203 LEU 203 355 355 LEU LEU A . n A 1 204 SER 204 356 356 SER SER A . n A 1 205 ASN 205 357 357 ASN ASN A . n A 1 206 THR 206 358 358 THR THR A . n A 1 207 LEU 207 359 359 LEU LEU A . n A 1 208 GLN 208 360 360 GLN GLN A . n A 1 209 THR 209 361 361 THR THR A . n A 1 210 TYR 210 362 362 TYR TYR A . n A 1 211 ILE 211 363 363 ILE ILE A . n A 1 212 ARG 212 364 364 ARG ARG A . n A 1 213 CYS 213 365 365 CYS CYS A . n A 1 214 ARG 214 366 366 ARG ARG A . n A 1 215 HIS 215 367 367 HIS HIS A . n A 1 216 PRO 216 368 368 PRO PRO A . n A 1 217 PRO 217 369 369 PRO PRO A . n A 1 218 PRO 218 370 370 PRO PRO A . n A 1 219 GLY 219 371 371 GLY GLY A . n A 1 220 SER 220 372 372 SER SER A . n A 1 221 HIS 221 373 373 HIS HIS A . n A 1 222 GLN 222 374 374 GLN GLN A . n A 1 223 LEU 223 375 375 LEU LEU A . n A 1 224 TYR 224 376 376 TYR TYR A . n A 1 225 ALA 225 377 377 ALA ALA A . n A 1 226 LYS 226 378 378 LYS LYS A . n A 1 227 MET 227 379 379 MET MET A . n A 1 228 ILE 228 380 380 ILE ILE A . n A 1 229 GLN 229 381 381 GLN GLN A . n A 1 230 LYS 230 382 382 LYS LYS A . n A 1 231 LEU 231 383 383 LEU LEU A . n A 1 232 ALA 232 384 384 ALA ALA A . n A 1 233 ASP 233 385 385 ASP ASP A . n A 1 234 LEU 234 386 386 LEU LEU A . n A 1 235 ARG 235 387 387 ARG ARG A . n A 1 236 SER 236 388 388 SER SER A . n A 1 237 LEU 237 389 389 LEU LEU A . n A 1 238 ASN 238 390 390 ASN ASN A . n A 1 239 GLU 239 391 391 GLU GLU A . n A 1 240 GLU 240 392 392 GLU GLU A . n A 1 241 HIS 241 393 393 HIS HIS A . n A 1 242 SER 242 394 394 SER SER A . n A 1 243 LYS 243 395 395 LYS LYS A . n A 1 244 GLN 244 396 396 GLN GLN A . n A 1 245 TYR 245 397 397 TYR TYR A . n A 1 246 ARG 246 398 398 ARG ARG A . n A 1 247 SER 247 399 399 SER SER A . n A 1 248 LEU 248 400 400 LEU LEU A . n A 1 249 SER 249 401 401 SER SER A . n A 1 250 PHE 250 402 402 PHE PHE A . n A 1 251 GLN 251 403 403 GLN GLN A . n A 1 252 PRO 252 404 404 PRO PRO A . n A 1 253 GLU 253 405 405 GLU GLU A . n A 1 254 ASN 254 406 406 ASN ASN A . n A 1 255 SER 255 407 407 SER SER A . n A 1 256 MET 256 408 408 MET MET A . n A 1 257 LYS 257 409 409 LYS LYS A . n A 1 258 LEU 258 410 410 LEU LEU A . n A 1 259 THR 259 411 411 THR THR A . n A 1 260 PRO 260 412 412 PRO PRO A . n A 1 261 LEU 261 413 413 LEU LEU A . n A 1 262 VAL 262 414 414 VAL VAL A . n A 1 263 LEU 263 415 415 LEU LEU A . n A 1 264 GLU 264 416 416 GLU GLU A . n A 1 265 VAL 265 417 417 VAL VAL A . n A 1 266 PHE 266 418 418 PHE PHE A . n A 1 267 GLY 267 419 419 GLY GLY A . n A 1 268 ASN 268 420 420 ASN ASN A . n A 1 269 GLU 269 421 ? ? ? A . n A 1 270 ILE 270 422 ? ? ? A . n A 1 271 SER 271 423 ? ? ? A . n B 2 1 LYS 1 625 625 LYS LYS C . n B 2 2 ASN 2 626 626 ASN ASN C . n B 2 3 HIS 3 627 627 HIS HIS C . n B 2 4 PRO 4 628 628 PRO PRO C . n B 2 5 MET 5 629 629 MET MET C . n B 2 6 LEU 6 630 630 LEU LEU C . n B 2 7 MET 7 631 631 MET MET C . n B 2 8 ASN 8 632 632 ASN ASN C . n B 2 9 LEU 9 633 633 LEU LEU C . n B 2 10 LEU 10 634 634 LEU LEU C . n B 2 11 LYS 11 635 635 LYS LYS C . n B 2 12 ASP 12 636 ? ? ? C . n B 2 13 ASN 13 637 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 9KR 1 501 1 9KR YMH A . D 4 HOH 1 601 151 HOH HOH A . D 4 HOH 2 602 149 HOH HOH A . D 4 HOH 3 603 57 HOH HOH A . D 4 HOH 4 604 136 HOH HOH A . D 4 HOH 5 605 142 HOH HOH A . D 4 HOH 6 606 150 HOH HOH A . D 4 HOH 7 607 153 HOH HOH A . D 4 HOH 8 608 41 HOH HOH A . D 4 HOH 9 609 141 HOH HOH A . D 4 HOH 10 610 127 HOH HOH A . D 4 HOH 11 611 135 HOH HOH A . D 4 HOH 12 612 29 HOH HOH A . D 4 HOH 13 613 118 HOH HOH A . D 4 HOH 14 614 7 HOH HOH A . D 4 HOH 15 615 14 HOH HOH A . D 4 HOH 16 616 16 HOH HOH A . D 4 HOH 17 617 138 HOH HOH A . D 4 HOH 18 618 119 HOH HOH A . D 4 HOH 19 619 56 HOH HOH A . D 4 HOH 20 620 143 HOH HOH A . D 4 HOH 21 621 32 HOH HOH A . D 4 HOH 22 622 160 HOH HOH A . D 4 HOH 23 623 134 HOH HOH A . D 4 HOH 24 624 133 HOH HOH A . D 4 HOH 25 625 6 HOH HOH A . D 4 HOH 26 626 1 HOH HOH A . D 4 HOH 27 627 131 HOH HOH A . D 4 HOH 28 628 33 HOH HOH A . D 4 HOH 29 629 21 HOH HOH A . D 4 HOH 30 630 129 HOH HOH A . D 4 HOH 31 631 11 HOH HOH A . D 4 HOH 32 632 144 HOH HOH A . D 4 HOH 33 633 159 HOH HOH A . D 4 HOH 34 634 15 HOH HOH A . D 4 HOH 35 635 147 HOH HOH A . D 4 HOH 36 636 4 HOH HOH A . D 4 HOH 37 637 26 HOH HOH A . D 4 HOH 38 638 30 HOH HOH A . D 4 HOH 39 639 17 HOH HOH A . D 4 HOH 40 640 83 HOH HOH A . D 4 HOH 41 641 128 HOH HOH A . D 4 HOH 42 642 140 HOH HOH A . D 4 HOH 43 643 23 HOH HOH A . D 4 HOH 44 644 126 HOH HOH A . D 4 HOH 45 645 25 HOH HOH A . D 4 HOH 46 646 12 HOH HOH A . D 4 HOH 47 647 146 HOH HOH A . D 4 HOH 48 648 145 HOH HOH A . D 4 HOH 49 649 22 HOH HOH A . D 4 HOH 50 650 165 HOH HOH A . D 4 HOH 51 651 130 HOH HOH A . D 4 HOH 52 652 60 HOH HOH A . D 4 HOH 53 653 10 HOH HOH A . D 4 HOH 54 654 37 HOH HOH A . D 4 HOH 55 655 53 HOH HOH A . D 4 HOH 56 656 44 HOH HOH A . D 4 HOH 57 657 137 HOH HOH A . D 4 HOH 58 658 155 HOH HOH A . D 4 HOH 59 659 116 HOH HOH A . D 4 HOH 60 660 161 HOH HOH A . D 4 HOH 61 661 13 HOH HOH A . D 4 HOH 62 662 156 HOH HOH A . D 4 HOH 63 663 164 HOH HOH A . D 4 HOH 64 664 162 HOH HOH A . D 4 HOH 65 665 62 HOH HOH A . D 4 HOH 66 666 154 HOH HOH A . D 4 HOH 67 667 84 HOH HOH A . D 4 HOH 68 668 19 HOH HOH A . D 4 HOH 69 669 163 HOH HOH A . D 4 HOH 70 670 74 HOH HOH A . D 4 HOH 71 671 152 HOH HOH A . D 4 HOH 72 672 158 HOH HOH A . E 4 HOH 1 701 9 HOH HOH C . E 4 HOH 2 702 38 HOH HOH C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1160 ? 1 MORE -10 ? 1 'SSA (A^2)' 11110 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-07-18 2 'Structure model' 1 1 2018-08-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 123 ? CG ? A LYS 18 CG 2 1 Y 1 A LYS 123 ? CD ? A LYS 18 CD 3 1 Y 1 A LYS 123 ? CE ? A LYS 18 CE 4 1 Y 1 A LYS 123 ? NZ ? A LYS 18 NZ 5 1 Y 1 A GLU 126 ? CG ? A GLU 21 CG 6 1 Y 1 A GLU 126 ? CD ? A GLU 21 CD 7 1 Y 1 A GLU 126 ? OE1 ? A GLU 21 OE1 8 1 Y 1 A GLU 126 ? OE2 ? A GLU 21 OE2 9 1 Y 1 A ARG 151 ? CG ? A ARG 46 CG 10 1 Y 1 A ARG 151 ? CD ? A ARG 46 CD 11 1 Y 1 A ARG 151 ? NE ? A ARG 46 NE 12 1 Y 1 A ARG 151 ? CZ ? A ARG 46 CZ 13 1 Y 1 A ARG 151 ? NH1 ? A ARG 46 NH1 14 1 Y 1 A ARG 151 ? NH2 ? A ARG 46 NH2 15 1 Y 1 A LYS 346 ? CG ? A LYS 194 CG 16 1 Y 1 A LYS 346 ? CD ? A LYS 194 CD 17 1 Y 1 A LYS 346 ? CE ? A LYS 194 CE 18 1 Y 1 A LYS 346 ? NZ ? A LYS 194 NZ 19 1 Y 1 A ARG 364 ? CG ? A ARG 212 CG 20 1 Y 1 A ARG 364 ? CD ? A ARG 212 CD 21 1 Y 1 A ARG 364 ? NE ? A ARG 212 NE 22 1 Y 1 A ARG 364 ? CZ ? A ARG 212 CZ 23 1 Y 1 A ARG 364 ? NH1 ? A ARG 212 NH1 24 1 Y 1 A ARG 364 ? NH2 ? A ARG 212 NH2 25 1 Y 1 A LYS 395 ? CG ? A LYS 243 CG 26 1 Y 1 A LYS 395 ? CD ? A LYS 243 CD 27 1 Y 1 A LYS 395 ? CE ? A LYS 243 CE 28 1 Y 1 A LYS 395 ? NZ ? A LYS 243 NZ 29 1 Y 1 A ARG 398 ? CG ? A ARG 246 CG 30 1 Y 1 A ARG 398 ? CD ? A ARG 246 CD 31 1 Y 1 A ARG 398 ? NE ? A ARG 246 NE 32 1 Y 1 A ARG 398 ? CZ ? A ARG 246 CZ 33 1 Y 1 A ARG 398 ? NH1 ? A ARG 246 NH1 34 1 Y 1 A ARG 398 ? NH2 ? A ARG 246 NH2 35 1 Y 1 A PHE 402 ? CG ? A PHE 250 CG 36 1 Y 1 A PHE 402 ? CD1 ? A PHE 250 CD1 37 1 Y 1 A PHE 402 ? CD2 ? A PHE 250 CD2 38 1 Y 1 A PHE 402 ? CE1 ? A PHE 250 CE1 39 1 Y 1 A PHE 402 ? CE2 ? A PHE 250 CE2 40 1 Y 1 A PHE 402 ? CZ ? A PHE 250 CZ 41 1 Y 1 A GLN 403 ? CG ? A GLN 251 CG 42 1 Y 1 A GLN 403 ? CD ? A GLN 251 CD 43 1 Y 1 A GLN 403 ? OE1 ? A GLN 251 OE1 44 1 Y 1 A GLN 403 ? NE2 ? A GLN 251 NE2 45 1 Y 1 C LYS 625 ? CG ? B LYS 1 CG 46 1 Y 1 C LYS 625 ? CD ? B LYS 1 CD 47 1 Y 1 C LYS 625 ? CE ? B LYS 1 CE 48 1 Y 1 C LYS 625 ? NZ ? B LYS 1 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 106 ? A GLY 1 2 1 Y 1 A SER 107 ? A SER 2 3 1 Y 1 A HIS 108 ? A HIS 3 4 1 Y 1 A MET 109 ? A MET 4 5 1 Y 1 A GLY 110 ? A GLY 5 6 1 Y 1 A SER 111 ? A SER 6 7 1 Y 1 A PRO 112 ? A PRO 7 8 1 Y 1 A ASN 113 ? A ASN 8 9 1 Y 1 A SER 114 ? A SER 9 10 1 Y 1 A PRO 115 ? A PRO 10 11 1 Y 1 A LEU 116 ? A LEU 11 12 1 Y 1 A LYS 117 ? A LYS 12 13 1 Y 1 A ASP 118 ? A ASP 13 14 1 Y 1 A SER 119 ? A SER 14 15 1 Y 1 A LEU 120 ? A LEU 15 16 1 Y 1 A ARG 121 ? A ARG 16 17 1 Y 1 A PRO 122 ? A PRO 17 18 1 Y 1 A MET 206 ? A MET 54 19 1 Y 1 A ASP 207 ? A ASP 55 20 1 Y 1 A GLY 208 ? A GLY 56 21 1 Y 1 A SER 209 ? A SER 57 22 1 Y 1 A THR 210 ? A THR 58 23 1 Y 1 A GLY 211 ? A GLY 59 24 1 Y 1 A SER 212 ? A SER 60 25 1 Y 1 A VAL 213 ? A VAL 61 26 1 Y 1 A THR 214 ? A THR 62 27 1 Y 1 A LEU 215 ? A LEU 63 28 1 Y 1 A ASP 216 ? A ASP 64 29 1 Y 1 A LEU 217 ? A LEU 65 30 1 Y 1 A SER 218 ? A SER 66 31 1 Y 1 A PRO 219 ? A PRO 67 32 1 Y 1 A GLU 421 ? A GLU 269 33 1 Y 1 A ILE 422 ? A ILE 270 34 1 Y 1 A SER 423 ? A SER 271 35 1 Y 1 C ASP 636 ? B ASP 12 36 1 Y 1 C ASN 637 ? B ASN 13 # _pdbx_audit_support.funding_organization ? _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 ;(E,7R)-7-[(1R,3aS,4E,7aR)-7a-methyl-4-[2-[(3R,5R)-4-methylidene-3,5-bis(oxidanyl)cyclohexylidene]ethylidene]-2,3,3a,5,6,7-hexahydro-1H-inden-1-yl]oct-2-en-4-one ; 9KR 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? #