data_5BVL # _entry.id 5BVL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5BVL pdb_00005bvl 10.2210/pdb5bvl/pdb WWPDB D_1000210535 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-11-18 2 'Structure model' 1 1 2015-11-25 3 'Structure model' 1 2 2015-12-02 4 'Structure model' 1 3 2015-12-30 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' chem_comp_atom 2 5 'Structure model' chem_comp_bond 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5BVL _pdbx_database_status.recvd_initial_deposition_date 2015-06-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Feldmeier, K.' 1 'Hocker, B.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 29 _citation.page_last 34 _citation.title 'De novo design of a four-fold symmetric TIM-barrel protein with atomic-level accuracy.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/nchembio.1966 _citation.pdbx_database_id_PubMed 26595462 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, P.S.' 1 ? primary 'Feldmeier, K.' 2 ? primary 'Parmeggiani, F.' 3 ? primary 'Fernandez Velasco, D.A.' 4 ? primary 'Hocker, B.' 5 ? primary 'Baker, D.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'designed TIM barrel sTIM11' 22896.449 1 ? ? ? ? 2 water nat water 18.015 20 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDKDEAWKCVEQLRREGATQIAYRSDDWRDLKEAWKKGADILIVDATDKDEAWKQVEQLRREGATQIAYRSDDWRDLKEA WKKGADILIVDATDKDEAWKQVEQLRREGATQIAYRSDDWRDLKEAWKKGADILIVDATDKDEAWKQVEQLRREGATQIA YRSDDWRDLKEAWKKGADILICDATGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDKDEAWKCVEQLRREGATQIAYRSDDWRDLKEAWKKGADILIVDATDKDEAWKQVEQLRREGATQIAYRSDDWRDLKEA WKKGADILIVDATDKDEAWKQVEQLRREGATQIAYRSDDWRDLKEAWKKGADILIVDATDKDEAWKQVEQLRREGATQIA YRSDDWRDLKEAWKKGADILICDATGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LYS n 1 4 ASP n 1 5 GLU n 1 6 ALA n 1 7 TRP n 1 8 LYS n 1 9 CYS n 1 10 VAL n 1 11 GLU n 1 12 GLN n 1 13 LEU n 1 14 ARG n 1 15 ARG n 1 16 GLU n 1 17 GLY n 1 18 ALA n 1 19 THR n 1 20 GLN n 1 21 ILE n 1 22 ALA n 1 23 TYR n 1 24 ARG n 1 25 SER n 1 26 ASP n 1 27 ASP n 1 28 TRP n 1 29 ARG n 1 30 ASP n 1 31 LEU n 1 32 LYS n 1 33 GLU n 1 34 ALA n 1 35 TRP n 1 36 LYS n 1 37 LYS n 1 38 GLY n 1 39 ALA n 1 40 ASP n 1 41 ILE n 1 42 LEU n 1 43 ILE n 1 44 VAL n 1 45 ASP n 1 46 ALA n 1 47 THR n 1 48 ASP n 1 49 LYS n 1 50 ASP n 1 51 GLU n 1 52 ALA n 1 53 TRP n 1 54 LYS n 1 55 GLN n 1 56 VAL n 1 57 GLU n 1 58 GLN n 1 59 LEU n 1 60 ARG n 1 61 ARG n 1 62 GLU n 1 63 GLY n 1 64 ALA n 1 65 THR n 1 66 GLN n 1 67 ILE n 1 68 ALA n 1 69 TYR n 1 70 ARG n 1 71 SER n 1 72 ASP n 1 73 ASP n 1 74 TRP n 1 75 ARG n 1 76 ASP n 1 77 LEU n 1 78 LYS n 1 79 GLU n 1 80 ALA n 1 81 TRP n 1 82 LYS n 1 83 LYS n 1 84 GLY n 1 85 ALA n 1 86 ASP n 1 87 ILE n 1 88 LEU n 1 89 ILE n 1 90 VAL n 1 91 ASP n 1 92 ALA n 1 93 THR n 1 94 ASP n 1 95 LYS n 1 96 ASP n 1 97 GLU n 1 98 ALA n 1 99 TRP n 1 100 LYS n 1 101 GLN n 1 102 VAL n 1 103 GLU n 1 104 GLN n 1 105 LEU n 1 106 ARG n 1 107 ARG n 1 108 GLU n 1 109 GLY n 1 110 ALA n 1 111 THR n 1 112 GLN n 1 113 ILE n 1 114 ALA n 1 115 TYR n 1 116 ARG n 1 117 SER n 1 118 ASP n 1 119 ASP n 1 120 TRP n 1 121 ARG n 1 122 ASP n 1 123 LEU n 1 124 LYS n 1 125 GLU n 1 126 ALA n 1 127 TRP n 1 128 LYS n 1 129 LYS n 1 130 GLY n 1 131 ALA n 1 132 ASP n 1 133 ILE n 1 134 LEU n 1 135 ILE n 1 136 VAL n 1 137 ASP n 1 138 ALA n 1 139 THR n 1 140 ASP n 1 141 LYS n 1 142 ASP n 1 143 GLU n 1 144 ALA n 1 145 TRP n 1 146 LYS n 1 147 GLN n 1 148 VAL n 1 149 GLU n 1 150 GLN n 1 151 LEU n 1 152 ARG n 1 153 ARG n 1 154 GLU n 1 155 GLY n 1 156 ALA n 1 157 THR n 1 158 GLN n 1 159 ILE n 1 160 ALA n 1 161 TYR n 1 162 ARG n 1 163 SER n 1 164 ASP n 1 165 ASP n 1 166 TRP n 1 167 ARG n 1 168 ASP n 1 169 LEU n 1 170 LYS n 1 171 GLU n 1 172 ALA n 1 173 TRP n 1 174 LYS n 1 175 LYS n 1 176 GLY n 1 177 ALA n 1 178 ASP n 1 179 ILE n 1 180 LEU n 1 181 ILE n 1 182 CYS n 1 183 ASP n 1 184 ALA n 1 185 THR n 1 186 GLY n 1 187 LEU n 1 188 GLU n 1 189 HIS n 1 190 HIS n 1 191 HIS n 1 192 HIS n 1 193 HIS n 1 194 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 ASP 2 1 1 ASP ASP A . n A 1 3 LYS 3 2 2 LYS LYS A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 ALA 6 5 5 ALA ALA A . n A 1 7 TRP 7 6 6 TRP TRP A . n A 1 8 LYS 8 7 7 LYS LYS A . n A 1 9 CYS 9 8 8 CYS CYS A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 GLN 12 11 11 GLN GLN A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ARG 14 13 13 ARG ARG A . n A 1 15 ARG 15 14 14 ARG ARG A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 GLY 17 16 16 GLY GLY A . n A 1 18 ALA 18 17 ? ? ? A . n A 1 19 THR 19 18 18 THR THR A . n A 1 20 GLN 20 19 19 GLN GLN A . n A 1 21 ILE 21 20 20 ILE ILE A . n A 1 22 ALA 22 21 21 ALA ALA A . n A 1 23 TYR 23 22 22 TYR TYR A . n A 1 24 ARG 24 23 23 ARG ARG A . n A 1 25 SER 25 24 24 SER SER A . n A 1 26 ASP 26 25 25 ASP ASP A . n A 1 27 ASP 27 26 26 ASP ASP A . n A 1 28 TRP 28 27 27 TRP TRP A . n A 1 29 ARG 29 28 28 ARG ARG A . n A 1 30 ASP 30 29 29 ASP ASP A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 LYS 32 31 31 LYS LYS A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 ALA 34 33 33 ALA ALA A . n A 1 35 TRP 35 34 34 TRP TRP A . n A 1 36 LYS 36 35 ? ? ? A . n A 1 37 LYS 37 36 ? ? ? A . n A 1 38 GLY 38 37 ? ? ? A . n A 1 39 ALA 39 38 38 ALA ALA A . n A 1 40 ASP 40 39 39 ASP ASP A . n A 1 41 ILE 41 40 40 ILE ILE A . n A 1 42 LEU 42 41 41 LEU LEU A . n A 1 43 ILE 43 42 42 ILE ILE A . n A 1 44 VAL 44 43 43 VAL VAL A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ALA 46 45 45 ALA ALA A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 ASP 48 47 47 ASP ASP A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 ASP 50 49 49 ASP ASP A . n A 1 51 GLU 51 50 50 GLU GLU A . n A 1 52 ALA 52 51 51 ALA ALA A . n A 1 53 TRP 53 52 52 TRP TRP A . n A 1 54 LYS 54 53 53 LYS LYS A . n A 1 55 GLN 55 54 54 GLN GLN A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 GLU 57 56 56 GLU GLU A . n A 1 58 GLN 58 57 57 GLN GLN A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 ARG 60 59 59 ARG ARG A . n A 1 61 ARG 61 60 60 ARG ARG A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 GLY 63 62 62 GLY GLY A . n A 1 64 ALA 64 63 63 ALA ALA A . n A 1 65 THR 65 64 64 THR THR A . n A 1 66 GLN 66 65 65 GLN GLN A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 TYR 69 68 68 TYR TYR A . n A 1 70 ARG 70 69 69 ARG ARG A . n A 1 71 SER 71 70 70 SER SER A . n A 1 72 ASP 72 71 71 ASP ASP A . n A 1 73 ASP 73 72 72 ASP ASP A . n A 1 74 TRP 74 73 73 TRP TRP A . n A 1 75 ARG 75 74 74 ARG ARG A . n A 1 76 ASP 76 75 75 ASP ASP A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 GLU 79 78 78 GLU GLU A . n A 1 80 ALA 80 79 79 ALA ALA A . n A 1 81 TRP 81 80 80 TRP TRP A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 ASP 86 85 85 ASP ASP A . n A 1 87 ILE 87 86 86 ILE ILE A . n A 1 88 LEU 88 87 87 LEU LEU A . n A 1 89 ILE 89 88 88 ILE ILE A . n A 1 90 VAL 90 89 89 VAL VAL A . n A 1 91 ASP 91 90 90 ASP ASP A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 THR 93 92 92 THR THR A . n A 1 94 ASP 94 93 93 ASP ASP A . n A 1 95 LYS 95 94 94 LYS LYS A . n A 1 96 ASP 96 95 95 ASP ASP A . n A 1 97 GLU 97 96 96 GLU GLU A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 TRP 99 98 98 TRP TRP A . n A 1 100 LYS 100 99 99 LYS LYS A . n A 1 101 GLN 101 100 100 GLN GLN A . n A 1 102 VAL 102 101 101 VAL VAL A . n A 1 103 GLU 103 102 102 GLU GLU A . n A 1 104 GLN 104 103 103 GLN GLN A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 ARG 107 106 106 ARG ARG A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 GLY 109 108 108 GLY GLY A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 THR 111 110 110 THR THR A . n A 1 112 GLN 112 111 111 GLN GLN A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 ALA 114 113 113 ALA ALA A . n A 1 115 TYR 115 114 114 TYR TYR A . n A 1 116 ARG 116 115 115 ARG ARG A . n A 1 117 SER 117 116 116 SER SER A . n A 1 118 ASP 118 117 117 ASP ASP A . n A 1 119 ASP 119 118 118 ASP ASP A . n A 1 120 TRP 120 119 119 TRP TRP A . n A 1 121 ARG 121 120 120 ARG ARG A . n A 1 122 ASP 122 121 121 ASP ASP A . n A 1 123 LEU 123 122 122 LEU LEU A . n A 1 124 LYS 124 123 123 LYS LYS A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 TRP 127 126 126 TRP TRP A . n A 1 128 LYS 128 127 127 LYS LYS A . n A 1 129 LYS 129 128 128 LYS LYS A . n A 1 130 GLY 130 129 129 GLY GLY A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 ASP 132 131 131 ASP ASP A . n A 1 133 ILE 133 132 132 ILE ILE A . n A 1 134 LEU 134 133 133 LEU LEU A . n A 1 135 ILE 135 134 134 ILE ILE A . n A 1 136 VAL 136 135 135 VAL VAL A . n A 1 137 ASP 137 136 136 ASP ASP A . n A 1 138 ALA 138 137 137 ALA ALA A . n A 1 139 THR 139 138 138 THR THR A . n A 1 140 ASP 140 139 139 ASP ASP A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 TRP 145 144 144 TRP TRP A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 GLN 147 146 146 GLN GLN A . n A 1 148 VAL 148 147 147 VAL VAL A . n A 1 149 GLU 149 148 148 GLU GLU A . n A 1 150 GLN 150 149 149 GLN GLN A . n A 1 151 LEU 151 150 150 LEU LEU A . n A 1 152 ARG 152 151 151 ARG ARG A . n A 1 153 ARG 153 152 152 ARG ARG A . n A 1 154 GLU 154 153 153 GLU GLU A . n A 1 155 GLY 155 154 154 GLY GLY A . n A 1 156 ALA 156 155 155 ALA ALA A . n A 1 157 THR 157 156 156 THR THR A . n A 1 158 GLN 158 157 157 GLN GLN A . n A 1 159 ILE 159 158 158 ILE ILE A . n A 1 160 ALA 160 159 159 ALA ALA A . n A 1 161 TYR 161 160 160 TYR TYR A . n A 1 162 ARG 162 161 161 ARG ARG A . n A 1 163 SER 163 162 162 SER SER A . n A 1 164 ASP 164 163 163 ASP ASP A . n A 1 165 ASP 165 164 164 ASP ASP A . n A 1 166 TRP 166 165 165 TRP TRP A . n A 1 167 ARG 167 166 166 ARG ARG A . n A 1 168 ASP 168 167 167 ASP ASP A . n A 1 169 LEU 169 168 168 LEU LEU A . n A 1 170 LYS 170 169 169 LYS LYS A . n A 1 171 GLU 171 170 170 GLU GLU A . n A 1 172 ALA 172 171 171 ALA ALA A . n A 1 173 TRP 173 172 172 TRP TRP A . n A 1 174 LYS 174 173 173 LYS LYS A . n A 1 175 LYS 175 174 174 LYS LYS A . n A 1 176 GLY 176 175 175 GLY GLY A . n A 1 177 ALA 177 176 176 ALA ALA A . n A 1 178 ASP 178 177 177 ASP ASP A . n A 1 179 ILE 179 178 178 ILE ILE A . n A 1 180 LEU 180 179 179 LEU LEU A . n A 1 181 ILE 181 180 180 ILE ILE A . n A 1 182 CYS 182 181 181 CYS CYS A . n A 1 183 ASP 183 182 182 ASP ASP A . n A 1 184 ALA 184 183 183 ALA ALA A . n A 1 185 THR 185 184 184 THR THR A . n A 1 186 GLY 186 185 ? ? ? A . n A 1 187 LEU 187 186 ? ? ? A . n A 1 188 GLU 188 187 ? ? ? A . n A 1 189 HIS 189 188 ? ? ? A . n A 1 190 HIS 190 189 ? ? ? A . n A 1 191 HIS 191 190 ? ? ? A . n A 1 192 HIS 192 191 ? ? ? A . n A 1 193 HIS 193 192 ? ? ? A . n A 1 194 HIS 194 193 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 13 HOH HOH A . B 2 HOH 2 202 6 HOH HOH A . B 2 HOH 3 203 11 HOH HOH A . B 2 HOH 4 204 2 HOH HOH A . B 2 HOH 5 205 15 HOH HOH A . B 2 HOH 6 206 20 HOH HOH A . B 2 HOH 7 207 18 HOH HOH A . B 2 HOH 8 208 10 HOH HOH A . B 2 HOH 9 209 7 HOH HOH A . B 2 HOH 10 210 9 HOH HOH A . B 2 HOH 11 211 19 HOH HOH A . B 2 HOH 12 212 5 HOH HOH A . B 2 HOH 13 213 1 HOH HOH A . B 2 HOH 14 214 4 HOH HOH A . B 2 HOH 15 215 17 HOH HOH A . B 2 HOH 16 216 8 HOH HOH A . B 2 HOH 17 217 14 HOH HOH A . B 2 HOH 18 218 3 HOH HOH A . B 2 HOH 19 219 16 HOH HOH A . B 2 HOH 20 220 12 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 2 ? CG ? A LYS 3 CG 2 1 Y 1 A LYS 2 ? CD ? A LYS 3 CD 3 1 Y 1 A LYS 2 ? CE ? A LYS 3 CE 4 1 Y 1 A LYS 2 ? NZ ? A LYS 3 NZ 5 1 Y 1 A GLU 4 ? CG ? A GLU 5 CG 6 1 Y 1 A GLU 4 ? CD ? A GLU 5 CD 7 1 Y 1 A GLU 4 ? OE1 ? A GLU 5 OE1 8 1 Y 1 A GLU 4 ? OE2 ? A GLU 5 OE2 9 1 Y 1 A LYS 7 ? CG ? A LYS 8 CG 10 1 Y 1 A LYS 7 ? CD ? A LYS 8 CD 11 1 Y 1 A LYS 7 ? CE ? A LYS 8 CE 12 1 Y 1 A LYS 7 ? NZ ? A LYS 8 NZ 13 1 Y 1 A GLU 10 ? CG ? A GLU 11 CG 14 1 Y 1 A GLU 10 ? CD ? A GLU 11 CD 15 1 Y 1 A GLU 10 ? OE1 ? A GLU 11 OE1 16 1 Y 1 A GLU 10 ? OE2 ? A GLU 11 OE2 17 1 Y 1 A LYS 31 ? CG ? A LYS 32 CG 18 1 Y 1 A LYS 31 ? CD ? A LYS 32 CD 19 1 Y 1 A LYS 31 ? CE ? A LYS 32 CE 20 1 Y 1 A LYS 31 ? NZ ? A LYS 32 NZ 21 1 Y 1 A GLU 32 ? CG ? A GLU 33 CG 22 1 Y 1 A GLU 32 ? CD ? A GLU 33 CD 23 1 Y 1 A GLU 32 ? OE1 ? A GLU 33 OE1 24 1 Y 1 A GLU 32 ? OE2 ? A GLU 33 OE2 25 1 Y 1 A GLU 96 ? CG ? A GLU 97 CG 26 1 Y 1 A GLU 96 ? CD ? A GLU 97 CD 27 1 Y 1 A GLU 96 ? OE1 ? A GLU 97 OE1 28 1 Y 1 A GLU 96 ? OE2 ? A GLU 97 OE2 29 1 Y 1 A THR 110 ? OG1 ? A THR 111 OG1 30 1 Y 1 A THR 110 ? CG2 ? A THR 111 CG2 31 1 Y 1 A LYS 140 ? CG ? A LYS 141 CG 32 1 Y 1 A LYS 140 ? CD ? A LYS 141 CD 33 1 Y 1 A LYS 140 ? CE ? A LYS 141 CE 34 1 Y 1 A LYS 140 ? NZ ? A LYS 141 NZ 35 1 Y 1 A ASP 141 ? CG ? A ASP 142 CG 36 1 Y 1 A ASP 141 ? OD1 ? A ASP 142 OD1 37 1 Y 1 A ASP 141 ? OD2 ? A ASP 142 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5BVL _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.080 _cell.length_a_esd ? _cell.length_b 50.080 _cell.length_b_esd ? _cell.length_c 131.280 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5BVL _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5BVL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.8 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.7 _exptl_crystal.description Needle _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG 3350, 0.2M magnesium chloride hexahydrate, 0.1M bis-tris' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-11-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'DOUBLE-CRYSTAL SI' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 41.84 _reflns.entry_id 5BVL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.992 _reflns.d_resolution_low 46.79 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11894 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.26 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.86 _reflns.pdbx_Rmerge_I_obs 0.05804 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.24 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.992 _reflns_shell.d_res_low 2.064 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.79 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 93.20 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.6607 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 61.90 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5BVL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.992 _refine.ls_d_res_low 46.79 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11894 _refine.ls_number_reflns_R_free 595 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.26 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2254 _refine.ls_R_factor_R_free 0.2607 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2237 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Rosetta backbone model' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.25 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1461 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 20 _refine_hist.number_atoms_total 1481 _refine_hist.d_res_high 1.992 _refine_hist.d_res_low 46.79 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 ? 1486 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.215 ? 2010 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.025 ? 541 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.050 ? 211 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 260 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9923 2.1928 . . 142 2707 97.00 . . . 0.2635 . 0.2438 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1928 2.5101 . . 148 2797 100.00 . . . 0.2910 . 0.2430 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5101 3.1624 . . 149 2836 100.00 . . . 0.2861 . 0.2655 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1624 46.8039 . . 156 2959 97.00 . . . 0.2454 . 0.2035 . . . . . . . . . . # _struct.entry_id 5BVL _struct.title 'Crystal structure of a de novo designed TIM-barrel' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5BVL _struct_keywords.text 'TIM-barrel, computational design, idealized scaffold, de novo protein' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5BVL _struct_ref.pdbx_db_accession 5BVL _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5BVL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 194 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5BVL _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 193 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 193 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8740 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? GLU A 16 ? ASP A 1 GLU A 15 1 ? 15 HELX_P HELX_P2 AA2 ASP A 27 ? TRP A 35 ? ASP A 26 TRP A 34 1 ? 9 HELX_P HELX_P3 AA3 ASP A 48 ? GLY A 63 ? ASP A 47 GLY A 62 1 ? 16 HELX_P HELX_P4 AA4 ASP A 73 ? LYS A 83 ? ASP A 72 LYS A 82 1 ? 11 HELX_P HELX_P5 AA5 ASP A 94 ? GLU A 108 ? ASP A 93 GLU A 107 1 ? 15 HELX_P HELX_P6 AA6 ASP A 119 ? GLY A 130 ? ASP A 118 GLY A 129 1 ? 12 HELX_P HELX_P7 AA7 ASP A 140 ? GLU A 143 ? ASP A 139 GLU A 142 5 ? 4 HELX_P HELX_P8 AA8 ALA A 144 ? GLY A 155 ? ALA A 143 GLY A 154 1 ? 12 HELX_P HELX_P9 AA9 ASP A 165 ? GLY A 176 ? ASP A 164 GLY A 175 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 20 ? SER A 25 ? GLN A 19 SER A 24 AA1 2 ILE A 41 ? VAL A 44 ? ILE A 40 VAL A 43 AA1 3 ILE A 67 ? SER A 71 ? ILE A 66 SER A 70 AA1 4 ILE A 87 ? ASP A 91 ? ILE A 86 ASP A 90 AA1 5 GLN A 112 ? SER A 117 ? GLN A 111 SER A 116 AA1 6 ILE A 133 ? ASP A 137 ? ILE A 132 ASP A 136 AA1 7 ILE A 159 ? SER A 163 ? ILE A 158 SER A 162 AA1 8 ILE A 179 ? CYS A 182 ? ILE A 178 CYS A 181 AA1 9 GLN A 20 ? SER A 25 ? GLN A 19 SER A 24 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 21 ? N ILE A 20 O ILE A 41 ? O ILE A 40 AA1 2 3 N LEU A 42 ? N LEU A 41 O ALA A 68 ? O ALA A 67 AA1 3 4 N TYR A 69 ? N TYR A 68 O ILE A 89 ? O ILE A 88 AA1 4 5 N LEU A 88 ? N LEU A 87 O ALA A 114 ? O ALA A 113 AA1 5 6 N TYR A 115 ? N TYR A 114 O ILE A 135 ? O ILE A 134 AA1 6 7 N LEU A 134 ? N LEU A 133 O ALA A 160 ? O ALA A 159 AA1 7 8 N TYR A 161 ? N TYR A 160 O ILE A 181 ? O ILE A 180 AA1 8 9 O LEU A 180 ? O LEU A 179 N GLN A 20 ? N GLN A 19 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 44 ? ? HH21 A ARG 69 ? ? 1.38 2 1 HZ3 A LYS 169 ? ? O A HOH 201 ? ? 1.59 3 1 OD2 A ASP 44 ? ? NH2 A ARG 69 ? ? 2.15 4 1 NZ A LYS 169 ? ? O A HOH 201 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 46 ? ? -171.03 106.17 2 1 ASP A 47 ? ? 59.44 90.04 3 1 THR A 92 ? ? -132.19 -30.39 4 1 ASP A 139 ? ? -93.04 48.13 5 1 LYS A 140 ? ? -25.99 -59.81 # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A ALA 17 ? A ALA 18 3 1 Y 1 A LYS 35 ? A LYS 36 4 1 Y 1 A LYS 36 ? A LYS 37 5 1 Y 1 A GLY 37 ? A GLY 38 6 1 Y 1 A GLY 185 ? A GLY 186 7 1 Y 1 A LEU 186 ? A LEU 187 8 1 Y 1 A GLU 187 ? A GLU 188 9 1 Y 1 A HIS 188 ? A HIS 189 10 1 Y 1 A HIS 189 ? A HIS 190 11 1 Y 1 A HIS 190 ? A HIS 191 12 1 Y 1 A HIS 191 ? A HIS 192 13 1 Y 1 A HIS 192 ? A HIS 193 14 1 Y 1 A HIS 193 ? A HIS 194 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 HOH O O N N 141 HOH H1 H N N 142 HOH H2 H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 SER N N N N 233 SER CA C N S 234 SER C C N N 235 SER O O N N 236 SER CB C N N 237 SER OG O N N 238 SER OXT O N N 239 SER H H N N 240 SER H2 H N N 241 SER HA H N N 242 SER HB2 H N N 243 SER HB3 H N N 244 SER HG H N N 245 SER HXT H N N 246 THR N N N N 247 THR CA C N S 248 THR C C N N 249 THR O O N N 250 THR CB C N R 251 THR OG1 O N N 252 THR CG2 C N N 253 THR OXT O N N 254 THR H H N N 255 THR H2 H N N 256 THR HA H N N 257 THR HB H N N 258 THR HG1 H N N 259 THR HG21 H N N 260 THR HG22 H N N 261 THR HG23 H N N 262 THR HXT H N N 263 TRP N N N N 264 TRP CA C N S 265 TRP C C N N 266 TRP O O N N 267 TRP CB C N N 268 TRP CG C Y N 269 TRP CD1 C Y N 270 TRP CD2 C Y N 271 TRP NE1 N Y N 272 TRP CE2 C Y N 273 TRP CE3 C Y N 274 TRP CZ2 C Y N 275 TRP CZ3 C Y N 276 TRP CH2 C Y N 277 TRP OXT O N N 278 TRP H H N N 279 TRP H2 H N N 280 TRP HA H N N 281 TRP HB2 H N N 282 TRP HB3 H N N 283 TRP HD1 H N N 284 TRP HE1 H N N 285 TRP HE3 H N N 286 TRP HZ2 H N N 287 TRP HZ3 H N N 288 TRP HH2 H N N 289 TRP HXT H N N 290 TYR N N N N 291 TYR CA C N S 292 TYR C C N N 293 TYR O O N N 294 TYR CB C N N 295 TYR CG C Y N 296 TYR CD1 C Y N 297 TYR CD2 C Y N 298 TYR CE1 C Y N 299 TYR CE2 C Y N 300 TYR CZ C Y N 301 TYR OH O N N 302 TYR OXT O N N 303 TYR H H N N 304 TYR H2 H N N 305 TYR HA H N N 306 TYR HB2 H N N 307 TYR HB3 H N N 308 TYR HD1 H N N 309 TYR HD2 H N N 310 TYR HE1 H N N 311 TYR HE2 H N N 312 TYR HH H N N 313 TYR HXT H N N 314 VAL N N N N 315 VAL CA C N S 316 VAL C C N N 317 VAL O O N N 318 VAL CB C N N 319 VAL CG1 C N N 320 VAL CG2 C N N 321 VAL OXT O N N 322 VAL H H N N 323 VAL H2 H N N 324 VAL HA H N N 325 VAL HB H N N 326 VAL HG11 H N N 327 VAL HG12 H N N 328 VAL HG13 H N N 329 VAL HG21 H N N 330 VAL HG22 H N N 331 VAL HG23 H N N 332 VAL HXT H N N 333 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 HOH O H1 sing N N 134 HOH O H2 sing N N 135 ILE N CA sing N N 136 ILE N H sing N N 137 ILE N H2 sing N N 138 ILE CA C sing N N 139 ILE CA CB sing N N 140 ILE CA HA sing N N 141 ILE C O doub N N 142 ILE C OXT sing N N 143 ILE CB CG1 sing N N 144 ILE CB CG2 sing N N 145 ILE CB HB sing N N 146 ILE CG1 CD1 sing N N 147 ILE CG1 HG12 sing N N 148 ILE CG1 HG13 sing N N 149 ILE CG2 HG21 sing N N 150 ILE CG2 HG22 sing N N 151 ILE CG2 HG23 sing N N 152 ILE CD1 HD11 sing N N 153 ILE CD1 HD12 sing N N 154 ILE CD1 HD13 sing N N 155 ILE OXT HXT sing N N 156 LEU N CA sing N N 157 LEU N H sing N N 158 LEU N H2 sing N N 159 LEU CA C sing N N 160 LEU CA CB sing N N 161 LEU CA HA sing N N 162 LEU C O doub N N 163 LEU C OXT sing N N 164 LEU CB CG sing N N 165 LEU CB HB2 sing N N 166 LEU CB HB3 sing N N 167 LEU CG CD1 sing N N 168 LEU CG CD2 sing N N 169 LEU CG HG sing N N 170 LEU CD1 HD11 sing N N 171 LEU CD1 HD12 sing N N 172 LEU CD1 HD13 sing N N 173 LEU CD2 HD21 sing N N 174 LEU CD2 HD22 sing N N 175 LEU CD2 HD23 sing N N 176 LEU OXT HXT sing N N 177 LYS N CA sing N N 178 LYS N H sing N N 179 LYS N H2 sing N N 180 LYS CA C sing N N 181 LYS CA CB sing N N 182 LYS CA HA sing N N 183 LYS C O doub N N 184 LYS C OXT sing N N 185 LYS CB CG sing N N 186 LYS CB HB2 sing N N 187 LYS CB HB3 sing N N 188 LYS CG CD sing N N 189 LYS CG HG2 sing N N 190 LYS CG HG3 sing N N 191 LYS CD CE sing N N 192 LYS CD HD2 sing N N 193 LYS CD HD3 sing N N 194 LYS CE NZ sing N N 195 LYS CE HE2 sing N N 196 LYS CE HE3 sing N N 197 LYS NZ HZ1 sing N N 198 LYS NZ HZ2 sing N N 199 LYS NZ HZ3 sing N N 200 LYS OXT HXT sing N N 201 MET N CA sing N N 202 MET N H sing N N 203 MET N H2 sing N N 204 MET CA C sing N N 205 MET CA CB sing N N 206 MET CA HA sing N N 207 MET C O doub N N 208 MET C OXT sing N N 209 MET CB CG sing N N 210 MET CB HB2 sing N N 211 MET CB HB3 sing N N 212 MET CG SD sing N N 213 MET CG HG2 sing N N 214 MET CG HG3 sing N N 215 MET SD CE sing N N 216 MET CE HE1 sing N N 217 MET CE HE2 sing N N 218 MET CE HE3 sing N N 219 MET OXT HXT sing N N 220 SER N CA sing N N 221 SER N H sing N N 222 SER N H2 sing N N 223 SER CA C sing N N 224 SER CA CB sing N N 225 SER CA HA sing N N 226 SER C O doub N N 227 SER C OXT sing N N 228 SER CB OG sing N N 229 SER CB HB2 sing N N 230 SER CB HB3 sing N N 231 SER OG HG sing N N 232 SER OXT HXT sing N N 233 THR N CA sing N N 234 THR N H sing N N 235 THR N H2 sing N N 236 THR CA C sing N N 237 THR CA CB sing N N 238 THR CA HA sing N N 239 THR C O doub N N 240 THR C OXT sing N N 241 THR CB OG1 sing N N 242 THR CB CG2 sing N N 243 THR CB HB sing N N 244 THR OG1 HG1 sing N N 245 THR CG2 HG21 sing N N 246 THR CG2 HG22 sing N N 247 THR CG2 HG23 sing N N 248 THR OXT HXT sing N N 249 TRP N CA sing N N 250 TRP N H sing N N 251 TRP N H2 sing N N 252 TRP CA C sing N N 253 TRP CA CB sing N N 254 TRP CA HA sing N N 255 TRP C O doub N N 256 TRP C OXT sing N N 257 TRP CB CG sing N N 258 TRP CB HB2 sing N N 259 TRP CB HB3 sing N N 260 TRP CG CD1 doub Y N 261 TRP CG CD2 sing Y N 262 TRP CD1 NE1 sing Y N 263 TRP CD1 HD1 sing N N 264 TRP CD2 CE2 doub Y N 265 TRP CD2 CE3 sing Y N 266 TRP NE1 CE2 sing Y N 267 TRP NE1 HE1 sing N N 268 TRP CE2 CZ2 sing Y N 269 TRP CE3 CZ3 doub Y N 270 TRP CE3 HE3 sing N N 271 TRP CZ2 CH2 doub Y N 272 TRP CZ2 HZ2 sing N N 273 TRP CZ3 CH2 sing Y N 274 TRP CZ3 HZ3 sing N N 275 TRP CH2 HH2 sing N N 276 TRP OXT HXT sing N N 277 TYR N CA sing N N 278 TYR N H sing N N 279 TYR N H2 sing N N 280 TYR CA C sing N N 281 TYR CA CB sing N N 282 TYR CA HA sing N N 283 TYR C O doub N N 284 TYR C OXT sing N N 285 TYR CB CG sing N N 286 TYR CB HB2 sing N N 287 TYR CB HB3 sing N N 288 TYR CG CD1 doub Y N 289 TYR CG CD2 sing Y N 290 TYR CD1 CE1 sing Y N 291 TYR CD1 HD1 sing N N 292 TYR CD2 CE2 doub Y N 293 TYR CD2 HD2 sing N N 294 TYR CE1 CZ doub Y N 295 TYR CE1 HE1 sing N N 296 TYR CE2 CZ sing Y N 297 TYR CE2 HE2 sing N N 298 TYR CZ OH sing N N 299 TYR OH HH sing N N 300 TYR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'Rosetta backbone model' # _atom_sites.entry_id 5BVL _atom_sites.fract_transf_matrix[1][1] 0.019968 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019968 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007617 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_