data_5A9H # _entry.id 5A9H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.308 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5A9H PDBE EBI-64457 WWPDB D_1290064457 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 5A9D unspecified 'CRYSTAL STRUCTURE OF THE EXTRACELLULAR DOMAIN OF PEPT1' PDB 5A9I unspecified 'CRYSTAL STRUCTURE OF THE EXTRACELLULAR DOMAIN OF PEPT2' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 5A9H _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2015-07-21 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Beale, J.H.' 1 'Newstead, S.' 2 # _citation.id primary _citation.title 'Crystal Structures of the Extracellular Domain from Pept1 and Pept2 Provide Novel Insights Into Mammalian Peptide Transport' _citation.journal_abbrev Structure _citation.journal_volume 23 _citation.page_first 1889 _citation.page_last ? _citation.year 2015 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26320580 _citation.pdbx_database_id_DOI 10.1016/J.STR.2015.07.016 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Beale, J.H.' 1 ? primary 'Parker, J.L.' 2 ? primary 'Samsudin, F.' 3 ? primary 'Barrett, A.L.' 4 ? primary 'Senan, A.' 5 ? primary 'Bird, L.E.' 6 ? primary 'Scott, D.' 7 ? primary 'Owens, R.J.' 8 ? primary 'Sanson, M.S.P.' 9 ? primary 'Tucker, S.J.' 10 ? primary 'Meredith, D.' 11 ? primary 'Fowler, P.W.' 12 ? primary 'Newstead, S.' 13 ? # _cell.entry_id 5A9H _cell.length_a 43.070 _cell.length_b 43.070 _cell.length_c 220.530 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5A9H _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SOLUTE CARRIER FAMILY 15 MEMBER 2' 21554.250 1 ? ? 'EXTRACELLULAR DOMAIN, RESIDUES 410-601' ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 non-polymer syn 'CESIUM ION' 132.905 2 ? ? ? ? 4 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 5 water nat water 18.015 94 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PEPT2, KIDNEY H(+)/PEPTIDE COTRANSPORTER, OLIGOPEPTIDE TRANSPORTER, KIDNEY ISOFORM, PEPTIDE TRANSPORTER 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAASQEIFLQVLNLADGDVKVTVLGSRNNSLLVESVSSFQNTTHYSKLHLEAKSQDLHFHLKYNSLSVHNDHSVEEKNCY QLLIHQDGESISSMLVKDTGIKPANGMAAIRFINTLHKDLNISLDTDAPLSVGKDYGVSAYRTVLRGKYPAVHCETEDKV FSLDLGQLDFGTTYLFVITNITSQGLQAWKAEDI ; _entity_poly.pdbx_seq_one_letter_code_can ;MAASQEIFLQVLNLADGDVKVTVLGSRNNSLLVESVSSFQNTTHYSKLHLEAKSQDLHFHLKYNSLSVHNDHSVEEKNCY QLLIHQDGESISSMLVKDTGIKPANGMAAIRFINTLHKDLNISLDTDAPLSVGKDYGVSAYRTVLRGKYPAVHCETEDKV FSLDLGQLDFGTTYLFVITNITSQGLQAWKAEDI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 SER n 1 5 GLN n 1 6 GLU n 1 7 ILE n 1 8 PHE n 1 9 LEU n 1 10 GLN n 1 11 VAL n 1 12 LEU n 1 13 ASN n 1 14 LEU n 1 15 ALA n 1 16 ASP n 1 17 GLY n 1 18 ASP n 1 19 VAL n 1 20 LYS n 1 21 VAL n 1 22 THR n 1 23 VAL n 1 24 LEU n 1 25 GLY n 1 26 SER n 1 27 ARG n 1 28 ASN n 1 29 ASN n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 VAL n 1 34 GLU n 1 35 SER n 1 36 VAL n 1 37 SER n 1 38 SER n 1 39 PHE n 1 40 GLN n 1 41 ASN n 1 42 THR n 1 43 THR n 1 44 HIS n 1 45 TYR n 1 46 SER n 1 47 LYS n 1 48 LEU n 1 49 HIS n 1 50 LEU n 1 51 GLU n 1 52 ALA n 1 53 LYS n 1 54 SER n 1 55 GLN n 1 56 ASP n 1 57 LEU n 1 58 HIS n 1 59 PHE n 1 60 HIS n 1 61 LEU n 1 62 LYS n 1 63 TYR n 1 64 ASN n 1 65 SER n 1 66 LEU n 1 67 SER n 1 68 VAL n 1 69 HIS n 1 70 ASN n 1 71 ASP n 1 72 HIS n 1 73 SER n 1 74 VAL n 1 75 GLU n 1 76 GLU n 1 77 LYS n 1 78 ASN n 1 79 CYS n 1 80 TYR n 1 81 GLN n 1 82 LEU n 1 83 LEU n 1 84 ILE n 1 85 HIS n 1 86 GLN n 1 87 ASP n 1 88 GLY n 1 89 GLU n 1 90 SER n 1 91 ILE n 1 92 SER n 1 93 SER n 1 94 MET n 1 95 LEU n 1 96 VAL n 1 97 LYS n 1 98 ASP n 1 99 THR n 1 100 GLY n 1 101 ILE n 1 102 LYS n 1 103 PRO n 1 104 ALA n 1 105 ASN n 1 106 GLY n 1 107 MET n 1 108 ALA n 1 109 ALA n 1 110 ILE n 1 111 ARG n 1 112 PHE n 1 113 ILE n 1 114 ASN n 1 115 THR n 1 116 LEU n 1 117 HIS n 1 118 LYS n 1 119 ASP n 1 120 LEU n 1 121 ASN n 1 122 ILE n 1 123 SER n 1 124 LEU n 1 125 ASP n 1 126 THR n 1 127 ASP n 1 128 ALA n 1 129 PRO n 1 130 LEU n 1 131 SER n 1 132 VAL n 1 133 GLY n 1 134 LYS n 1 135 ASP n 1 136 TYR n 1 137 GLY n 1 138 VAL n 1 139 SER n 1 140 ALA n 1 141 TYR n 1 142 ARG n 1 143 THR n 1 144 VAL n 1 145 LEU n 1 146 ARG n 1 147 GLY n 1 148 LYS n 1 149 TYR n 1 150 PRO n 1 151 ALA n 1 152 VAL n 1 153 HIS n 1 154 CYS n 1 155 GLU n 1 156 THR n 1 157 GLU n 1 158 ASP n 1 159 LYS n 1 160 VAL n 1 161 PHE n 1 162 SER n 1 163 LEU n 1 164 ASP n 1 165 LEU n 1 166 GLY n 1 167 GLN n 1 168 LEU n 1 169 ASP n 1 170 PHE n 1 171 GLY n 1 172 THR n 1 173 THR n 1 174 TYR n 1 175 LEU n 1 176 PHE n 1 177 VAL n 1 178 ILE n 1 179 THR n 1 180 ASN n 1 181 ILE n 1 182 THR n 1 183 SER n 1 184 GLN n 1 185 GLY n 1 186 LEU n 1 187 GLN n 1 188 ALA n 1 189 TRP n 1 190 LYS n 1 191 ALA n 1 192 GLU n 1 193 ASP n 1 194 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'NORWAY RAT' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'RATTUS NORVEGICUS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PLOU3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S15A2_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q63424 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5A9H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 194 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q63424 _struct_ref_seq.db_align_beg 410 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 601 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 410 _struct_ref_seq.pdbx_auth_seq_align_end 601 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5A9H MET A 1 ? UNP Q63424 ? ? 'expression tag' 408 1 1 5A9H ALA A 2 ? UNP Q63424 ? ? 'expression tag' 409 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CS non-polymer . 'CESIUM ION' ? 'Cs 1' 132.905 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 5A9H _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_percent_sol 49 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.2 M CSCL2, 15 % PEG 3350 AT 20 DEGREES CELCIUS' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2013-06-24 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97626 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_wavelength 0.97626 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 5A9H _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.46 _reflns.d_resolution_high 2.06 _reflns.number_obs 13761 _reflns.number_all ? _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.50 _reflns.B_iso_Wilson_estimate 41.30 _reflns.pdbx_redundancy 4.1 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.06 _reflns_shell.d_res_low 2.12 _reflns_shell.percent_possible_all 99.5 _reflns_shell.Rmerge_I_obs 0.67 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.30 _reflns_shell.pdbx_redundancy 4.3 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5A9H _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 13761 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.46 _refine.ls_d_res_high 2.06 _refine.ls_percent_reflns_obs 99.88 _refine.ls_R_factor_obs 0.1979 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1961 _refine.ls_R_factor_R_free 0.2334 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.01 _refine.ls_number_reflns_R_free 690 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.9508 _refine.correlation_coeff_Fo_to_Fc_free 0.9341 _refine.B_iso_mean 48.79 _refine.aniso_B[1][1] 0.0579 _refine.aniso_B[2][2] 0.0579 _refine.aniso_B[3][3] -0.1159 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;IDEAL-DIST CONTACT TERM CONTACT SETUP. RESIDUE TYPES WITHOUT CCP4 ATOM TYPE IN LIBRARY=CS. NUMBER OF ATOMS WITH PROPER CCP4 ATOM TYPE=1622. NUMBER WITH APPROX DEFAULT CCP4 ATOM TYPE=0. NUMBER TREATED BY BAD NON-BONDED CONTACTS=2. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI 0.190 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.165 _refine.pdbx_overall_SU_R_Blow_DPI 0.210 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.171 # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 5A9H _refine_analyze.Luzzati_coordinate_error_obs 0.327 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1481 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 94 _refine_hist.number_atoms_total 1587 _refine_hist.d_res_high 2.06 _refine_hist.d_res_low 30.46 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.010 ? 2.00 1557 'X-RAY DIFFRACTION' HARMONIC t_angle_deg 1.24 ? 2.00 2114 'X-RAY DIFFRACTION' HARMONIC t_dihedral_angle_d ? ? 2.00 544 'X-RAY DIFFRACTION' SINUSOIDAL t_incorr_chiral_ct ? ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes ? ? 2.00 44 'X-RAY DIFFRACTION' HARMONIC t_gen_planes ? ? 5.00 225 'X-RAY DIFFRACTION' HARMONIC t_it ? ? 20.00 1557 'X-RAY DIFFRACTION' HARMONIC t_nbd ? ? 5.00 5 'X-RAY DIFFRACTION' SEMIHARMONIC t_omega_torsion 3.99 ? ? ? 'X-RAY DIFFRACTION' ? t_other_torsion 18.82 ? ? ? 'X-RAY DIFFRACTION' ? t_improper_torsion ? ? ? ? 'X-RAY DIFFRACTION' ? t_chiral_improper_torsion ? ? 5.00 204 'X-RAY DIFFRACTION' SEMIHARMONIC t_sum_occupancies ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_distance ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_torsion ? ? ? ? 'X-RAY DIFFRACTION' ? t_ideal_dist_contact ? ? 4.00 1736 'X-RAY DIFFRACTION' SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 7 _refine_ls_shell.d_res_high 2.06 _refine_ls_shell.d_res_low 2.23 _refine_ls_shell.number_reflns_R_work 2567 _refine_ls_shell.R_factor_R_work 0.2138 _refine_ls_shell.percent_reflns_obs 99.88 _refine_ls_shell.R_factor_R_free 0.2638 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 5.87 _refine_ls_shell.number_reflns_R_free 160 _refine_ls_shell.number_reflns_all 2727 _refine_ls_shell.R_factor_all 0.2166 # _struct.entry_id 5A9H _struct.title 'Crystal structure of the extracellular domain of PepT2' _struct.pdbx_descriptor 'SOLUTE CARRIER FAMILY 15 MEMBER 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5A9H _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'TRANSPORT PROTEIN, PEPT2, EXTRACELLULAR DOMAIN, MFS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 3 ? F N N 5 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? C CS . CS ? ? ? 1_555 A GLU 34 OE1 ? ? A CS 1603 A GLU 441 7_555 ? ? ? ? ? ? ? 2.558 ? metalc2 metalc ? ? C CS . CS ? ? ? 1_555 A GLU 34 OE2 ? ? A CS 1603 A GLU 441 7_555 ? ? ? ? ? ? ? 2.866 ? metalc3 metalc ? ? C CS . CS ? ? ? 1_555 F HOH . O ? ? A CS 1603 A HOH 2093 1_555 ? ? ? ? ? ? ? 2.578 ? metalc4 metalc ? ? E CS . CS ? ? ? 1_555 A ASP 158 OD2 ? ? A CS 1605 A ASP 565 5_555 ? ? ? ? ? ? ? 2.799 ? metalc5 metalc ? ? E CS . CS ? ? ? 1_555 A ASP 71 OD1 ? ? A CS 1605 A ASP 478 1_555 ? ? ? ? ? ? ? 2.529 ? metalc6 metalc ? ? E CS . CS ? ? ? 1_555 A ASP 71 OD2 ? ? A CS 1605 A ASP 478 1_555 ? ? ? ? ? ? ? 2.508 ? metalc7 metalc ? ? E CS . CS ? ? ? 1_555 A ASP 158 OD1 ? ? A CS 1605 A ASP 565 5_555 ? ? ? ? ? ? ? 2.531 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLN 40 A . ? GLN 447 A ASN 41 A ? ASN 448 A 1 1.89 2 THR 156 A . ? THR 563 A GLU 157 A ? GLU 564 A 1 -10.58 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 4 ? AB ? 4 ? AC ? 2 ? AD ? 2 ? AE ? 4 ? AF ? 4 ? AG ? 4 ? AH ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? parallel AA 3 4 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AC 1 2 ? anti-parallel AD 1 2 ? anti-parallel AE 1 2 ? anti-parallel AE 2 3 ? parallel AE 3 4 ? anti-parallel AF 1 2 ? anti-parallel AF 2 3 ? parallel AF 3 4 ? anti-parallel AG 1 2 ? anti-parallel AG 2 3 ? anti-parallel AG 3 4 ? anti-parallel AH 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 SER A 46 ? HIS A 49 ? SER A 453 HIS A 456 AA 2 GLU A 6 ? ASN A 13 ? GLU A 413 ASN A 420 AA 3 CYS A 79 ? ASP A 87 ? CYS A 486 ASP A 494 AA 4 SER A 90 ? LYS A 97 ? SER A 497 LYS A 504 AB 1 SER A 30 ? VAL A 36 ? SER A 437 VAL A 443 AB 2 VAL A 19 ? LEU A 24 ? VAL A 426 LEU A 431 AB 3 SER A 54 ? TYR A 63 ? SER A 461 TYR A 470 AB 4 LEU A 66 ? GLU A 75 ? LEU A 473 GLU A 482 AC 1 GLY A 137 ? VAL A 138 ? GLY A 544 VAL A 545 AC 2 MET A 107 ? ASN A 114 ? MET A 514 ASN A 521 AD 1 ARG A 142 ? LEU A 145 ? ARG A 549 LEU A 552 AD 2 MET A 107 ? ASN A 114 ? MET A 514 ASN A 521 AE 1 ALA A 188 ? GLU A 192 ? ALA A 595 GLU A 599 AE 2 THR A 173 ? ILE A 178 ? THR A 580 ILE A 585 AE 3 MET A 107 ? ASN A 114 ? MET A 514 ASN A 521 AE 4 GLY A 137 ? VAL A 138 ? GLY A 544 VAL A 545 AF 1 ALA A 188 ? GLU A 192 ? ALA A 595 GLU A 599 AF 2 THR A 173 ? ILE A 178 ? THR A 580 ILE A 585 AF 3 MET A 107 ? ASN A 114 ? MET A 514 ASN A 521 AF 4 ARG A 142 ? LEU A 145 ? ARG A 549 LEU A 552 AG 1 LEU A 130 ? VAL A 132 ? LEU A 537 VAL A 539 AG 2 LEU A 120 ? SER A 123 ? LEU A 527 SER A 530 AG 3 VAL A 152 ? GLU A 155 ? VAL A 559 GLU A 562 AG 4 VAL A 160 ? LEU A 163 ? VAL A 567 LEU A 570 AH 1 GLY A 147 ? LYS A 148 ? GLY A 554 LYS A 555 AH 2 GLN A 167 ? LEU A 168 ? GLN A 574 LEU A 575 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N LEU A 48 ? N LEU A 455 O ILE A 7 ? O ILE A 414 AA 2 3 N GLN A 10 ? N GLN A 417 O TYR A 80 ? O TYR A 487 AA 3 4 N ASP A 87 ? N ASP A 494 O SER A 90 ? O SER A 497 AB 1 2 N VAL A 36 ? N VAL A 443 O VAL A 19 ? O VAL A 426 AB 2 3 N LEU A 24 ? N LEU A 431 O HIS A 58 ? O HIS A 465 AB 3 4 N TYR A 63 ? N TYR A 470 O LEU A 66 ? O LEU A 473 AC 1 2 O GLY A 137 ? O GLY A 544 N ASN A 114 ? N ASN A 521 AD 1 2 N VAL A 144 ? N VAL A 551 O ALA A 108 ? O ALA A 515 AE 1 2 N ALA A 191 ? N ALA A 598 O LEU A 175 ? O LEU A 582 AE 2 3 N TYR A 174 ? N TYR A 581 O ALA A 109 ? O ALA A 516 AE 3 4 N ASN A 114 ? N ASN A 521 O GLY A 137 ? O GLY A 544 AF 1 2 N ALA A 191 ? N ALA A 598 O LEU A 175 ? O LEU A 582 AF 2 3 N TYR A 174 ? N TYR A 581 O ALA A 109 ? O ALA A 516 AF 3 4 N ILE A 110 ? N ILE A 517 O ARG A 142 ? O ARG A 549 AG 1 2 N VAL A 132 ? N VAL A 539 O LEU A 120 ? O LEU A 527 AG 2 3 N SER A 123 ? N SER A 530 O HIS A 153 ? O HIS A 560 AG 3 4 N CYS A 154 ? N CYS A 561 O PHE A 161 ? O PHE A 568 AH 1 2 N GLY A 147 ? N GLY A 554 O LEU A 168 ? O LEU A 575 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 1602' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CS A 1603' AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE ACT A 1604' AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CS A 1605' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 56 ? ASP A 463 . ? 1_555 ? 2 AC1 5 HIS A 72 ? HIS A 479 . ? 1_555 ? 3 AC1 5 SER A 73 ? SER A 480 . ? 1_555 ? 4 AC1 5 LYS A 118 ? LYS A 525 . ? 5_555 ? 5 AC1 5 HOH F . ? HOH A 2041 . ? 1_555 ? 6 AC2 4 GLU A 34 ? GLU A 441 . ? 7_555 ? 7 AC2 4 HIS A 44 ? HIS A 451 . ? 7_555 ? 8 AC2 4 HIS A 44 ? HIS A 451 . ? 1_555 ? 9 AC2 4 HOH F . ? HOH A 2093 . ? 1_555 ? 10 AC3 8 SER A 35 ? SER A 442 . ? 1_555 ? 11 AC3 8 SER A 37 ? SER A 444 . ? 1_555 ? 12 AC3 8 ASN A 41 ? ASN A 448 . ? 1_555 ? 13 AC3 8 HOH F . ? HOH A 2016 . ? 1_555 ? 14 AC3 8 HOH F . ? HOH A 2025 . ? 7_555 ? 15 AC3 8 HOH F . ? HOH A 2093 . ? 1_555 ? 16 AC3 8 HOH F . ? HOH A 2094 . ? 7_555 ? 17 AC3 8 HOH F . ? HOH A 2094 . ? 1_555 ? 18 AC4 4 HIS A 58 ? HIS A 465 . ? 1_555 ? 19 AC4 4 HIS A 69 ? HIS A 476 . ? 1_555 ? 20 AC4 4 ASP A 71 ? ASP A 478 . ? 1_555 ? 21 AC4 4 ASP A 158 ? ASP A 565 . ? 5_555 ? # _database_PDB_matrix.entry_id 5A9H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5A9H _atom_sites.fract_transf_matrix[1][1] 0.023218 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023218 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004535 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CS H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 408 408 MET MET A . n A 1 2 ALA 2 409 409 ALA ALA A . n A 1 3 ALA 3 410 410 ALA ALA A . n A 1 4 SER 4 411 411 SER SER A . n A 1 5 GLN 5 412 412 GLN GLN A . n A 1 6 GLU 6 413 413 GLU GLU A . n A 1 7 ILE 7 414 414 ILE ILE A . n A 1 8 PHE 8 415 415 PHE PHE A . n A 1 9 LEU 9 416 416 LEU LEU A . n A 1 10 GLN 10 417 417 GLN GLN A . n A 1 11 VAL 11 418 418 VAL VAL A . n A 1 12 LEU 12 419 419 LEU LEU A . n A 1 13 ASN 13 420 420 ASN ASN A . n A 1 14 LEU 14 421 421 LEU LEU A . n A 1 15 ALA 15 422 422 ALA ALA A . n A 1 16 ASP 16 423 423 ASP ASP A . n A 1 17 GLY 17 424 424 GLY GLY A . n A 1 18 ASP 18 425 425 ASP ASP A . n A 1 19 VAL 19 426 426 VAL VAL A . n A 1 20 LYS 20 427 427 LYS LYS A . n A 1 21 VAL 21 428 428 VAL VAL A . n A 1 22 THR 22 429 429 THR THR A . n A 1 23 VAL 23 430 430 VAL VAL A . n A 1 24 LEU 24 431 431 LEU LEU A . n A 1 25 GLY 25 432 432 GLY GLY A . n A 1 26 SER 26 433 433 SER SER A . n A 1 27 ARG 27 434 434 ARG ARG A . n A 1 28 ASN 28 435 435 ASN ASN A . n A 1 29 ASN 29 436 436 ASN ASN A . n A 1 30 SER 30 437 437 SER SER A . n A 1 31 LEU 31 438 438 LEU LEU A . n A 1 32 LEU 32 439 439 LEU LEU A . n A 1 33 VAL 33 440 440 VAL VAL A . n A 1 34 GLU 34 441 441 GLU GLU A . n A 1 35 SER 35 442 442 SER SER A . n A 1 36 VAL 36 443 443 VAL VAL A . n A 1 37 SER 37 444 444 SER SER A . n A 1 38 SER 38 445 445 SER SER A . n A 1 39 PHE 39 446 446 PHE PHE A . n A 1 40 GLN 40 447 447 GLN GLN A . n A 1 41 ASN 41 448 448 ASN ASN A . n A 1 42 THR 42 449 449 THR THR A . n A 1 43 THR 43 450 450 THR THR A . n A 1 44 HIS 44 451 451 HIS HIS A . n A 1 45 TYR 45 452 452 TYR TYR A . n A 1 46 SER 46 453 453 SER SER A . n A 1 47 LYS 47 454 454 LYS LYS A . n A 1 48 LEU 48 455 455 LEU LEU A . n A 1 49 HIS 49 456 456 HIS HIS A . n A 1 50 LEU 50 457 457 LEU LEU A . n A 1 51 GLU 51 458 458 GLU GLU A . n A 1 52 ALA 52 459 459 ALA ALA A . n A 1 53 LYS 53 460 460 LYS LYS A . n A 1 54 SER 54 461 461 SER SER A . n A 1 55 GLN 55 462 462 GLN GLN A . n A 1 56 ASP 56 463 463 ASP ASP A . n A 1 57 LEU 57 464 464 LEU LEU A . n A 1 58 HIS 58 465 465 HIS HIS A . n A 1 59 PHE 59 466 466 PHE PHE A . n A 1 60 HIS 60 467 467 HIS HIS A . n A 1 61 LEU 61 468 468 LEU LEU A . n A 1 62 LYS 62 469 469 LYS LYS A . n A 1 63 TYR 63 470 470 TYR TYR A . n A 1 64 ASN 64 471 471 ASN ASN A . n A 1 65 SER 65 472 472 SER SER A . n A 1 66 LEU 66 473 473 LEU LEU A . n A 1 67 SER 67 474 474 SER SER A . n A 1 68 VAL 68 475 475 VAL VAL A . n A 1 69 HIS 69 476 476 HIS HIS A . n A 1 70 ASN 70 477 477 ASN ASN A . n A 1 71 ASP 71 478 478 ASP ASP A . n A 1 72 HIS 72 479 479 HIS HIS A . n A 1 73 SER 73 480 480 SER SER A . n A 1 74 VAL 74 481 481 VAL VAL A . n A 1 75 GLU 75 482 482 GLU GLU A . n A 1 76 GLU 76 483 483 GLU GLU A . n A 1 77 LYS 77 484 484 LYS LYS A . n A 1 78 ASN 78 485 485 ASN ASN A . n A 1 79 CYS 79 486 486 CYS CYS A . n A 1 80 TYR 80 487 487 TYR TYR A . n A 1 81 GLN 81 488 488 GLN GLN A . n A 1 82 LEU 82 489 489 LEU LEU A . n A 1 83 LEU 83 490 490 LEU LEU A . n A 1 84 ILE 84 491 491 ILE ILE A . n A 1 85 HIS 85 492 492 HIS HIS A . n A 1 86 GLN 86 493 493 GLN GLN A . n A 1 87 ASP 87 494 494 ASP ASP A . n A 1 88 GLY 88 495 495 GLY GLY A . n A 1 89 GLU 89 496 496 GLU GLU A . n A 1 90 SER 90 497 497 SER SER A . n A 1 91 ILE 91 498 498 ILE ILE A . n A 1 92 SER 92 499 499 SER SER A . n A 1 93 SER 93 500 500 SER SER A . n A 1 94 MET 94 501 501 MET MET A . n A 1 95 LEU 95 502 502 LEU LEU A . n A 1 96 VAL 96 503 503 VAL VAL A . n A 1 97 LYS 97 504 504 LYS LYS A . n A 1 98 ASP 98 505 505 ASP ASP A . n A 1 99 THR 99 506 506 THR THR A . n A 1 100 GLY 100 507 507 GLY GLY A . n A 1 101 ILE 101 508 508 ILE ILE A . n A 1 102 LYS 102 509 509 LYS LYS A . n A 1 103 PRO 103 510 510 PRO PRO A . n A 1 104 ALA 104 511 511 ALA ALA A . n A 1 105 ASN 105 512 512 ASN ASN A . n A 1 106 GLY 106 513 513 GLY GLY A . n A 1 107 MET 107 514 514 MET MET A . n A 1 108 ALA 108 515 515 ALA ALA A . n A 1 109 ALA 109 516 516 ALA ALA A . n A 1 110 ILE 110 517 517 ILE ILE A . n A 1 111 ARG 111 518 518 ARG ARG A . n A 1 112 PHE 112 519 519 PHE PHE A . n A 1 113 ILE 113 520 520 ILE ILE A . n A 1 114 ASN 114 521 521 ASN ASN A . n A 1 115 THR 115 522 522 THR THR A . n A 1 116 LEU 116 523 523 LEU LEU A . n A 1 117 HIS 117 524 524 HIS HIS A . n A 1 118 LYS 118 525 525 LYS LYS A . n A 1 119 ASP 119 526 526 ASP ASP A . n A 1 120 LEU 120 527 527 LEU LEU A . n A 1 121 ASN 121 528 528 ASN ASN A . n A 1 122 ILE 122 529 529 ILE ILE A . n A 1 123 SER 123 530 530 SER SER A . n A 1 124 LEU 124 531 531 LEU LEU A . n A 1 125 ASP 125 532 532 ASP ASP A . n A 1 126 THR 126 533 533 THR THR A . n A 1 127 ASP 127 534 534 ASP ASP A . n A 1 128 ALA 128 535 535 ALA ALA A . n A 1 129 PRO 129 536 536 PRO PRO A . n A 1 130 LEU 130 537 537 LEU LEU A . n A 1 131 SER 131 538 538 SER SER A . n A 1 132 VAL 132 539 539 VAL VAL A . n A 1 133 GLY 133 540 540 GLY GLY A . n A 1 134 LYS 134 541 541 LYS LYS A . n A 1 135 ASP 135 542 542 ASP ASP A . n A 1 136 TYR 136 543 543 TYR TYR A . n A 1 137 GLY 137 544 544 GLY GLY A . n A 1 138 VAL 138 545 545 VAL VAL A . n A 1 139 SER 139 546 546 SER SER A . n A 1 140 ALA 140 547 547 ALA ALA A . n A 1 141 TYR 141 548 548 TYR TYR A . n A 1 142 ARG 142 549 549 ARG ARG A . n A 1 143 THR 143 550 550 THR THR A . n A 1 144 VAL 144 551 551 VAL VAL A . n A 1 145 LEU 145 552 552 LEU LEU A . n A 1 146 ARG 146 553 553 ARG ARG A . n A 1 147 GLY 147 554 554 GLY GLY A . n A 1 148 LYS 148 555 555 LYS LYS A . n A 1 149 TYR 149 556 556 TYR TYR A . n A 1 150 PRO 150 557 557 PRO PRO A . n A 1 151 ALA 151 558 558 ALA ALA A . n A 1 152 VAL 152 559 559 VAL VAL A . n A 1 153 HIS 153 560 560 HIS HIS A . n A 1 154 CYS 154 561 561 CYS CYS A . n A 1 155 GLU 155 562 562 GLU GLU A . n A 1 156 THR 156 563 563 THR THR A . n A 1 157 GLU 157 564 564 GLU GLU A . n A 1 158 ASP 158 565 565 ASP ASP A . n A 1 159 LYS 159 566 566 LYS LYS A . n A 1 160 VAL 160 567 567 VAL VAL A . n A 1 161 PHE 161 568 568 PHE PHE A . n A 1 162 SER 162 569 569 SER SER A . n A 1 163 LEU 163 570 570 LEU LEU A . n A 1 164 ASP 164 571 571 ASP ASP A . n A 1 165 LEU 165 572 572 LEU LEU A . n A 1 166 GLY 166 573 573 GLY GLY A . n A 1 167 GLN 167 574 574 GLN GLN A . n A 1 168 LEU 168 575 575 LEU LEU A . n A 1 169 ASP 169 576 576 ASP ASP A . n A 1 170 PHE 170 577 577 PHE PHE A . n A 1 171 GLY 171 578 578 GLY GLY A . n A 1 172 THR 172 579 579 THR THR A . n A 1 173 THR 173 580 580 THR THR A . n A 1 174 TYR 174 581 581 TYR TYR A . n A 1 175 LEU 175 582 582 LEU LEU A . n A 1 176 PHE 176 583 583 PHE PHE A . n A 1 177 VAL 177 584 584 VAL VAL A . n A 1 178 ILE 178 585 585 ILE ILE A . n A 1 179 THR 179 586 586 THR THR A . n A 1 180 ASN 180 587 587 ASN ASN A . n A 1 181 ILE 181 588 ? ? ? A . n A 1 182 THR 182 589 ? ? ? A . n A 1 183 SER 183 590 ? ? ? A . n A 1 184 GLN 184 591 ? ? ? A . n A 1 185 GLY 185 592 ? ? ? A . n A 1 186 LEU 186 593 593 LEU LEU A . n A 1 187 GLN 187 594 594 GLN GLN A . n A 1 188 ALA 188 595 595 ALA ALA A . n A 1 189 TRP 189 596 596 TRP TRP A . n A 1 190 LYS 190 597 597 LYS LYS A . n A 1 191 ALA 191 598 598 ALA ALA A . n A 1 192 GLU 192 599 599 GLU GLU A . n A 1 193 ASP 193 600 600 ASP ASP A . n A 1 194 ILE 194 601 601 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 1602 1602 GOL GOL A . C 3 CS 1 1603 1603 CS CS A . D 4 ACT 1 1604 1604 ACT ACT A . E 3 CS 1 1605 1605 CS CS A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . F 5 HOH 48 2048 2048 HOH HOH A . F 5 HOH 49 2049 2049 HOH HOH A . F 5 HOH 50 2050 2050 HOH HOH A . F 5 HOH 51 2051 2051 HOH HOH A . F 5 HOH 52 2052 2052 HOH HOH A . F 5 HOH 53 2053 2053 HOH HOH A . F 5 HOH 54 2054 2054 HOH HOH A . F 5 HOH 55 2055 2055 HOH HOH A . F 5 HOH 56 2056 2056 HOH HOH A . F 5 HOH 57 2057 2057 HOH HOH A . F 5 HOH 58 2058 2058 HOH HOH A . F 5 HOH 59 2059 2059 HOH HOH A . F 5 HOH 60 2060 2060 HOH HOH A . F 5 HOH 61 2061 2061 HOH HOH A . F 5 HOH 62 2062 2062 HOH HOH A . F 5 HOH 63 2063 2063 HOH HOH A . F 5 HOH 64 2064 2064 HOH HOH A . F 5 HOH 65 2065 2065 HOH HOH A . F 5 HOH 66 2066 2066 HOH HOH A . F 5 HOH 67 2067 2067 HOH HOH A . F 5 HOH 68 2068 2068 HOH HOH A . F 5 HOH 69 2069 2069 HOH HOH A . F 5 HOH 70 2070 2070 HOH HOH A . F 5 HOH 71 2071 2071 HOH HOH A . F 5 HOH 72 2072 2072 HOH HOH A . F 5 HOH 73 2073 2073 HOH HOH A . F 5 HOH 74 2074 2074 HOH HOH A . F 5 HOH 75 2075 2075 HOH HOH A . F 5 HOH 76 2076 2076 HOH HOH A . F 5 HOH 77 2077 2077 HOH HOH A . F 5 HOH 78 2078 2078 HOH HOH A . F 5 HOH 79 2079 2079 HOH HOH A . F 5 HOH 80 2080 2080 HOH HOH A . F 5 HOH 81 2081 2081 HOH HOH A . F 5 HOH 82 2082 2082 HOH HOH A . F 5 HOH 83 2083 2083 HOH HOH A . F 5 HOH 84 2084 2084 HOH HOH A . F 5 HOH 85 2085 2085 HOH HOH A . F 5 HOH 86 2086 2086 HOH HOH A . F 5 HOH 87 2087 2087 HOH HOH A . F 5 HOH 88 2088 2088 HOH HOH A . F 5 HOH 89 2089 2089 HOH HOH A . F 5 HOH 90 2090 2090 HOH HOH A . F 5 HOH 91 2091 2091 HOH HOH A . F 5 HOH 92 2092 2092 HOH HOH A . F 5 HOH 93 2093 2093 HOH HOH A . F 5 HOH 94 2094 2094 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3680 ? 1 MORE -181.1 ? 1 'SSA (A^2)' 17600 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2094 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 34 ? A GLU 441 ? 7_555 CS ? C CS . ? A CS 1603 ? 1_555 OE2 ? A GLU 34 ? A GLU 441 ? 7_555 47.5 ? 2 OE1 ? A GLU 34 ? A GLU 441 ? 7_555 CS ? C CS . ? A CS 1603 ? 1_555 O ? F HOH . ? A HOH 2093 ? 1_555 70.3 ? 3 OE2 ? A GLU 34 ? A GLU 441 ? 7_555 CS ? C CS . ? A CS 1603 ? 1_555 O ? F HOH . ? A HOH 2093 ? 1_555 117.3 ? 4 OD2 ? A ASP 158 ? A ASP 565 ? 5_555 CS ? E CS . ? A CS 1605 ? 1_555 OD1 ? A ASP 71 ? A ASP 478 ? 1_555 164.6 ? 5 OD2 ? A ASP 158 ? A ASP 565 ? 5_555 CS ? E CS . ? A CS 1605 ? 1_555 OD2 ? A ASP 71 ? A ASP 478 ? 1_555 134.0 ? 6 OD1 ? A ASP 71 ? A ASP 478 ? 1_555 CS ? E CS . ? A CS 1605 ? 1_555 OD2 ? A ASP 71 ? A ASP 478 ? 1_555 52.3 ? 7 OD2 ? A ASP 158 ? A ASP 565 ? 5_555 CS ? E CS . ? A CS 1605 ? 1_555 OD1 ? A ASP 158 ? A ASP 565 ? 5_555 48.7 ? 8 OD1 ? A ASP 71 ? A ASP 478 ? 1_555 CS ? E CS . ? A CS 1605 ? 1_555 OD1 ? A ASP 158 ? A ASP 565 ? 5_555 140.9 ? 9 OD2 ? A ASP 71 ? A ASP 478 ? 1_555 CS ? E CS . ? A CS 1605 ? 1_555 OD1 ? A ASP 158 ? A ASP 565 ? 5_555 88.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-09 2 'Structure model' 1 1 2015-10-21 3 'Structure model' 1 2 2019-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Experimental preparation' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' exptl_crystal_grow 2 3 'Structure model' pdbx_database_proc 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_exptl_crystal_grow.temp' 2 3 'Structure model' '_pdbx_database_status.recvd_author_approval' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 4.7402 12.4284 10.8508 -0.1236 -0.0682 -0.0464 0.0005 -0.0716 0.0371 5.0869 1.6220 2.4666 -0.8394 0.9850 -0.7160 -0.0938 -0.5317 -0.0521 0.0834 -0.0404 -0.0710 -0.3284 -0.1656 0.1342 'X-RAY DIFFRACTION' 2 ? refined 25.1879 4.3201 18.1029 -0.2160 0.0467 0.0458 -0.0045 -0.0696 0.1506 3.7299 2.3563 2.2980 1.0153 -0.9621 -1.3296 0.0537 -0.5442 -0.5442 0.0342 -0.0584 -0.1194 -0.0542 0.1655 0.0046 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '{ A|410 - A|504 }' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '{ A|514 - A|601 }' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal BUSTER refinement 2.11.5 ? 1 XDS 'data reduction' . ? 2 Aimless 'data scaling' . ? 3 PHASER phasing . ? 4 # _pdbx_entry_details.entry_id 5A9H _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;ACETATE (ACT): FROM CRYSTALLISATION CONDITION CESIUM (CS): CESIUM ION ; _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NE2 A HIS 476 ? ? CS A CS 1605 ? ? 1.72 2 1 ND1 A HIS 465 ? ? CS A CS 1605 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 450 ? ? -141.37 35.35 2 1 THR A 450 ? ? -141.37 34.39 3 1 ASN A 471 ? ? 56.76 -121.59 4 1 TYR A 543 ? ? 74.31 31.96 5 1 THR A 563 ? ? -162.88 79.94 6 1 ASP A 565 ? ? -143.95 13.51 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 588 ? A ILE 181 2 1 Y 1 A THR 589 ? A THR 182 3 1 Y 1 A SER 590 ? A SER 183 4 1 Y 1 A GLN 591 ? A GLN 184 5 1 Y 1 A GLY 592 ? A GLY 185 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 'CESIUM ION' CS 4 'ACETATE ION' ACT 5 water HOH #