data_5B7A # _entry.id 5B7A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5B7A pdb_00005b7a 10.2210/pdb5b7a/pdb WWPDB D_1300000658 ? ? BMRB 36000 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 2N1V unspecified BMRB . 25576 unspecified BMRB . 36000 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5B7A _pdbx_database_status.recvd_initial_deposition_date 2016-06-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Naik, M.T.' 1 ? 'Naik, N.' 2 ? 'Shih, H.' 3 ? 'Huang, T.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structures Of Human Sumo' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Naik, M.T.' 1 ? primary 'Naik, N.' 2 ? primary 'Shih, H.' 3 ? primary 'Huang, T.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5B7A _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5B7A _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Small ubiquitin-related modifier 1' _entity.formula_weight 12809.266 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 1-97' _entity.details ;Lys37 acetylated mature SMALL UBIQUITIN-RELATED MODIFIER 1 ( SUMO1) Residues 1-14 (MGSSHHHHHHSQDP) represent a non-native purification tag. These residues were neither assigned nor included in structure calculation. ; # _entity_name_com.entity_id 1 _entity_name_com.name ;SUMO-1,GAP-modifying protein 1,GMP1,SMT3 homolog 3,Sentrin,Ubiquitin-homology domain protein PIC1,Ubiquitin-like protein SMT3C,Smt3C,Ubiquitin-like protein UBL1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSQDPMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHF(ALY)VKMTTHLKKLKESYCQRQGVPMNSL RFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSQDPMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLF EGQRIADNHTPKELGMEEEDVIEVYQEQTGG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 GLN n 1 13 ASP n 1 14 PRO n 1 15 MET n 1 16 SER n 1 17 ASP n 1 18 GLN n 1 19 GLU n 1 20 ALA n 1 21 LYS n 1 22 PRO n 1 23 SER n 1 24 THR n 1 25 GLU n 1 26 ASP n 1 27 LEU n 1 28 GLY n 1 29 ASP n 1 30 LYS n 1 31 LYS n 1 32 GLU n 1 33 GLY n 1 34 GLU n 1 35 TYR n 1 36 ILE n 1 37 LYS n 1 38 LEU n 1 39 LYS n 1 40 VAL n 1 41 ILE n 1 42 GLY n 1 43 GLN n 1 44 ASP n 1 45 SER n 1 46 SER n 1 47 GLU n 1 48 ILE n 1 49 HIS n 1 50 PHE n 1 51 ALY n 1 52 VAL n 1 53 LYS n 1 54 MET n 1 55 THR n 1 56 THR n 1 57 HIS n 1 58 LEU n 1 59 LYS n 1 60 LYS n 1 61 LEU n 1 62 LYS n 1 63 GLU n 1 64 SER n 1 65 TYR n 1 66 CYS n 1 67 GLN n 1 68 ARG n 1 69 GLN n 1 70 GLY n 1 71 VAL n 1 72 PRO n 1 73 MET n 1 74 ASN n 1 75 SER n 1 76 LEU n 1 77 ARG n 1 78 PHE n 1 79 LEU n 1 80 PHE n 1 81 GLU n 1 82 GLY n 1 83 GLN n 1 84 ARG n 1 85 ILE n 1 86 ALA n 1 87 ASP n 1 88 ASN n 1 89 HIS n 1 90 THR n 1 91 PRO n 1 92 LYS n 1 93 GLU n 1 94 LEU n 1 95 GLY n 1 96 MET n 1 97 GLU n 1 98 GLU n 1 99 GLU n 1 100 ASP n 1 101 VAL n 1 102 ILE n 1 103 GLU n 1 104 VAL n 1 105 TYR n 1 106 GLN n 1 107 GLU n 1 108 GLN n 1 109 THR n 1 110 GLY n 1 111 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 111 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pCDFDuet-1 _entity_src_gen.pdbx_host_org_vector PCDFDUET-1 _entity_src_gen.host_org_details ;Plasmid pCDF PylT-1 with SUMO insert with K37STOP mutation (with amber codon) and pAcKRS-3 as described in Neumann et al., Mol Cell, 36, 153, 2009 ; _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ;PLASMID PCDF PYLT-1 WITH SUMO INSERT WITH K37STOP MUTATION (WITH AMBER CODON) AND PACKRS-3 AS DESCRIBED IN NEUMANN ET AL., MOL CELL, 36, 153, 2009 ; # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SUMO1_HUMAN _struct_ref.pdbx_db_accession P63165 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL GMEEEDVIEVYQEQTGG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5B7A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 15 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 111 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P63165 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 97 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 97 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5B7A MET A 1 ? UNP P63165 ? ? 'initiating methionine' -13 1 1 5B7A GLY A 2 ? UNP P63165 ? ? 'expression tag' -12 2 1 5B7A SER A 3 ? UNP P63165 ? ? 'expression tag' -11 3 1 5B7A SER A 4 ? UNP P63165 ? ? 'expression tag' -10 4 1 5B7A HIS A 5 ? UNP P63165 ? ? 'expression tag' -9 5 1 5B7A HIS A 6 ? UNP P63165 ? ? 'expression tag' -8 6 1 5B7A HIS A 7 ? UNP P63165 ? ? 'expression tag' -7 7 1 5B7A HIS A 8 ? UNP P63165 ? ? 'expression tag' -6 8 1 5B7A HIS A 9 ? UNP P63165 ? ? 'expression tag' -5 9 1 5B7A HIS A 10 ? UNP P63165 ? ? 'expression tag' -4 10 1 5B7A SER A 11 ? UNP P63165 ? ? 'expression tag' -3 11 1 5B7A GLN A 12 ? UNP P63165 ? ? 'expression tag' -2 12 1 5B7A ASP A 13 ? UNP P63165 ? ? 'expression tag' -1 13 1 5B7A PRO A 14 ? UNP P63165 ? ? 'expression tag' 0 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D 1H-15N HSQC' 3 isotropic 2 1 1 '2D 1H-13C HSQC' 3 isotropic 3 1 1 '3D HNCO' 2 isotropic 4 1 1 '3D HNCA' 2 isotropic 5 1 1 '3D HN(CO)CA' 2 isotropic 6 1 1 '3D HNCACB' 2 isotropic 7 1 1 '3D CBCA(CO)NH' 2 isotropic 8 1 1 '3D HCCH-TOCSY' 2 isotropic 9 1 1 '3D HCCH-COSY' 2 isotropic 10 1 1 '3D HBHA(CO)NH' 2 isotropic 11 1 1 2D-HBCBCGCDHD 2 isotropic 12 1 1 2D-HBCBCGCDCEHE 2 isotropic 13 1 1 '3D 1H-15N TOCSY' 2 isotropic 14 1 4 '2D 1H-1H NOESY' 4 isotropic 15 1 1 '3D 1H-15N NOESY' 3 isotropic 16 1 1 '3D 1H-13C NOESY' 3 isotropic 17 1 3 '2D 1H-15N HSQC IPAP' 2 anisotropic 18 1 1 '2D NOESY F1 FILTERED' 4 isotropic 19 1 1 '2D NOESY F2 FILTERED' 4 isotropic 20 1 1 '2D NOESY F1/F2 FILTERED' 4 isotropic 21 1 1 '2D TOCSY F1/F2 FILTERED' 4 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 290 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM KCl' _pdbx_nmr_exptl_sample_conditions.details 'NMR data was acquired in shigemi tubes.' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label Default _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;1 mM [U-100% 13C; U-100% 15N] SUMO1 K37Ac, 10 mM potassium phosphate, 100 mM potassium chloride, 2 mM DTT, 0.1 mM EDTA, 0.001 % sodium azide, 90% H2O/10% D2O ; '90% H2O/10% D2O' CN solution '13C, 15N- K37Ac SUMO1' 2 ;1 mM [U-100% 15N] SUMO1 K37Ac, 10 mM potassium phosphate, 100 mM potassium chloride, 2 mM DTT, 0.1 mM EDTA, 0.001 % sodium azide, 90% H2O/10% D2O ; '90% H2O/10% D2O' N solution '15N- K37Ac SUMO1' 3 ;1 mM [U-100% 15N] SUMO1 K37Ac, 10 mM potassium phosphate, 100 mM potassium chloride, 2 mM DTT, 0.1 mM EDTA, 0.001 % sodium azide, 10 mg/mL Pf1 phage, 90% H2O/10% D2O ; '90% H2O/10% D2O' Phage 'filamentous virus' '15N K37Ac SUMO1 in Pf1 phage alignment medium' 4 ;1 mM SUMO1 K37Ac, 10 mM potassium phosphate, 100 mM potassium chloride, 2 mM DTT, 0.1 mM EDTA, 0.001 % sodium azide, 90% H2O/10% D2O ; '90% H2O/10% D2O' Unlabeled solution 'Unlabeled- K37Ac SUMO1' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 500 ? 2 'AVANCE III' ? Bruker 600 ? 3 AVANCE ? Bruker 800 ? 4 'AVANCE III' ? Bruker 850 ? # _pdbx_nmr_refine.entry_id 5B7A _pdbx_nmr_refine.method ;TORSION ANGLE DYNAMICS, DGSA- DISTANCE GEOMETRY SIMULATED ANNEALING ; _pdbx_nmr_refine.details ;Initial structure ensemble was calculated by semi-automated NOESY assignment by CYANA. The assignments were manually verified in Sparky and final structure annealing was performed in CYANA.Structure and restraints from CYANA were imported in Xplor-NIH for explicit water refinement., Initial structure ensemble was calculated by semi-automated NOESY assignment by CYANA. The assignments were manually verified in Sparky and final structure annealing was performed in CYANA.Structure and restraints from CYANA were imported in Xplor-NIH for explicit water refinement. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 5B7A _pdbx_nmr_details.text 'NMR DATA WAS ACQUIRED AT 295K USING SHIGEMI NMR TUBES.' # _pdbx_nmr_ensemble.entry_id 5B7A _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5B7A _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' 2.34 'Schwieters, Kuszewski, Tjandra and Clore' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 processing TopSpin 3.2 'Bruker Biospin' 4 'data analysis' Sparky 3.113 Goddard # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5B7A _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5B7A _struct.title 'SOLUTION STRUCTURE OF LYS37 ACETYLATED HUMAN SUMO1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5B7A _struct_keywords.text 'UBIQUITIN-LIKE PROTEIN, ACETYLATED PROTEIN, STRUCTURAL GENOMICS' _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 70 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 44 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 56 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PHE 50 C ? ? ? 1_555 A ALY 51 N ? ? A PHE 36 A ALY 37 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale2 covale both ? A ALY 51 C ? ? ? 1_555 A VAL 52 N ? ? A ALY 37 A VAL 38 1_555 ? ? ? ? ? ? ? 1.299 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 47 ? LYS A 53 ? GLU A 33 LYS A 39 AA1 2 TYR A 35 ? GLY A 42 ? TYR A 21 GLY A 28 AA1 3 VAL A 101 ? GLN A 106 ? VAL A 87 GLN A 92 AA1 4 LEU A 76 ? PHE A 80 ? LEU A 62 PHE A 66 AA1 5 GLN A 83 ? ILE A 85 ? GLN A 69 ILE A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 52 ? O VAL A 38 N ILE A 36 ? N ILE A 22 AA1 2 3 N ILE A 41 ? N ILE A 27 O VAL A 104 ? O VAL A 90 AA1 3 4 O GLU A 103 ? O GLU A 89 N LEU A 79 ? N LEU A 65 AA1 4 5 N PHE A 78 ? N PHE A 64 O ILE A 85 ? O ILE A 71 # _database_PDB_matrix.entry_id 5B7A _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5B7A _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -13 ? ? ? A . n A 1 2 GLY 2 -12 ? ? ? A . n A 1 3 SER 3 -11 ? ? ? A . n A 1 4 SER 4 -10 ? ? ? A . n A 1 5 HIS 5 -9 ? ? ? A . n A 1 6 HIS 6 -8 ? ? ? A . n A 1 7 HIS 7 -7 ? ? ? A . n A 1 8 HIS 8 -6 ? ? ? A . n A 1 9 HIS 9 -5 ? ? ? A . n A 1 10 HIS 10 -4 ? ? ? A . n A 1 11 SER 11 -3 ? ? ? A . n A 1 12 GLN 12 -2 ? ? ? A . n A 1 13 ASP 13 -1 ? ? ? A . n A 1 14 PRO 14 0 ? ? ? A . n A 1 15 MET 15 1 1 MET MET A . n A 1 16 SER 16 2 2 SER SER A . n A 1 17 ASP 17 3 3 ASP ASP A . n A 1 18 GLN 18 4 4 GLN GLN A . n A 1 19 GLU 19 5 5 GLU GLU A . n A 1 20 ALA 20 6 6 ALA ALA A . n A 1 21 LYS 21 7 7 LYS LYS A . n A 1 22 PRO 22 8 8 PRO PRO A . n A 1 23 SER 23 9 9 SER SER A . n A 1 24 THR 24 10 10 THR THR A . n A 1 25 GLU 25 11 11 GLU GLU A . n A 1 26 ASP 26 12 12 ASP ASP A . n A 1 27 LEU 27 13 13 LEU LEU A . n A 1 28 GLY 28 14 14 GLY GLY A . n A 1 29 ASP 29 15 15 ASP ASP A . n A 1 30 LYS 30 16 16 LYS LYS A . n A 1 31 LYS 31 17 17 LYS LYS A . n A 1 32 GLU 32 18 18 GLU GLU A . n A 1 33 GLY 33 19 19 GLY GLY A . n A 1 34 GLU 34 20 20 GLU GLU A . n A 1 35 TYR 35 21 21 TYR TYR A . n A 1 36 ILE 36 22 22 ILE ILE A . n A 1 37 LYS 37 23 23 LYS LYS A . n A 1 38 LEU 38 24 24 LEU LEU A . n A 1 39 LYS 39 25 25 LYS LYS A . n A 1 40 VAL 40 26 26 VAL VAL A . n A 1 41 ILE 41 27 27 ILE ILE A . n A 1 42 GLY 42 28 28 GLY GLY A . n A 1 43 GLN 43 29 29 GLN GLN A . n A 1 44 ASP 44 30 30 ASP ASP A . n A 1 45 SER 45 31 31 SER SER A . n A 1 46 SER 46 32 32 SER SER A . n A 1 47 GLU 47 33 33 GLU GLU A . n A 1 48 ILE 48 34 34 ILE ILE A . n A 1 49 HIS 49 35 35 HIS HIS A . n A 1 50 PHE 50 36 36 PHE PHE A . n A 1 51 ALY 51 37 37 ALY ALY A . n A 1 52 VAL 52 38 38 VAL VAL A . n A 1 53 LYS 53 39 39 LYS LYS A . n A 1 54 MET 54 40 40 MET MET A . n A 1 55 THR 55 41 41 THR THR A . n A 1 56 THR 56 42 42 THR THR A . n A 1 57 HIS 57 43 43 HIS HIS A . n A 1 58 LEU 58 44 44 LEU LEU A . n A 1 59 LYS 59 45 45 LYS LYS A . n A 1 60 LYS 60 46 46 LYS LYS A . n A 1 61 LEU 61 47 47 LEU LEU A . n A 1 62 LYS 62 48 48 LYS LYS A . n A 1 63 GLU 63 49 49 GLU GLU A . n A 1 64 SER 64 50 50 SER SER A . n A 1 65 TYR 65 51 51 TYR TYR A . n A 1 66 CYS 66 52 52 CYS CYS A . n A 1 67 GLN 67 53 53 GLN GLN A . n A 1 68 ARG 68 54 54 ARG ARG A . n A 1 69 GLN 69 55 55 GLN GLN A . n A 1 70 GLY 70 56 56 GLY GLY A . n A 1 71 VAL 71 57 57 VAL VAL A . n A 1 72 PRO 72 58 58 PRO PRO A . n A 1 73 MET 73 59 59 MET MET A . n A 1 74 ASN 74 60 60 ASN ASN A . n A 1 75 SER 75 61 61 SER SER A . n A 1 76 LEU 76 62 62 LEU LEU A . n A 1 77 ARG 77 63 63 ARG ARG A . n A 1 78 PHE 78 64 64 PHE PHE A . n A 1 79 LEU 79 65 65 LEU LEU A . n A 1 80 PHE 80 66 66 PHE PHE A . n A 1 81 GLU 81 67 67 GLU GLU A . n A 1 82 GLY 82 68 68 GLY GLY A . n A 1 83 GLN 83 69 69 GLN GLN A . n A 1 84 ARG 84 70 70 ARG ARG A . n A 1 85 ILE 85 71 71 ILE ILE A . n A 1 86 ALA 86 72 72 ALA ALA A . n A 1 87 ASP 87 73 73 ASP ASP A . n A 1 88 ASN 88 74 74 ASN ASN A . n A 1 89 HIS 89 75 75 HIS HIS A . n A 1 90 THR 90 76 76 THR THR A . n A 1 91 PRO 91 77 77 PRO PRO A . n A 1 92 LYS 92 78 78 LYS LYS A . n A 1 93 GLU 93 79 79 GLU GLU A . n A 1 94 LEU 94 80 80 LEU LEU A . n A 1 95 GLY 95 81 81 GLY GLY A . n A 1 96 MET 96 82 82 MET MET A . n A 1 97 GLU 97 83 83 GLU GLU A . n A 1 98 GLU 98 84 84 GLU GLU A . n A 1 99 GLU 99 85 85 GLU GLU A . n A 1 100 ASP 100 86 86 ASP ASP A . n A 1 101 VAL 101 87 87 VAL VAL A . n A 1 102 ILE 102 88 88 ILE ILE A . n A 1 103 GLU 103 89 89 GLU GLU A . n A 1 104 VAL 104 90 90 VAL VAL A . n A 1 105 TYR 105 91 91 TYR TYR A . n A 1 106 GLN 106 92 92 GLN GLN A . n A 1 107 GLU 107 93 93 GLU GLU A . n A 1 108 GLN 108 94 94 GLN GLN A . n A 1 109 THR 109 95 95 THR THR A . n A 1 110 GLY 110 96 96 GLY GLY A . n A 1 111 GLY 111 97 97 GLY GLY A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ALY _pdbx_struct_mod_residue.label_seq_id 51 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ALY _pdbx_struct_mod_residue.auth_seq_id 37 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7340 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-07 2 'Structure model' 1 1 2023-10-11 3 'Structure model' 2 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' atom_site 7 3 'Structure model' chem_comp_atom 8 3 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_atom_site.auth_atom_id' 6 3 'Structure model' '_atom_site.label_atom_id' 7 3 'Structure model' '_chem_comp_atom.atom_id' 8 3 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'SUMO1 K37Ac' 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'potassium phosphate' 10 ? mM 'natural abundance' 1 'potassium chloride' 100 ? mM 'natural abundance' 1 DTT 2 ? mM 'natural abundance' 1 EDTA 0.1 ? mM 'natural abundance' 1 'sodium azide' 0.001 ? % 'natural abundance' 2 'SUMO1 K37Ac' 1 ? mM '[U-100% 15N]' 2 'potassium phosphate' 10 ? mM 'natural abundance' 2 'potassium chloride' 100 ? mM 'natural abundance' 2 DTT 2 ? mM 'natural abundance' 2 EDTA 0.1 ? mM 'natural abundance' 2 'sodium azide' 0.001 ? % 'natural abundance' 3 'SUMO1 K37Ac' 1 ? mM '[U-100% 15N]' 3 'potassium phosphate' 10 ? mM 'natural abundance' 3 'potassium chloride' 100 ? mM 'natural abundance' 3 DTT 2 ? mM 'natural abundance' 3 EDTA 0.1 ? mM 'natural abundance' 3 'sodium azide' 0.001 ? % 'natural abundance' 3 'Pf1 phage' 10 ? mg/mL 'natural abundance' 4 'SUMO1 K37Ac' 1 ? mM 'natural abundance' 4 'potassium phosphate' 10 ? mM 'natural abundance' 4 'potassium chloride' 100 ? mM 'natural abundance' 4 DTT 2 ? mM 'natural abundance' 4 EDTA 0.1 ? mM 'natural abundance' 4 'sodium azide' 0.001 ? % 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 48 ? ? OD1 A ASP 73 ? ? 1.56 2 2 O A ASP 30 ? ? HG A SER 31 ? ? 1.59 3 2 HZ2 A LYS 48 ? ? OD1 A ASP 73 ? ? 1.59 4 5 HZ1 A LYS 48 ? ? OD1 A ASP 73 ? ? 1.59 5 7 HZ1 A LYS 48 ? ? OD1 A ASP 73 ? ? 1.57 6 9 HZ2 A LYS 48 ? ? OD1 A ASP 73 ? ? 1.55 7 9 HZ1 A LYS 45 ? ? OE2 A GLU 49 ? ? 1.58 8 10 HZ2 A LYS 7 ? ? OE2 A GLU 18 ? ? 1.59 9 12 HZ1 A LYS 45 ? ? OE2 A GLU 49 ? ? 1.58 10 13 HZ3 A LYS 48 ? ? OD1 A ASP 73 ? ? 1.56 11 13 OD2 A ASP 15 ? ? HZ2 A LYS 16 ? ? 1.60 12 18 HZ2 A LYS 48 ? ? OD1 A ASP 73 ? ? 1.56 13 19 HZ1 A LYS 48 ? ? OD1 A ASP 73 ? ? 1.55 14 19 HG1 A THR 10 ? ? OE1 A GLU 11 ? ? 1.58 15 20 HZ2 A LYS 45 ? ? OE2 A GLU 49 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 72 ? ? -102.12 77.08 2 1 ASN A 74 ? ? -151.11 -31.48 3 1 GLU A 83 ? ? -146.61 -159.96 4 1 GLU A 93 ? ? 179.95 136.01 5 2 ASP A 15 ? ? -124.17 -53.90 6 2 VAL A 38 ? ? -109.66 -167.21 7 2 ASP A 73 ? ? 45.77 22.48 8 2 ASN A 74 ? ? -147.51 -14.40 9 2 GLU A 93 ? ? 177.74 130.16 10 3 SER A 2 ? ? -152.72 8.48 11 3 GLN A 4 ? ? -57.92 179.20 12 3 PRO A 8 ? ? -66.96 -160.27 13 3 GLU A 67 ? ? 49.99 29.67 14 3 ALA A 72 ? ? -108.44 77.12 15 3 ASN A 74 ? ? -153.86 -39.99 16 3 GLU A 93 ? ? -178.86 116.69 17 4 PRO A 8 ? ? -70.03 -158.98 18 4 ASP A 15 ? ? -109.96 -71.78 19 4 ASN A 74 ? ? -149.65 -24.50 20 4 GLU A 93 ? ? -167.81 105.30 21 5 ASP A 3 ? ? 71.37 -23.41 22 5 PRO A 8 ? ? -69.67 -173.98 23 5 ALA A 72 ? ? -104.18 76.86 24 5 ASN A 74 ? ? -153.42 -25.70 25 5 GLU A 83 ? ? -144.41 -157.73 26 5 GLU A 93 ? ? -178.55 115.69 27 6 PRO A 8 ? ? -78.40 -157.34 28 6 THR A 10 ? ? -87.74 47.26 29 6 ASP A 15 ? ? 80.51 -41.38 30 6 ASP A 73 ? ? 48.48 23.96 31 6 ASN A 74 ? ? -148.98 -21.84 32 6 GLU A 93 ? ? -172.45 140.83 33 7 PRO A 8 ? ? -61.67 -75.98 34 7 THR A 10 ? ? 40.76 23.47 35 7 ASP A 12 ? ? -128.93 -85.89 36 7 GLU A 67 ? ? 48.15 28.44 37 7 ALA A 72 ? ? -102.26 75.19 38 7 ASP A 73 ? ? 46.85 24.66 39 7 ASN A 74 ? ? -148.57 -20.33 40 7 GLU A 93 ? ? -173.71 124.06 41 8 PRO A 8 ? ? -60.47 -80.82 42 8 SER A 9 ? ? 64.92 87.82 43 8 GLU A 67 ? ? 47.99 28.76 44 8 ALA A 72 ? ? -102.17 77.99 45 8 ASP A 73 ? ? 42.40 29.37 46 8 ASN A 74 ? ? -148.78 -24.28 47 8 GLU A 83 ? ? -136.18 -159.98 48 8 GLU A 93 ? ? -173.91 123.85 49 9 ASP A 73 ? ? 48.73 21.73 50 9 ASN A 74 ? ? -146.77 -18.74 51 9 GLU A 85 ? ? 83.55 23.85 52 9 GLU A 93 ? ? 178.43 125.41 53 10 GLN A 4 ? ? -172.00 -174.78 54 10 ALA A 6 ? ? 71.23 130.37 55 10 ALA A 72 ? ? -100.45 75.96 56 10 ASP A 73 ? ? 48.73 20.95 57 10 ASN A 74 ? ? -148.05 -8.74 58 10 GLU A 93 ? ? 176.27 109.96 59 11 PRO A 8 ? ? -67.79 -161.34 60 11 ASP A 12 ? ? -78.17 -166.77 61 11 ASP A 15 ? ? -125.80 -58.20 62 11 GLU A 18 ? ? -87.64 30.00 63 11 ASP A 73 ? ? 47.22 21.20 64 11 ASN A 74 ? ? -147.28 -8.19 65 11 GLU A 93 ? ? -178.79 144.89 66 12 GLN A 4 ? ? -172.84 142.96 67 12 SER A 9 ? ? 62.61 75.70 68 12 ASN A 74 ? ? -152.91 -33.02 69 12 GLU A 93 ? ? -168.91 -48.67 70 12 GLN A 94 ? ? -69.78 61.23 71 13 ALA A 72 ? ? -100.50 76.00 72 13 ASP A 73 ? ? 46.59 27.54 73 13 ASN A 74 ? ? -147.05 -20.61 74 13 GLU A 93 ? ? -172.22 110.82 75 14 PRO A 8 ? ? -67.40 -159.13 76 14 ASP A 15 ? ? -66.04 71.21 77 14 ASP A 73 ? ? 47.13 27.33 78 14 ASN A 74 ? ? -149.42 -23.45 79 14 GLU A 83 ? ? -141.79 -158.87 80 14 GLU A 93 ? ? 179.00 97.81 81 15 GLU A 5 ? ? -147.53 -42.94 82 15 PRO A 8 ? ? -74.89 -165.98 83 15 ASP A 15 ? ? -143.92 -89.45 84 15 GLU A 67 ? ? 48.44 29.81 85 15 ALA A 72 ? ? -112.35 75.71 86 15 ASP A 73 ? ? 46.92 24.82 87 15 ASN A 74 ? ? -140.44 -21.77 88 15 GLU A 93 ? ? 174.71 153.11 89 15 GLN A 94 ? ? 67.70 63.50 90 15 THR A 95 ? ? -140.82 11.85 91 16 PRO A 8 ? ? -69.83 -154.44 92 16 SER A 9 ? ? 60.43 63.27 93 16 ALA A 72 ? ? -110.48 76.43 94 16 ASN A 74 ? ? -150.96 -28.80 95 16 GLU A 93 ? ? -178.18 133.52 96 17 GLN A 4 ? ? -75.13 -168.46 97 17 GLU A 5 ? ? -56.97 170.64 98 17 PRO A 8 ? ? -73.48 -169.88 99 17 THR A 10 ? ? -165.08 -5.31 100 17 LEU A 13 ? ? -54.62 -72.83 101 17 ASP A 73 ? ? 42.65 19.60 102 17 ASN A 74 ? ? -143.18 -18.89 103 17 GLU A 83 ? ? -125.65 -164.36 104 17 GLU A 93 ? ? -178.51 143.48 105 18 PRO A 8 ? ? -74.15 -90.65 106 18 GLU A 11 ? ? -108.92 -157.62 107 18 LYS A 17 ? ? -140.98 -30.77 108 18 GLU A 67 ? ? 46.82 29.27 109 18 ASN A 74 ? ? -154.53 -30.08 110 18 GLU A 93 ? ? 178.02 137.62 111 19 GLU A 5 ? ? -125.79 -59.13 112 19 PRO A 8 ? ? -59.52 -88.16 113 19 ASP A 15 ? ? -67.61 -79.43 114 19 ALA A 72 ? ? -103.78 75.47 115 19 ASN A 74 ? ? -156.15 -35.87 116 19 GLU A 83 ? ? -143.15 -158.80 117 19 GLU A 93 ? ? 178.27 150.03 118 20 GLU A 18 ? ? -98.38 -96.97 119 20 ALA A 72 ? ? -107.91 77.09 120 20 ASP A 73 ? ? 42.70 21.29 121 20 GLU A 83 ? ? -147.57 -159.11 122 20 GLU A 93 ? ? -175.25 114.13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -13 ? A MET 1 2 1 Y 1 A GLY -12 ? A GLY 2 3 1 Y 1 A SER -11 ? A SER 3 4 1 Y 1 A SER -10 ? A SER 4 5 1 Y 1 A HIS -9 ? A HIS 5 6 1 Y 1 A HIS -8 ? A HIS 6 7 1 Y 1 A HIS -7 ? A HIS 7 8 1 Y 1 A HIS -6 ? A HIS 8 9 1 Y 1 A HIS -5 ? A HIS 9 10 1 Y 1 A HIS -4 ? A HIS 10 11 1 Y 1 A SER -3 ? A SER 11 12 1 Y 1 A GLN -2 ? A GLN 12 13 1 Y 1 A ASP -1 ? A ASP 13 14 1 Y 1 A PRO 0 ? A PRO 14 15 2 Y 1 A MET -13 ? A MET 1 16 2 Y 1 A GLY -12 ? A GLY 2 17 2 Y 1 A SER -11 ? A SER 3 18 2 Y 1 A SER -10 ? A SER 4 19 2 Y 1 A HIS -9 ? A HIS 5 20 2 Y 1 A HIS -8 ? A HIS 6 21 2 Y 1 A HIS -7 ? A HIS 7 22 2 Y 1 A HIS -6 ? A HIS 8 23 2 Y 1 A HIS -5 ? A HIS 9 24 2 Y 1 A HIS -4 ? A HIS 10 25 2 Y 1 A SER -3 ? A SER 11 26 2 Y 1 A GLN -2 ? A GLN 12 27 2 Y 1 A ASP -1 ? A ASP 13 28 2 Y 1 A PRO 0 ? A PRO 14 29 3 Y 1 A MET -13 ? A MET 1 30 3 Y 1 A GLY -12 ? A GLY 2 31 3 Y 1 A SER -11 ? A SER 3 32 3 Y 1 A SER -10 ? A SER 4 33 3 Y 1 A HIS -9 ? A HIS 5 34 3 Y 1 A HIS -8 ? A HIS 6 35 3 Y 1 A HIS -7 ? A HIS 7 36 3 Y 1 A HIS -6 ? A HIS 8 37 3 Y 1 A HIS -5 ? A HIS 9 38 3 Y 1 A HIS -4 ? A HIS 10 39 3 Y 1 A SER -3 ? A SER 11 40 3 Y 1 A GLN -2 ? A GLN 12 41 3 Y 1 A ASP -1 ? A ASP 13 42 3 Y 1 A PRO 0 ? A PRO 14 43 4 Y 1 A MET -13 ? A MET 1 44 4 Y 1 A GLY -12 ? A GLY 2 45 4 Y 1 A SER -11 ? A SER 3 46 4 Y 1 A SER -10 ? A SER 4 47 4 Y 1 A HIS -9 ? A HIS 5 48 4 Y 1 A HIS -8 ? A HIS 6 49 4 Y 1 A HIS -7 ? A HIS 7 50 4 Y 1 A HIS -6 ? A HIS 8 51 4 Y 1 A HIS -5 ? A HIS 9 52 4 Y 1 A HIS -4 ? A HIS 10 53 4 Y 1 A SER -3 ? A SER 11 54 4 Y 1 A GLN -2 ? A GLN 12 55 4 Y 1 A ASP -1 ? A ASP 13 56 4 Y 1 A PRO 0 ? A PRO 14 57 5 Y 1 A MET -13 ? A MET 1 58 5 Y 1 A GLY -12 ? A GLY 2 59 5 Y 1 A SER -11 ? A SER 3 60 5 Y 1 A SER -10 ? A SER 4 61 5 Y 1 A HIS -9 ? A HIS 5 62 5 Y 1 A HIS -8 ? A HIS 6 63 5 Y 1 A HIS -7 ? A HIS 7 64 5 Y 1 A HIS -6 ? A HIS 8 65 5 Y 1 A HIS -5 ? A HIS 9 66 5 Y 1 A HIS -4 ? A HIS 10 67 5 Y 1 A SER -3 ? A SER 11 68 5 Y 1 A GLN -2 ? A GLN 12 69 5 Y 1 A ASP -1 ? A ASP 13 70 5 Y 1 A PRO 0 ? A PRO 14 71 6 Y 1 A MET -13 ? A MET 1 72 6 Y 1 A GLY -12 ? A GLY 2 73 6 Y 1 A SER -11 ? A SER 3 74 6 Y 1 A SER -10 ? A SER 4 75 6 Y 1 A HIS -9 ? A HIS 5 76 6 Y 1 A HIS -8 ? A HIS 6 77 6 Y 1 A HIS -7 ? A HIS 7 78 6 Y 1 A HIS -6 ? A HIS 8 79 6 Y 1 A HIS -5 ? A HIS 9 80 6 Y 1 A HIS -4 ? A HIS 10 81 6 Y 1 A SER -3 ? A SER 11 82 6 Y 1 A GLN -2 ? A GLN 12 83 6 Y 1 A ASP -1 ? A ASP 13 84 6 Y 1 A PRO 0 ? A PRO 14 85 7 Y 1 A MET -13 ? A MET 1 86 7 Y 1 A GLY -12 ? A GLY 2 87 7 Y 1 A SER -11 ? A SER 3 88 7 Y 1 A SER -10 ? A SER 4 89 7 Y 1 A HIS -9 ? A HIS 5 90 7 Y 1 A HIS -8 ? A HIS 6 91 7 Y 1 A HIS -7 ? A HIS 7 92 7 Y 1 A HIS -6 ? A HIS 8 93 7 Y 1 A HIS -5 ? A HIS 9 94 7 Y 1 A HIS -4 ? A HIS 10 95 7 Y 1 A SER -3 ? A SER 11 96 7 Y 1 A GLN -2 ? A GLN 12 97 7 Y 1 A ASP -1 ? A ASP 13 98 7 Y 1 A PRO 0 ? A PRO 14 99 8 Y 1 A MET -13 ? A MET 1 100 8 Y 1 A GLY -12 ? A GLY 2 101 8 Y 1 A SER -11 ? A SER 3 102 8 Y 1 A SER -10 ? A SER 4 103 8 Y 1 A HIS -9 ? A HIS 5 104 8 Y 1 A HIS -8 ? A HIS 6 105 8 Y 1 A HIS -7 ? A HIS 7 106 8 Y 1 A HIS -6 ? A HIS 8 107 8 Y 1 A HIS -5 ? A HIS 9 108 8 Y 1 A HIS -4 ? A HIS 10 109 8 Y 1 A SER -3 ? A SER 11 110 8 Y 1 A GLN -2 ? A GLN 12 111 8 Y 1 A ASP -1 ? A ASP 13 112 8 Y 1 A PRO 0 ? A PRO 14 113 9 Y 1 A MET -13 ? A MET 1 114 9 Y 1 A GLY -12 ? A GLY 2 115 9 Y 1 A SER -11 ? A SER 3 116 9 Y 1 A SER -10 ? A SER 4 117 9 Y 1 A HIS -9 ? A HIS 5 118 9 Y 1 A HIS -8 ? A HIS 6 119 9 Y 1 A HIS -7 ? A HIS 7 120 9 Y 1 A HIS -6 ? A HIS 8 121 9 Y 1 A HIS -5 ? A HIS 9 122 9 Y 1 A HIS -4 ? A HIS 10 123 9 Y 1 A SER -3 ? A SER 11 124 9 Y 1 A GLN -2 ? A GLN 12 125 9 Y 1 A ASP -1 ? A ASP 13 126 9 Y 1 A PRO 0 ? A PRO 14 127 10 Y 1 A MET -13 ? A MET 1 128 10 Y 1 A GLY -12 ? A GLY 2 129 10 Y 1 A SER -11 ? A SER 3 130 10 Y 1 A SER -10 ? A SER 4 131 10 Y 1 A HIS -9 ? A HIS 5 132 10 Y 1 A HIS -8 ? A HIS 6 133 10 Y 1 A HIS -7 ? A HIS 7 134 10 Y 1 A HIS -6 ? A HIS 8 135 10 Y 1 A HIS -5 ? A HIS 9 136 10 Y 1 A HIS -4 ? A HIS 10 137 10 Y 1 A SER -3 ? A SER 11 138 10 Y 1 A GLN -2 ? A GLN 12 139 10 Y 1 A ASP -1 ? A ASP 13 140 10 Y 1 A PRO 0 ? A PRO 14 141 11 Y 1 A MET -13 ? A MET 1 142 11 Y 1 A GLY -12 ? A GLY 2 143 11 Y 1 A SER -11 ? A SER 3 144 11 Y 1 A SER -10 ? A SER 4 145 11 Y 1 A HIS -9 ? A HIS 5 146 11 Y 1 A HIS -8 ? A HIS 6 147 11 Y 1 A HIS -7 ? A HIS 7 148 11 Y 1 A HIS -6 ? A HIS 8 149 11 Y 1 A HIS -5 ? A HIS 9 150 11 Y 1 A HIS -4 ? A HIS 10 151 11 Y 1 A SER -3 ? A SER 11 152 11 Y 1 A GLN -2 ? A GLN 12 153 11 Y 1 A ASP -1 ? A ASP 13 154 11 Y 1 A PRO 0 ? A PRO 14 155 12 Y 1 A MET -13 ? A MET 1 156 12 Y 1 A GLY -12 ? A GLY 2 157 12 Y 1 A SER -11 ? A SER 3 158 12 Y 1 A SER -10 ? A SER 4 159 12 Y 1 A HIS -9 ? A HIS 5 160 12 Y 1 A HIS -8 ? A HIS 6 161 12 Y 1 A HIS -7 ? A HIS 7 162 12 Y 1 A HIS -6 ? A HIS 8 163 12 Y 1 A HIS -5 ? A HIS 9 164 12 Y 1 A HIS -4 ? A HIS 10 165 12 Y 1 A SER -3 ? A SER 11 166 12 Y 1 A GLN -2 ? A GLN 12 167 12 Y 1 A ASP -1 ? A ASP 13 168 12 Y 1 A PRO 0 ? A PRO 14 169 13 Y 1 A MET -13 ? A MET 1 170 13 Y 1 A GLY -12 ? A GLY 2 171 13 Y 1 A SER -11 ? A SER 3 172 13 Y 1 A SER -10 ? A SER 4 173 13 Y 1 A HIS -9 ? A HIS 5 174 13 Y 1 A HIS -8 ? A HIS 6 175 13 Y 1 A HIS -7 ? A HIS 7 176 13 Y 1 A HIS -6 ? A HIS 8 177 13 Y 1 A HIS -5 ? A HIS 9 178 13 Y 1 A HIS -4 ? A HIS 10 179 13 Y 1 A SER -3 ? A SER 11 180 13 Y 1 A GLN -2 ? A GLN 12 181 13 Y 1 A ASP -1 ? A ASP 13 182 13 Y 1 A PRO 0 ? A PRO 14 183 14 Y 1 A MET -13 ? A MET 1 184 14 Y 1 A GLY -12 ? A GLY 2 185 14 Y 1 A SER -11 ? A SER 3 186 14 Y 1 A SER -10 ? A SER 4 187 14 Y 1 A HIS -9 ? A HIS 5 188 14 Y 1 A HIS -8 ? A HIS 6 189 14 Y 1 A HIS -7 ? A HIS 7 190 14 Y 1 A HIS -6 ? A HIS 8 191 14 Y 1 A HIS -5 ? A HIS 9 192 14 Y 1 A HIS -4 ? A HIS 10 193 14 Y 1 A SER -3 ? A SER 11 194 14 Y 1 A GLN -2 ? A GLN 12 195 14 Y 1 A ASP -1 ? A ASP 13 196 14 Y 1 A PRO 0 ? A PRO 14 197 15 Y 1 A MET -13 ? A MET 1 198 15 Y 1 A GLY -12 ? A GLY 2 199 15 Y 1 A SER -11 ? A SER 3 200 15 Y 1 A SER -10 ? A SER 4 201 15 Y 1 A HIS -9 ? A HIS 5 202 15 Y 1 A HIS -8 ? A HIS 6 203 15 Y 1 A HIS -7 ? A HIS 7 204 15 Y 1 A HIS -6 ? A HIS 8 205 15 Y 1 A HIS -5 ? A HIS 9 206 15 Y 1 A HIS -4 ? A HIS 10 207 15 Y 1 A SER -3 ? A SER 11 208 15 Y 1 A GLN -2 ? A GLN 12 209 15 Y 1 A ASP -1 ? A ASP 13 210 15 Y 1 A PRO 0 ? A PRO 14 211 16 Y 1 A MET -13 ? A MET 1 212 16 Y 1 A GLY -12 ? A GLY 2 213 16 Y 1 A SER -11 ? A SER 3 214 16 Y 1 A SER -10 ? A SER 4 215 16 Y 1 A HIS -9 ? A HIS 5 216 16 Y 1 A HIS -8 ? A HIS 6 217 16 Y 1 A HIS -7 ? A HIS 7 218 16 Y 1 A HIS -6 ? A HIS 8 219 16 Y 1 A HIS -5 ? A HIS 9 220 16 Y 1 A HIS -4 ? A HIS 10 221 16 Y 1 A SER -3 ? A SER 11 222 16 Y 1 A GLN -2 ? A GLN 12 223 16 Y 1 A ASP -1 ? A ASP 13 224 16 Y 1 A PRO 0 ? A PRO 14 225 17 Y 1 A MET -13 ? A MET 1 226 17 Y 1 A GLY -12 ? A GLY 2 227 17 Y 1 A SER -11 ? A SER 3 228 17 Y 1 A SER -10 ? A SER 4 229 17 Y 1 A HIS -9 ? A HIS 5 230 17 Y 1 A HIS -8 ? A HIS 6 231 17 Y 1 A HIS -7 ? A HIS 7 232 17 Y 1 A HIS -6 ? A HIS 8 233 17 Y 1 A HIS -5 ? A HIS 9 234 17 Y 1 A HIS -4 ? A HIS 10 235 17 Y 1 A SER -3 ? A SER 11 236 17 Y 1 A GLN -2 ? A GLN 12 237 17 Y 1 A ASP -1 ? A ASP 13 238 17 Y 1 A PRO 0 ? A PRO 14 239 18 Y 1 A MET -13 ? A MET 1 240 18 Y 1 A GLY -12 ? A GLY 2 241 18 Y 1 A SER -11 ? A SER 3 242 18 Y 1 A SER -10 ? A SER 4 243 18 Y 1 A HIS -9 ? A HIS 5 244 18 Y 1 A HIS -8 ? A HIS 6 245 18 Y 1 A HIS -7 ? A HIS 7 246 18 Y 1 A HIS -6 ? A HIS 8 247 18 Y 1 A HIS -5 ? A HIS 9 248 18 Y 1 A HIS -4 ? A HIS 10 249 18 Y 1 A SER -3 ? A SER 11 250 18 Y 1 A GLN -2 ? A GLN 12 251 18 Y 1 A ASP -1 ? A ASP 13 252 18 Y 1 A PRO 0 ? A PRO 14 253 19 Y 1 A MET -13 ? A MET 1 254 19 Y 1 A GLY -12 ? A GLY 2 255 19 Y 1 A SER -11 ? A SER 3 256 19 Y 1 A SER -10 ? A SER 4 257 19 Y 1 A HIS -9 ? A HIS 5 258 19 Y 1 A HIS -8 ? A HIS 6 259 19 Y 1 A HIS -7 ? A HIS 7 260 19 Y 1 A HIS -6 ? A HIS 8 261 19 Y 1 A HIS -5 ? A HIS 9 262 19 Y 1 A HIS -4 ? A HIS 10 263 19 Y 1 A SER -3 ? A SER 11 264 19 Y 1 A GLN -2 ? A GLN 12 265 19 Y 1 A ASP -1 ? A ASP 13 266 19 Y 1 A PRO 0 ? A PRO 14 267 20 Y 1 A MET -13 ? A MET 1 268 20 Y 1 A GLY -12 ? A GLY 2 269 20 Y 1 A SER -11 ? A SER 3 270 20 Y 1 A SER -10 ? A SER 4 271 20 Y 1 A HIS -9 ? A HIS 5 272 20 Y 1 A HIS -8 ? A HIS 6 273 20 Y 1 A HIS -7 ? A HIS 7 274 20 Y 1 A HIS -6 ? A HIS 8 275 20 Y 1 A HIS -5 ? A HIS 9 276 20 Y 1 A HIS -4 ? A HIS 10 277 20 Y 1 A SER -3 ? A SER 11 278 20 Y 1 A GLN -2 ? A GLN 12 279 20 Y 1 A ASP -1 ? A ASP 13 280 20 Y 1 A PRO 0 ? A PRO 14 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ALY OH O N N 14 ALY CH C N N 15 ALY CH3 C N N 16 ALY NZ N N N 17 ALY CE C N N 18 ALY CD C N N 19 ALY CG C N N 20 ALY CB C N N 21 ALY CA C N S 22 ALY N N N N 23 ALY C C N N 24 ALY O O N N 25 ALY OXT O N N 26 ALY HH31 H N N 27 ALY HH32 H N N 28 ALY HH33 H N N 29 ALY HZ H N N 30 ALY HE3 H N N 31 ALY HE2 H N N 32 ALY HD3 H N N 33 ALY HD2 H N N 34 ALY HG3 H N N 35 ALY HG2 H N N 36 ALY HB3 H N N 37 ALY HB2 H N N 38 ALY HA H N N 39 ALY H H N N 40 ALY H2 H N N 41 ALY HXT H N N 42 ARG N N N N 43 ARG CA C N S 44 ARG C C N N 45 ARG O O N N 46 ARG CB C N N 47 ARG CG C N N 48 ARG CD C N N 49 ARG NE N N N 50 ARG CZ C N N 51 ARG NH1 N N N 52 ARG NH2 N N N 53 ARG OXT O N N 54 ARG H H N N 55 ARG H2 H N N 56 ARG HA H N N 57 ARG HB2 H N N 58 ARG HB3 H N N 59 ARG HG2 H N N 60 ARG HG3 H N N 61 ARG HD2 H N N 62 ARG HD3 H N N 63 ARG HE H N N 64 ARG HH11 H N N 65 ARG HH12 H N N 66 ARG HH21 H N N 67 ARG HH22 H N N 68 ARG HXT H N N 69 ASN N N N N 70 ASN CA C N S 71 ASN C C N N 72 ASN O O N N 73 ASN CB C N N 74 ASN CG C N N 75 ASN OD1 O N N 76 ASN ND2 N N N 77 ASN OXT O N N 78 ASN H H N N 79 ASN H2 H N N 80 ASN HA H N N 81 ASN HB2 H N N 82 ASN HB3 H N N 83 ASN HD21 H N N 84 ASN HD22 H N N 85 ASN HXT H N N 86 ASP N N N N 87 ASP CA C N S 88 ASP C C N N 89 ASP O O N N 90 ASP CB C N N 91 ASP CG C N N 92 ASP OD1 O N N 93 ASP OD2 O N N 94 ASP OXT O N N 95 ASP H H N N 96 ASP H2 H N N 97 ASP HA H N N 98 ASP HB2 H N N 99 ASP HB3 H N N 100 ASP HD2 H N N 101 ASP HXT H N N 102 CYS N N N N 103 CYS CA C N R 104 CYS C C N N 105 CYS O O N N 106 CYS CB C N N 107 CYS SG S N N 108 CYS OXT O N N 109 CYS H H N N 110 CYS H2 H N N 111 CYS HA H N N 112 CYS HB2 H N N 113 CYS HB3 H N N 114 CYS HG H N N 115 CYS HXT H N N 116 GLN N N N N 117 GLN CA C N S 118 GLN C C N N 119 GLN O O N N 120 GLN CB C N N 121 GLN CG C N N 122 GLN CD C N N 123 GLN OE1 O N N 124 GLN NE2 N N N 125 GLN OXT O N N 126 GLN H H N N 127 GLN H2 H N N 128 GLN HA H N N 129 GLN HB2 H N N 130 GLN HB3 H N N 131 GLN HG2 H N N 132 GLN HG3 H N N 133 GLN HE21 H N N 134 GLN HE22 H N N 135 GLN HXT H N N 136 GLU N N N N 137 GLU CA C N S 138 GLU C C N N 139 GLU O O N N 140 GLU CB C N N 141 GLU CG C N N 142 GLU CD C N N 143 GLU OE1 O N N 144 GLU OE2 O N N 145 GLU OXT O N N 146 GLU H H N N 147 GLU H2 H N N 148 GLU HA H N N 149 GLU HB2 H N N 150 GLU HB3 H N N 151 GLU HG2 H N N 152 GLU HG3 H N N 153 GLU HE2 H N N 154 GLU HXT H N N 155 GLY N N N N 156 GLY CA C N N 157 GLY C C N N 158 GLY O O N N 159 GLY OXT O N N 160 GLY H H N N 161 GLY H2 H N N 162 GLY HA2 H N N 163 GLY HA3 H N N 164 GLY HXT H N N 165 HIS N N N N 166 HIS CA C N S 167 HIS C C N N 168 HIS O O N N 169 HIS CB C N N 170 HIS CG C Y N 171 HIS ND1 N Y N 172 HIS CD2 C Y N 173 HIS CE1 C Y N 174 HIS NE2 N Y N 175 HIS OXT O N N 176 HIS H H N N 177 HIS H2 H N N 178 HIS HA H N N 179 HIS HB2 H N N 180 HIS HB3 H N N 181 HIS HD1 H N N 182 HIS HD2 H N N 183 HIS HE1 H N N 184 HIS HE2 H N N 185 HIS HXT H N N 186 ILE N N N N 187 ILE CA C N S 188 ILE C C N N 189 ILE O O N N 190 ILE CB C N S 191 ILE CG1 C N N 192 ILE CG2 C N N 193 ILE CD1 C N N 194 ILE OXT O N N 195 ILE H H N N 196 ILE H2 H N N 197 ILE HA H N N 198 ILE HB H N N 199 ILE HG12 H N N 200 ILE HG13 H N N 201 ILE HG21 H N N 202 ILE HG22 H N N 203 ILE HG23 H N N 204 ILE HD11 H N N 205 ILE HD12 H N N 206 ILE HD13 H N N 207 ILE HXT H N N 208 LEU N N N N 209 LEU CA C N S 210 LEU C C N N 211 LEU O O N N 212 LEU CB C N N 213 LEU CG C N N 214 LEU CD1 C N N 215 LEU CD2 C N N 216 LEU OXT O N N 217 LEU H H N N 218 LEU H2 H N N 219 LEU HA H N N 220 LEU HB2 H N N 221 LEU HB3 H N N 222 LEU HG H N N 223 LEU HD11 H N N 224 LEU HD12 H N N 225 LEU HD13 H N N 226 LEU HD21 H N N 227 LEU HD22 H N N 228 LEU HD23 H N N 229 LEU HXT H N N 230 LYS N N N N 231 LYS CA C N S 232 LYS C C N N 233 LYS O O N N 234 LYS CB C N N 235 LYS CG C N N 236 LYS CD C N N 237 LYS CE C N N 238 LYS NZ N N N 239 LYS OXT O N N 240 LYS H H N N 241 LYS H2 H N N 242 LYS HA H N N 243 LYS HB2 H N N 244 LYS HB3 H N N 245 LYS HG2 H N N 246 LYS HG3 H N N 247 LYS HD2 H N N 248 LYS HD3 H N N 249 LYS HE2 H N N 250 LYS HE3 H N N 251 LYS HZ1 H N N 252 LYS HZ2 H N N 253 LYS HZ3 H N N 254 LYS HXT H N N 255 MET N N N N 256 MET CA C N S 257 MET C C N N 258 MET O O N N 259 MET CB C N N 260 MET CG C N N 261 MET SD S N N 262 MET CE C N N 263 MET OXT O N N 264 MET H H N N 265 MET H2 H N N 266 MET HA H N N 267 MET HB2 H N N 268 MET HB3 H N N 269 MET HG2 H N N 270 MET HG3 H N N 271 MET HE1 H N N 272 MET HE2 H N N 273 MET HE3 H N N 274 MET HXT H N N 275 PHE N N N N 276 PHE CA C N S 277 PHE C C N N 278 PHE O O N N 279 PHE CB C N N 280 PHE CG C Y N 281 PHE CD1 C Y N 282 PHE CD2 C Y N 283 PHE CE1 C Y N 284 PHE CE2 C Y N 285 PHE CZ C Y N 286 PHE OXT O N N 287 PHE H H N N 288 PHE H2 H N N 289 PHE HA H N N 290 PHE HB2 H N N 291 PHE HB3 H N N 292 PHE HD1 H N N 293 PHE HD2 H N N 294 PHE HE1 H N N 295 PHE HE2 H N N 296 PHE HZ H N N 297 PHE HXT H N N 298 PRO N N N N 299 PRO CA C N S 300 PRO C C N N 301 PRO O O N N 302 PRO CB C N N 303 PRO CG C N N 304 PRO CD C N N 305 PRO OXT O N N 306 PRO H H N N 307 PRO HA H N N 308 PRO HB2 H N N 309 PRO HB3 H N N 310 PRO HG2 H N N 311 PRO HG3 H N N 312 PRO HD2 H N N 313 PRO HD3 H N N 314 PRO HXT H N N 315 SER N N N N 316 SER CA C N S 317 SER C C N N 318 SER O O N N 319 SER CB C N N 320 SER OG O N N 321 SER OXT O N N 322 SER H H N N 323 SER H2 H N N 324 SER HA H N N 325 SER HB2 H N N 326 SER HB3 H N N 327 SER HG H N N 328 SER HXT H N N 329 THR N N N N 330 THR CA C N S 331 THR C C N N 332 THR O O N N 333 THR CB C N R 334 THR OG1 O N N 335 THR CG2 C N N 336 THR OXT O N N 337 THR H H N N 338 THR H2 H N N 339 THR HA H N N 340 THR HB H N N 341 THR HG1 H N N 342 THR HG21 H N N 343 THR HG22 H N N 344 THR HG23 H N N 345 THR HXT H N N 346 TYR N N N N 347 TYR CA C N S 348 TYR C C N N 349 TYR O O N N 350 TYR CB C N N 351 TYR CG C Y N 352 TYR CD1 C Y N 353 TYR CD2 C Y N 354 TYR CE1 C Y N 355 TYR CE2 C Y N 356 TYR CZ C Y N 357 TYR OH O N N 358 TYR OXT O N N 359 TYR H H N N 360 TYR H2 H N N 361 TYR HA H N N 362 TYR HB2 H N N 363 TYR HB3 H N N 364 TYR HD1 H N N 365 TYR HD2 H N N 366 TYR HE1 H N N 367 TYR HE2 H N N 368 TYR HH H N N 369 TYR HXT H N N 370 VAL N N N N 371 VAL CA C N S 372 VAL C C N N 373 VAL O O N N 374 VAL CB C N N 375 VAL CG1 C N N 376 VAL CG2 C N N 377 VAL OXT O N N 378 VAL H H N N 379 VAL H2 H N N 380 VAL HA H N N 381 VAL HB H N N 382 VAL HG11 H N N 383 VAL HG12 H N N 384 VAL HG13 H N N 385 VAL HG21 H N N 386 VAL HG22 H N N 387 VAL HG23 H N N 388 VAL HXT H N N 389 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ALY OH CH doub N N 13 ALY CH CH3 sing N N 14 ALY CH NZ sing N N 15 ALY CH3 HH31 sing N N 16 ALY CH3 HH32 sing N N 17 ALY CH3 HH33 sing N N 18 ALY NZ CE sing N N 19 ALY NZ HZ sing N N 20 ALY CE CD sing N N 21 ALY CE HE3 sing N N 22 ALY CE HE2 sing N N 23 ALY CD CG sing N N 24 ALY CD HD3 sing N N 25 ALY CD HD2 sing N N 26 ALY CG CB sing N N 27 ALY CG HG3 sing N N 28 ALY CG HG2 sing N N 29 ALY CB CA sing N N 30 ALY CB HB3 sing N N 31 ALY CB HB2 sing N N 32 ALY CA N sing N N 33 ALY CA C sing N N 34 ALY CA HA sing N N 35 ALY N H sing N N 36 ALY N H2 sing N N 37 ALY C O doub N N 38 ALY C OXT sing N N 39 ALY OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 CYS N CA sing N N 98 CYS N H sing N N 99 CYS N H2 sing N N 100 CYS CA C sing N N 101 CYS CA CB sing N N 102 CYS CA HA sing N N 103 CYS C O doub N N 104 CYS C OXT sing N N 105 CYS CB SG sing N N 106 CYS CB HB2 sing N N 107 CYS CB HB3 sing N N 108 CYS SG HG sing N N 109 CYS OXT HXT sing N N 110 GLN N CA sing N N 111 GLN N H sing N N 112 GLN N H2 sing N N 113 GLN CA C sing N N 114 GLN CA CB sing N N 115 GLN CA HA sing N N 116 GLN C O doub N N 117 GLN C OXT sing N N 118 GLN CB CG sing N N 119 GLN CB HB2 sing N N 120 GLN CB HB3 sing N N 121 GLN CG CD sing N N 122 GLN CG HG2 sing N N 123 GLN CG HG3 sing N N 124 GLN CD OE1 doub N N 125 GLN CD NE2 sing N N 126 GLN NE2 HE21 sing N N 127 GLN NE2 HE22 sing N N 128 GLN OXT HXT sing N N 129 GLU N CA sing N N 130 GLU N H sing N N 131 GLU N H2 sing N N 132 GLU CA C sing N N 133 GLU CA CB sing N N 134 GLU CA HA sing N N 135 GLU C O doub N N 136 GLU C OXT sing N N 137 GLU CB CG sing N N 138 GLU CB HB2 sing N N 139 GLU CB HB3 sing N N 140 GLU CG CD sing N N 141 GLU CG HG2 sing N N 142 GLU CG HG3 sing N N 143 GLU CD OE1 doub N N 144 GLU CD OE2 sing N N 145 GLU OE2 HE2 sing N N 146 GLU OXT HXT sing N N 147 GLY N CA sing N N 148 GLY N H sing N N 149 GLY N H2 sing N N 150 GLY CA C sing N N 151 GLY CA HA2 sing N N 152 GLY CA HA3 sing N N 153 GLY C O doub N N 154 GLY C OXT sing N N 155 GLY OXT HXT sing N N 156 HIS N CA sing N N 157 HIS N H sing N N 158 HIS N H2 sing N N 159 HIS CA C sing N N 160 HIS CA CB sing N N 161 HIS CA HA sing N N 162 HIS C O doub N N 163 HIS C OXT sing N N 164 HIS CB CG sing N N 165 HIS CB HB2 sing N N 166 HIS CB HB3 sing N N 167 HIS CG ND1 sing Y N 168 HIS CG CD2 doub Y N 169 HIS ND1 CE1 doub Y N 170 HIS ND1 HD1 sing N N 171 HIS CD2 NE2 sing Y N 172 HIS CD2 HD2 sing N N 173 HIS CE1 NE2 sing Y N 174 HIS CE1 HE1 sing N N 175 HIS NE2 HE2 sing N N 176 HIS OXT HXT sing N N 177 ILE N CA sing N N 178 ILE N H sing N N 179 ILE N H2 sing N N 180 ILE CA C sing N N 181 ILE CA CB sing N N 182 ILE CA HA sing N N 183 ILE C O doub N N 184 ILE C OXT sing N N 185 ILE CB CG1 sing N N 186 ILE CB CG2 sing N N 187 ILE CB HB sing N N 188 ILE CG1 CD1 sing N N 189 ILE CG1 HG12 sing N N 190 ILE CG1 HG13 sing N N 191 ILE CG2 HG21 sing N N 192 ILE CG2 HG22 sing N N 193 ILE CG2 HG23 sing N N 194 ILE CD1 HD11 sing N N 195 ILE CD1 HD12 sing N N 196 ILE CD1 HD13 sing N N 197 ILE OXT HXT sing N N 198 LEU N CA sing N N 199 LEU N H sing N N 200 LEU N H2 sing N N 201 LEU CA C sing N N 202 LEU CA CB sing N N 203 LEU CA HA sing N N 204 LEU C O doub N N 205 LEU C OXT sing N N 206 LEU CB CG sing N N 207 LEU CB HB2 sing N N 208 LEU CB HB3 sing N N 209 LEU CG CD1 sing N N 210 LEU CG CD2 sing N N 211 LEU CG HG sing N N 212 LEU CD1 HD11 sing N N 213 LEU CD1 HD12 sing N N 214 LEU CD1 HD13 sing N N 215 LEU CD2 HD21 sing N N 216 LEU CD2 HD22 sing N N 217 LEU CD2 HD23 sing N N 218 LEU OXT HXT sing N N 219 LYS N CA sing N N 220 LYS N H sing N N 221 LYS N H2 sing N N 222 LYS CA C sing N N 223 LYS CA CB sing N N 224 LYS CA HA sing N N 225 LYS C O doub N N 226 LYS C OXT sing N N 227 LYS CB CG sing N N 228 LYS CB HB2 sing N N 229 LYS CB HB3 sing N N 230 LYS CG CD sing N N 231 LYS CG HG2 sing N N 232 LYS CG HG3 sing N N 233 LYS CD CE sing N N 234 LYS CD HD2 sing N N 235 LYS CD HD3 sing N N 236 LYS CE NZ sing N N 237 LYS CE HE2 sing N N 238 LYS CE HE3 sing N N 239 LYS NZ HZ1 sing N N 240 LYS NZ HZ2 sing N N 241 LYS NZ HZ3 sing N N 242 LYS OXT HXT sing N N 243 MET N CA sing N N 244 MET N H sing N N 245 MET N H2 sing N N 246 MET CA C sing N N 247 MET CA CB sing N N 248 MET CA HA sing N N 249 MET C O doub N N 250 MET C OXT sing N N 251 MET CB CG sing N N 252 MET CB HB2 sing N N 253 MET CB HB3 sing N N 254 MET CG SD sing N N 255 MET CG HG2 sing N N 256 MET CG HG3 sing N N 257 MET SD CE sing N N 258 MET CE HE1 sing N N 259 MET CE HE2 sing N N 260 MET CE HE3 sing N N 261 MET OXT HXT sing N N 262 PHE N CA sing N N 263 PHE N H sing N N 264 PHE N H2 sing N N 265 PHE CA C sing N N 266 PHE CA CB sing N N 267 PHE CA HA sing N N 268 PHE C O doub N N 269 PHE C OXT sing N N 270 PHE CB CG sing N N 271 PHE CB HB2 sing N N 272 PHE CB HB3 sing N N 273 PHE CG CD1 doub Y N 274 PHE CG CD2 sing Y N 275 PHE CD1 CE1 sing Y N 276 PHE CD1 HD1 sing N N 277 PHE CD2 CE2 doub Y N 278 PHE CD2 HD2 sing N N 279 PHE CE1 CZ doub Y N 280 PHE CE1 HE1 sing N N 281 PHE CE2 CZ sing Y N 282 PHE CE2 HE2 sing N N 283 PHE CZ HZ sing N N 284 PHE OXT HXT sing N N 285 PRO N CA sing N N 286 PRO N CD sing N N 287 PRO N H sing N N 288 PRO CA C sing N N 289 PRO CA CB sing N N 290 PRO CA HA sing N N 291 PRO C O doub N N 292 PRO C OXT sing N N 293 PRO CB CG sing N N 294 PRO CB HB2 sing N N 295 PRO CB HB3 sing N N 296 PRO CG CD sing N N 297 PRO CG HG2 sing N N 298 PRO CG HG3 sing N N 299 PRO CD HD2 sing N N 300 PRO CD HD3 sing N N 301 PRO OXT HXT sing N N 302 SER N CA sing N N 303 SER N H sing N N 304 SER N H2 sing N N 305 SER CA C sing N N 306 SER CA CB sing N N 307 SER CA HA sing N N 308 SER C O doub N N 309 SER C OXT sing N N 310 SER CB OG sing N N 311 SER CB HB2 sing N N 312 SER CB HB3 sing N N 313 SER OG HG sing N N 314 SER OXT HXT sing N N 315 THR N CA sing N N 316 THR N H sing N N 317 THR N H2 sing N N 318 THR CA C sing N N 319 THR CA CB sing N N 320 THR CA HA sing N N 321 THR C O doub N N 322 THR C OXT sing N N 323 THR CB OG1 sing N N 324 THR CB CG2 sing N N 325 THR CB HB sing N N 326 THR OG1 HG1 sing N N 327 THR CG2 HG21 sing N N 328 THR CG2 HG22 sing N N 329 THR CG2 HG23 sing N N 330 THR OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 #