data_5C20 # _entry.id 5C20 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5C20 pdb_00005c20 10.2210/pdb5c20/pdb WWPDB D_1000210896 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-01 2 'Structure model' 1 1 2016-10-26 3 'Structure model' 1 2 2017-09-27 4 'Structure model' 2 0 2020-09-02 5 'Structure model' 2 1 2023-11-08 6 'Structure model' 2 2 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Non-polymer description' 6 4 'Structure model' 'Structure summary' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Refinement description' 10 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' diffrn_detector 2 3 'Structure model' pdbx_struct_oper_list 3 4 'Structure model' chem_comp 4 4 'Structure model' entity 5 4 'Structure model' pdbx_entity_nonpoly 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_initial_refinement_model 10 6 'Structure model' pdbx_entry_details 11 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_diffrn_detector.detector' 2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 4 'Structure model' '_chem_comp.formula' 4 4 'Structure model' '_chem_comp.formula_weight' 5 4 'Structure model' '_chem_comp.name' 6 4 'Structure model' '_entity.formula_weight' 7 4 'Structure model' '_entity.pdbx_description' 8 4 'Structure model' '_pdbx_entity_nonpoly.name' 9 5 'Structure model' '_database_2.pdbx_DOI' 10 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5C20 _pdbx_database_status.recvd_initial_deposition_date 2015-06-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 4GHQ unspecified PDB . 4GHT unspecified PDB . 5C1U unspecified PDB . 5C1X unspecified PDB . 5C1Y unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, L.' 1 'Huang, G.' 2 'Cai, Q.' 3 'Zhao, C.' 4 'Ren, H.' 5 'Li, P.' 6 'Li, N.' 7 'Chen, S.' 8 'Li, J.' 9 'Lin, T.' 10 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Recognit. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 0952-3499 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 520 _citation.page_last 527 _citation.title 'Optimize the interactions at S4 with efficient inhibitors targeting 3C proteinase from enterovirus 71' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/jmr.2551 _citation.pdbx_database_id_PubMed 27185390 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, L.' 1 ? primary 'Huang, G.' 2 ? primary 'Cai, Q.' 3 ? primary 'Zhao, C.' 4 ? primary 'Tang, L.' 5 ? primary 'Ren, H.' 6 ? primary 'Li, P.' 7 ? primary 'Li, N.' 8 ? primary 'Huang, J.' 9 ? primary 'Chen, X.' 10 ? primary 'Guan, Y.' 11 ? primary 'You, H.' 12 ? primary 'Chen, S.' 13 ? primary 'Li, J.' 14 ? primary 'Lin, T.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3C proteinase' 21391.482 1 3.4.22.28 ? ? ? 2 non-polymer syn ;2-methylpropyl N-[(2S)-1-oxidanylidene-1-[[(2S)-1-oxidanyl-3-[(3S)-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]-3-phenyl-propan-2-yl]carbamate ; 405.488 1 ? ? ? ? 3 water nat water 18.015 13 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGPSLDFALSLLRRNVRQVQTDQGHFTMLGVRDRLAVLPRHSQPGKTIWIEHKLVNILDAVELVDEQGVNLELTLITLDT NEKFRDITKFIPENISTASDATLVINTEHMPSMFVPVGDVVQYGFLNLSGKPTHRTMMYNFPTKAGQCGGVVTSVGKVIG IHIGGNGRQGFCAGLKRSYFASEQLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGPSLDFALSLLRRNVRQVQTDQGHFTMLGVRDRLAVLPRHSQPGKTIWIEHKLVNILDAVELVDEQGVNLELTLITLDT NEKFRDITKFIPENISTASDATLVINTEHMPSMFVPVGDVVQYGFLNLSGKPTHRTMMYNFPTKAGQCGGVVTSVGKVIG IHIGGNGRQGFCAGLKRSYFASEQLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2-methylpropyl N-[(2S)-1-oxidanylidene-1-[[(2S)-1-oxidanyl-3-[(3S)-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]-3-phenyl-propan-2-yl]carbamate ; GHZ 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 PRO n 1 4 SER n 1 5 LEU n 1 6 ASP n 1 7 PHE n 1 8 ALA n 1 9 LEU n 1 10 SER n 1 11 LEU n 1 12 LEU n 1 13 ARG n 1 14 ARG n 1 15 ASN n 1 16 VAL n 1 17 ARG n 1 18 GLN n 1 19 VAL n 1 20 GLN n 1 21 THR n 1 22 ASP n 1 23 GLN n 1 24 GLY n 1 25 HIS n 1 26 PHE n 1 27 THR n 1 28 MET n 1 29 LEU n 1 30 GLY n 1 31 VAL n 1 32 ARG n 1 33 ASP n 1 34 ARG n 1 35 LEU n 1 36 ALA n 1 37 VAL n 1 38 LEU n 1 39 PRO n 1 40 ARG n 1 41 HIS n 1 42 SER n 1 43 GLN n 1 44 PRO n 1 45 GLY n 1 46 LYS n 1 47 THR n 1 48 ILE n 1 49 TRP n 1 50 ILE n 1 51 GLU n 1 52 HIS n 1 53 LYS n 1 54 LEU n 1 55 VAL n 1 56 ASN n 1 57 ILE n 1 58 LEU n 1 59 ASP n 1 60 ALA n 1 61 VAL n 1 62 GLU n 1 63 LEU n 1 64 VAL n 1 65 ASP n 1 66 GLU n 1 67 GLN n 1 68 GLY n 1 69 VAL n 1 70 ASN n 1 71 LEU n 1 72 GLU n 1 73 LEU n 1 74 THR n 1 75 LEU n 1 76 ILE n 1 77 THR n 1 78 LEU n 1 79 ASP n 1 80 THR n 1 81 ASN n 1 82 GLU n 1 83 LYS n 1 84 PHE n 1 85 ARG n 1 86 ASP n 1 87 ILE n 1 88 THR n 1 89 LYS n 1 90 PHE n 1 91 ILE n 1 92 PRO n 1 93 GLU n 1 94 ASN n 1 95 ILE n 1 96 SER n 1 97 THR n 1 98 ALA n 1 99 SER n 1 100 ASP n 1 101 ALA n 1 102 THR n 1 103 LEU n 1 104 VAL n 1 105 ILE n 1 106 ASN n 1 107 THR n 1 108 GLU n 1 109 HIS n 1 110 MET n 1 111 PRO n 1 112 SER n 1 113 MET n 1 114 PHE n 1 115 VAL n 1 116 PRO n 1 117 VAL n 1 118 GLY n 1 119 ASP n 1 120 VAL n 1 121 VAL n 1 122 GLN n 1 123 TYR n 1 124 GLY n 1 125 PHE n 1 126 LEU n 1 127 ASN n 1 128 LEU n 1 129 SER n 1 130 GLY n 1 131 LYS n 1 132 PRO n 1 133 THR n 1 134 HIS n 1 135 ARG n 1 136 THR n 1 137 MET n 1 138 MET n 1 139 TYR n 1 140 ASN n 1 141 PHE n 1 142 PRO n 1 143 THR n 1 144 LYS n 1 145 ALA n 1 146 GLY n 1 147 GLN n 1 148 CYS n 1 149 GLY n 1 150 GLY n 1 151 VAL n 1 152 VAL n 1 153 THR n 1 154 SER n 1 155 VAL n 1 156 GLY n 1 157 LYS n 1 158 VAL n 1 159 ILE n 1 160 GLY n 1 161 ILE n 1 162 HIS n 1 163 ILE n 1 164 GLY n 1 165 GLY n 1 166 ASN n 1 167 GLY n 1 168 ARG n 1 169 GLN n 1 170 GLY n 1 171 PHE n 1 172 CYS n 1 173 ALA n 1 174 GLY n 1 175 LEU n 1 176 LYS n 1 177 ARG n 1 178 SER n 1 179 TYR n 1 180 PHE n 1 181 ALA n 1 182 SER n 1 183 GLU n 1 184 GLN n 1 185 LEU n 1 186 GLU n 1 187 HIS n 1 188 HIS n 1 189 HIS n 1 190 HIS n 1 191 HIS n 1 192 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 192 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain E2004104-TW-CDC _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterovirus A71' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 39054 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GHZ non-polymer . ;2-methylpropyl N-[(2S)-1-oxidanylidene-1-[[(2S)-1-oxidanyl-3-[(3S)-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]-3-phenyl-propan-2-yl]carbamate ; ? 'C21 H31 N3 O5' 405.488 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 GLY 2 1 1 GLY GLY A . n A 1 3 PRO 3 2 2 PRO PRO A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 LEU 5 4 4 LEU LEU A . n A 1 6 ASP 6 5 5 ASP ASP A . n A 1 7 PHE 7 6 6 PHE PHE A . n A 1 8 ALA 8 7 7 ALA ALA A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 SER 10 9 9 SER SER A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 ARG 13 12 12 ARG ARG A . n A 1 14 ARG 14 13 13 ARG ARG A . n A 1 15 ASN 15 14 14 ASN ASN A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 ARG 17 16 16 ARG ARG A . n A 1 18 GLN 18 17 17 GLN GLN A . n A 1 19 VAL 19 18 18 VAL VAL A . n A 1 20 GLN 20 19 19 GLN GLN A . n A 1 21 THR 21 20 20 THR THR A . n A 1 22 ASP 22 21 21 ASP ASP A . n A 1 23 GLN 23 22 22 GLN GLN A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 HIS 25 24 24 HIS HIS A . n A 1 26 PHE 26 25 25 PHE PHE A . n A 1 27 THR 27 26 26 THR THR A . n A 1 28 MET 28 27 27 MET MET A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 ASP 33 32 32 ASP ASP A . n A 1 34 ARG 34 33 33 ARG ARG A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 ALA 36 35 35 ALA ALA A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 PRO 39 38 38 PRO PRO A . n A 1 40 ARG 40 39 39 ARG ARG A . n A 1 41 HIS 41 40 40 HIS HIS A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 GLN 43 42 42 GLN GLN A . n A 1 44 PRO 44 43 43 PRO PRO A . n A 1 45 GLY 45 44 44 GLY GLY A . n A 1 46 LYS 46 45 45 LYS LYS A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 TRP 49 48 48 TRP TRP A . n A 1 50 ILE 50 49 49 ILE ILE A . n A 1 51 GLU 51 50 50 GLU GLU A . n A 1 52 HIS 52 51 51 HIS HIS A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 ASN 56 55 55 ASN ASN A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 ASP 59 58 58 ASP ASP A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 VAL 61 60 60 VAL VAL A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 LEU 63 62 62 LEU LEU A . n A 1 64 VAL 64 63 63 VAL VAL A . n A 1 65 ASP 65 64 64 ASP ASP A . n A 1 66 GLU 66 65 65 GLU GLU A . n A 1 67 GLN 67 66 66 GLN GLN A . n A 1 68 GLY 68 67 67 GLY GLY A . n A 1 69 VAL 69 68 68 VAL VAL A . n A 1 70 ASN 70 69 69 ASN ASN A . n A 1 71 LEU 71 70 70 LEU LEU A . n A 1 72 GLU 72 71 71 GLU GLU A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 THR 74 73 73 THR THR A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 THR 77 76 76 THR THR A . n A 1 78 LEU 78 77 77 LEU LEU A . n A 1 79 ASP 79 78 78 ASP ASP A . n A 1 80 THR 80 79 79 THR THR A . n A 1 81 ASN 81 80 80 ASN ASN A . n A 1 82 GLU 82 81 81 GLU GLU A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 PHE 84 83 83 PHE PHE A . n A 1 85 ARG 85 84 84 ARG ARG A . n A 1 86 ASP 86 85 85 ASP ASP A . n A 1 87 ILE 87 86 86 ILE ILE A . n A 1 88 THR 88 87 87 THR THR A . n A 1 89 LYS 89 88 88 LYS LYS A . n A 1 90 PHE 90 89 89 PHE PHE A . n A 1 91 ILE 91 90 90 ILE ILE A . n A 1 92 PRO 92 91 91 PRO PRO A . n A 1 93 GLU 93 92 92 GLU GLU A . n A 1 94 ASN 94 93 93 ASN ASN A . n A 1 95 ILE 95 94 94 ILE ILE A . n A 1 96 SER 96 95 95 SER SER A . n A 1 97 THR 97 96 96 THR THR A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 ASP 100 99 99 ASP ASP A . n A 1 101 ALA 101 100 100 ALA ALA A . n A 1 102 THR 102 101 101 THR THR A . n A 1 103 LEU 103 102 102 LEU LEU A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 ILE 105 104 104 ILE ILE A . n A 1 106 ASN 106 105 105 ASN ASN A . n A 1 107 THR 107 106 106 THR THR A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 HIS 109 108 108 HIS HIS A . n A 1 110 MET 110 109 109 MET MET A . n A 1 111 PRO 111 110 110 PRO PRO A . n A 1 112 SER 112 111 111 SER SER A . n A 1 113 MET 113 112 112 MET MET A . n A 1 114 PHE 114 113 113 PHE PHE A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 PRO 116 115 115 PRO PRO A . n A 1 117 VAL 117 116 116 VAL VAL A . n A 1 118 GLY 118 117 117 GLY GLY A . n A 1 119 ASP 119 118 118 ASP ASP A . n A 1 120 VAL 120 119 119 VAL VAL A . n A 1 121 VAL 121 120 120 VAL VAL A . n A 1 122 GLN 122 121 121 GLN GLN A . n A 1 123 TYR 123 122 122 TYR TYR A . n A 1 124 GLY 124 123 123 GLY GLY A . n A 1 125 PHE 125 124 124 PHE PHE A . n A 1 126 LEU 126 125 125 LEU LEU A . n A 1 127 ASN 127 126 126 ASN ASN A . n A 1 128 LEU 128 127 127 LEU LEU A . n A 1 129 SER 129 128 128 SER SER A . n A 1 130 GLY 130 129 129 GLY GLY A . n A 1 131 LYS 131 130 130 LYS LYS A . n A 1 132 PRO 132 131 131 PRO PRO A . n A 1 133 THR 133 132 132 THR THR A . n A 1 134 HIS 134 133 133 HIS HIS A . n A 1 135 ARG 135 134 134 ARG ARG A . n A 1 136 THR 136 135 135 THR THR A . n A 1 137 MET 137 136 136 MET MET A . n A 1 138 MET 138 137 137 MET MET A . n A 1 139 TYR 139 138 138 TYR TYR A . n A 1 140 ASN 140 139 139 ASN ASN A . n A 1 141 PHE 141 140 140 PHE PHE A . n A 1 142 PRO 142 141 141 PRO PRO A . n A 1 143 THR 143 142 142 THR THR A . n A 1 144 LYS 144 143 143 LYS LYS A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 GLY 146 145 145 GLY GLY A . n A 1 147 GLN 147 146 146 GLN GLN A . n A 1 148 CYS 148 147 147 CYS CYS A . n A 1 149 GLY 149 148 148 GLY GLY A . n A 1 150 GLY 150 149 149 GLY GLY A . n A 1 151 VAL 151 150 150 VAL VAL A . n A 1 152 VAL 152 151 151 VAL VAL A . n A 1 153 THR 153 152 152 THR THR A . n A 1 154 SER 154 153 153 SER SER A . n A 1 155 VAL 155 154 154 VAL VAL A . n A 1 156 GLY 156 155 155 GLY GLY A . n A 1 157 LYS 157 156 156 LYS LYS A . n A 1 158 VAL 158 157 157 VAL VAL A . n A 1 159 ILE 159 158 158 ILE ILE A . n A 1 160 GLY 160 159 159 GLY GLY A . n A 1 161 ILE 161 160 160 ILE ILE A . n A 1 162 HIS 162 161 161 HIS HIS A . n A 1 163 ILE 163 162 162 ILE ILE A . n A 1 164 GLY 164 163 163 GLY GLY A . n A 1 165 GLY 165 164 164 GLY GLY A . n A 1 166 ASN 166 165 165 ASN ASN A . n A 1 167 GLY 167 166 166 GLY GLY A . n A 1 168 ARG 168 167 167 ARG ARG A . n A 1 169 GLN 169 168 168 GLN GLN A . n A 1 170 GLY 170 169 169 GLY GLY A . n A 1 171 PHE 171 170 170 PHE PHE A . n A 1 172 CYS 172 171 171 CYS CYS A . n A 1 173 ALA 173 172 172 ALA ALA A . n A 1 174 GLY 174 173 173 GLY GLY A . n A 1 175 LEU 175 174 174 LEU LEU A . n A 1 176 LYS 176 175 175 LYS LYS A . n A 1 177 ARG 177 176 176 ARG ARG A . n A 1 178 SER 178 177 177 SER SER A . n A 1 179 TYR 179 178 178 TYR TYR A . n A 1 180 PHE 180 179 179 PHE PHE A . n A 1 181 ALA 181 180 180 ALA ALA A . n A 1 182 SER 182 181 ? ? ? A . n A 1 183 GLU 183 182 ? ? ? A . n A 1 184 GLN 184 183 ? ? ? A . n A 1 185 LEU 185 184 ? ? ? A . n A 1 186 GLU 186 185 ? ? ? A . n A 1 187 HIS 187 186 ? ? ? A . n A 1 188 HIS 188 187 ? ? ? A . n A 1 189 HIS 189 188 ? ? ? A . n A 1 190 HIS 190 189 ? ? ? A . n A 1 191 HIS 191 190 ? ? ? A . n A 1 192 HIS 192 191 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GHZ 1 201 201 GHZ GHZ A . C 3 HOH 1 301 310 HOH HOH A . C 3 HOH 2 302 305 HOH HOH A . C 3 HOH 3 303 309 HOH HOH A . C 3 HOH 4 304 306 HOH HOH A . C 3 HOH 5 305 307 HOH HOH A . C 3 HOH 6 306 311 HOH HOH A . C 3 HOH 7 307 304 HOH HOH A . C 3 HOH 8 308 308 HOH HOH A . C 3 HOH 9 309 301 HOH HOH A . C 3 HOH 10 310 303 HOH HOH A . C 3 HOH 11 311 312 HOH HOH A . C 3 HOH 12 312 313 HOH HOH A . C 3 HOH 13 313 302 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? AUTOMAR ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? AUTOMAR ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0029 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5C20 _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.119 _cell.length_a_esd ? _cell.length_b 64.564 _cell.length_b_esd ? _cell.length_c 75.334 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5C20 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5C20 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.82 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100MM TRIS, 25% PEG4000, 0.8M LITHIUM CHLORIDE' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-11-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5C20 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.750 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3961 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 0.000 _reflns.percent_possible_obs 92.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.480 _reflns.pdbx_Rmerge_I_obs 0.13250 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.6000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.75 _reflns_shell.d_res_low 2.85 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.100 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 96.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.39770 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.45 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.33000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] -0.00000 _refine.aniso_B[2][2] -0.40000 _refine.aniso_B[2][3] -0.00000 _refine.aniso_B[3][3] 0.08000 _refine.B_iso_max ? _refine.B_iso_mean 35.16 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.926 _refine.correlation_coeff_Fo_to_Fc_free 0.852 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5C20 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.75 _refine.ls_d_res_low 20.29 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3934 _refine.ls_number_reflns_R_free 182 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.0 _refine.ls_percent_reflns_R_free 4.600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.215 _refine.ls_R_factor_R_free 0.282 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.211 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB ENTRY 4GHQ' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.503 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 19.541 _refine.overall_SU_ML 0.380 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1401 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1443 _refine_hist.d_res_high 2.75 _refine_hist.d_res_low 20.29 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.019 1459 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1425 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.487 1.979 1975 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.904 3.000 3269 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.066 5.000 180 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.274 23.710 62 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 22.881 15.000 247 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.937 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.085 0.200 228 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 1638 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 338 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.75 _refine_ls_shell.d_res_low 2.82 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 14 _refine_ls_shell.number_reflns_R_work 282 _refine_ls_shell.percent_reflns_obs 96.10 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3230 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3190 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _database_PDB_matrix.entry_id 5C20 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 5C20 _struct.title 'Crystal structure of EV71 3C Proteinase in complex with Compound 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5C20 _struct_keywords.text 'HYDROLASE, CYSTEINE PROTEINASE, INHIBITOR, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A9XG43_9ENTO _struct_ref.pdbx_db_accession A9XG43 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GPSLDFALSLLRRNVRQVQTDQGHFTMLGVRDRLAVLPRHSQPGKTIWIEHKLVNILDAVELVDEQGVNLELTLITLDTN EKFRDITKFIPENISTASDATLVINTEHMPSMFVPVGDVVQYGFLNLSGKPTHRTMMYNFPTKAGQCGGVVTSVGKVIGI HIGGNGRQGFCAGLKRSYFASEQ ; _struct_ref.pdbx_align_begin 1549 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5C20 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 184 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A9XG43 _struct_ref_seq.db_align_beg 1549 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1731 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5C20 MET A 1 ? UNP A9XG43 ? ? 'expression tag' 0 1 1 5C20 LEU A 185 ? UNP A9XG43 ? ? 'expression tag' 184 2 1 5C20 GLU A 186 ? UNP A9XG43 ? ? 'expression tag' 185 3 1 5C20 HIS A 187 ? UNP A9XG43 ? ? 'expression tag' 186 4 1 5C20 HIS A 188 ? UNP A9XG43 ? ? 'expression tag' 187 5 1 5C20 HIS A 189 ? UNP A9XG43 ? ? 'expression tag' 188 6 1 5C20 HIS A 190 ? UNP A9XG43 ? ? 'expression tag' 189 7 1 5C20 HIS A 191 ? UNP A9XG43 ? ? 'expression tag' 190 8 1 5C20 HIS A 192 ? UNP A9XG43 ? ? 'expression tag' 191 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8380 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 2 ? ASN A 15 ? GLY A 1 ASN A 14 1 ? 14 HELX_P HELX_P2 AA2 HIS A 41 ? GLN A 43 ? HIS A 40 GLN A 42 5 ? 3 HELX_P HELX_P3 AA3 ILE A 87 ? ILE A 91 ? ILE A 86 ILE A 90 5 ? 5 HELX_P HELX_P4 AA4 LYS A 176 ? ALA A 181 ? LYS A 175 ALA A 180 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 148 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id GHZ _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C27 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 147 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GHZ _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.761 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id GHZ _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 148 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id GHZ _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 147 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C27 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id GHZ _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 16 ? THR A 21 ? VAL A 15 THR A 20 AA1 2 GLY A 24 ? ARG A 32 ? GLY A 23 ARG A 31 AA1 3 LEU A 35 ? PRO A 39 ? LEU A 34 PRO A 38 AA1 4 ASN A 70 ? ASP A 79 ? ASN A 69 ASP A 78 AA1 5 LYS A 53 ? VAL A 64 ? LYS A 52 VAL A 63 AA1 6 THR A 47 ? ILE A 50 ? THR A 46 ILE A 49 AA1 7 VAL A 16 ? THR A 21 ? VAL A 15 THR A 20 AA2 1 ALA A 98 ? ILE A 105 ? ALA A 97 ILE A 104 AA2 2 MET A 113 ? LEU A 128 ? MET A 112 LEU A 127 AA2 3 LYS A 131 ? TYR A 139 ? LYS A 130 TYR A 138 AA2 4 GLY A 170 ? GLY A 174 ? GLY A 169 GLY A 173 AA2 5 LYS A 157 ? GLY A 165 ? LYS A 156 GLY A 164 AA2 6 VAL A 151 ? SER A 154 ? VAL A 150 SER A 153 AA2 7 ALA A 98 ? ILE A 105 ? ALA A 97 ILE A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 17 ? N ARG A 16 O MET A 28 ? O MET A 27 AA1 2 3 N VAL A 31 ? N VAL A 30 O LEU A 35 ? O LEU A 34 AA1 3 4 N LEU A 38 ? N LEU A 37 O THR A 74 ? O THR A 73 AA1 4 5 O THR A 77 ? O THR A 76 N LEU A 58 ? N LEU A 57 AA1 5 6 O VAL A 55 ? O VAL A 54 N ILE A 48 ? N ILE A 47 AA1 6 7 O TRP A 49 ? O TRP A 48 N GLN A 20 ? N GLN A 19 AA2 1 2 N LEU A 103 ? N LEU A 102 O VAL A 115 ? O VAL A 114 AA2 2 3 N VAL A 121 ? N VAL A 120 O MET A 138 ? O MET A 137 AA2 3 4 N TYR A 139 ? N TYR A 138 O GLY A 170 ? O GLY A 169 AA2 4 5 O ALA A 173 ? O ALA A 172 N ILE A 161 ? N ILE A 160 AA2 5 6 O ILE A 159 ? O ILE A 158 N VAL A 152 ? N VAL A 151 AA2 6 7 O VAL A 151 ? O VAL A 150 N VAL A 104 ? N VAL A 103 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GHZ _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'binding site for residue GHZ A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 ARG A 40 ? ARG A 39 . ? 1_555 ? 2 AC1 14 HIS A 41 ? HIS A 40 . ? 1_555 ? 3 AC1 14 GLU A 72 ? GLU A 71 . ? 1_555 ? 4 AC1 14 LEU A 128 ? LEU A 127 . ? 1_555 ? 5 AC1 14 SER A 129 ? SER A 128 . ? 1_555 ? 6 AC1 14 THR A 143 ? THR A 142 . ? 1_555 ? 7 AC1 14 LYS A 144 ? LYS A 143 . ? 1_555 ? 8 AC1 14 ALA A 145 ? ALA A 144 . ? 1_555 ? 9 AC1 14 GLY A 146 ? GLY A 145 . ? 1_555 ? 10 AC1 14 CYS A 148 ? CYS A 147 . ? 1_555 ? 11 AC1 14 HIS A 162 ? HIS A 161 . ? 1_555 ? 12 AC1 14 ILE A 163 ? ILE A 162 . ? 1_555 ? 13 AC1 14 GLY A 164 ? GLY A 163 . ? 1_555 ? 14 AC1 14 GLY A 165 ? GLY A 164 . ? 1_555 ? # _pdbx_entry_details.entry_id 5C20 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 32 ? ? NZ A LYS 82 ? ? 1.53 2 1 OD1 A ASP 85 ? ? OG1 A THR 87 ? ? 2.03 3 1 O A THR 142 ? ? N33 A GHZ 201 ? ? 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 32 ? ? 56.53 -125.85 2 1 GLU A 50 ? ? 71.56 -66.94 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 313 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 181 ? A SER 182 2 1 Y 1 A GLU 182 ? A GLU 183 3 1 Y 1 A GLN 183 ? A GLN 184 4 1 Y 1 A LEU 184 ? A LEU 185 5 1 Y 1 A GLU 185 ? A GLU 186 6 1 Y 1 A HIS 186 ? A HIS 187 7 1 Y 1 A HIS 187 ? A HIS 188 8 1 Y 1 A HIS 188 ? A HIS 189 9 1 Y 1 A HIS 189 ? A HIS 190 10 1 Y 1 A HIS 190 ? A HIS 191 11 1 Y 1 A HIS 191 ? A HIS 192 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GHZ O25 O N N 88 GHZ C23 C N N 89 GHZ C15 C N S 90 GHZ C16 C N N 91 GHZ C17 C Y N 92 GHZ C22 C Y N 93 GHZ C21 C Y N 94 GHZ C20 C Y N 95 GHZ C19 C Y N 96 GHZ C18 C Y N 97 GHZ N13 N N N 98 GHZ C12 C N N 99 GHZ O11 O N N 100 GHZ C10 C N N 101 GHZ C1 C N N 102 GHZ O14 O N N 103 GHZ N24 N N N 104 GHZ C26 C N S 105 GHZ C27 C N N 106 GHZ O28 O N N 107 GHZ C29 C N N 108 GHZ C30 C N S 109 GHZ C31 C N N 110 GHZ C32 C N N 111 GHZ N33 N N N 112 GHZ C34 C N N 113 GHZ O1 O N N 114 GHZ C2 C N N 115 GHZ C3 C N N 116 GHZ H1 H N N 117 GHZ H2 H N N 118 GHZ H3 H N N 119 GHZ H4 H N N 120 GHZ H5 H N N 121 GHZ H6 H N N 122 GHZ H7 H N N 123 GHZ H8 H N N 124 GHZ H9 H N N 125 GHZ H10 H N N 126 GHZ H11 H N N 127 GHZ H12 H N N 128 GHZ H13 H N N 129 GHZ H14 H N N 130 GHZ H15 H N N 131 GHZ H16 H N N 132 GHZ H17 H N N 133 GHZ H18 H N N 134 GHZ H19 H N N 135 GHZ H20 H N N 136 GHZ H21 H N N 137 GHZ H22 H N N 138 GHZ H23 H N N 139 GHZ H24 H N N 140 GHZ H25 H N N 141 GHZ H26 H N N 142 GHZ H27 H N N 143 GHZ H28 H N N 144 GHZ H29 H N N 145 GHZ H30 H N N 146 GHZ H31 H N N 147 GLN N N N N 148 GLN CA C N S 149 GLN C C N N 150 GLN O O N N 151 GLN CB C N N 152 GLN CG C N N 153 GLN CD C N N 154 GLN OE1 O N N 155 GLN NE2 N N N 156 GLN OXT O N N 157 GLN H H N N 158 GLN H2 H N N 159 GLN HA H N N 160 GLN HB2 H N N 161 GLN HB3 H N N 162 GLN HG2 H N N 163 GLN HG3 H N N 164 GLN HE21 H N N 165 GLN HE22 H N N 166 GLN HXT H N N 167 GLU N N N N 168 GLU CA C N S 169 GLU C C N N 170 GLU O O N N 171 GLU CB C N N 172 GLU CG C N N 173 GLU CD C N N 174 GLU OE1 O N N 175 GLU OE2 O N N 176 GLU OXT O N N 177 GLU H H N N 178 GLU H2 H N N 179 GLU HA H N N 180 GLU HB2 H N N 181 GLU HB3 H N N 182 GLU HG2 H N N 183 GLU HG3 H N N 184 GLU HE2 H N N 185 GLU HXT H N N 186 GLY N N N N 187 GLY CA C N N 188 GLY C C N N 189 GLY O O N N 190 GLY OXT O N N 191 GLY H H N N 192 GLY H2 H N N 193 GLY HA2 H N N 194 GLY HA3 H N N 195 GLY HXT H N N 196 HIS N N N N 197 HIS CA C N S 198 HIS C C N N 199 HIS O O N N 200 HIS CB C N N 201 HIS CG C Y N 202 HIS ND1 N Y N 203 HIS CD2 C Y N 204 HIS CE1 C Y N 205 HIS NE2 N Y N 206 HIS OXT O N N 207 HIS H H N N 208 HIS H2 H N N 209 HIS HA H N N 210 HIS HB2 H N N 211 HIS HB3 H N N 212 HIS HD1 H N N 213 HIS HD2 H N N 214 HIS HE1 H N N 215 HIS HE2 H N N 216 HIS HXT H N N 217 HOH O O N N 218 HOH H1 H N N 219 HOH H2 H N N 220 ILE N N N N 221 ILE CA C N S 222 ILE C C N N 223 ILE O O N N 224 ILE CB C N S 225 ILE CG1 C N N 226 ILE CG2 C N N 227 ILE CD1 C N N 228 ILE OXT O N N 229 ILE H H N N 230 ILE H2 H N N 231 ILE HA H N N 232 ILE HB H N N 233 ILE HG12 H N N 234 ILE HG13 H N N 235 ILE HG21 H N N 236 ILE HG22 H N N 237 ILE HG23 H N N 238 ILE HD11 H N N 239 ILE HD12 H N N 240 ILE HD13 H N N 241 ILE HXT H N N 242 LEU N N N N 243 LEU CA C N S 244 LEU C C N N 245 LEU O O N N 246 LEU CB C N N 247 LEU CG C N N 248 LEU CD1 C N N 249 LEU CD2 C N N 250 LEU OXT O N N 251 LEU H H N N 252 LEU H2 H N N 253 LEU HA H N N 254 LEU HB2 H N N 255 LEU HB3 H N N 256 LEU HG H N N 257 LEU HD11 H N N 258 LEU HD12 H N N 259 LEU HD13 H N N 260 LEU HD21 H N N 261 LEU HD22 H N N 262 LEU HD23 H N N 263 LEU HXT H N N 264 LYS N N N N 265 LYS CA C N S 266 LYS C C N N 267 LYS O O N N 268 LYS CB C N N 269 LYS CG C N N 270 LYS CD C N N 271 LYS CE C N N 272 LYS NZ N N N 273 LYS OXT O N N 274 LYS H H N N 275 LYS H2 H N N 276 LYS HA H N N 277 LYS HB2 H N N 278 LYS HB3 H N N 279 LYS HG2 H N N 280 LYS HG3 H N N 281 LYS HD2 H N N 282 LYS HD3 H N N 283 LYS HE2 H N N 284 LYS HE3 H N N 285 LYS HZ1 H N N 286 LYS HZ2 H N N 287 LYS HZ3 H N N 288 LYS HXT H N N 289 MET N N N N 290 MET CA C N S 291 MET C C N N 292 MET O O N N 293 MET CB C N N 294 MET CG C N N 295 MET SD S N N 296 MET CE C N N 297 MET OXT O N N 298 MET H H N N 299 MET H2 H N N 300 MET HA H N N 301 MET HB2 H N N 302 MET HB3 H N N 303 MET HG2 H N N 304 MET HG3 H N N 305 MET HE1 H N N 306 MET HE2 H N N 307 MET HE3 H N N 308 MET HXT H N N 309 PHE N N N N 310 PHE CA C N S 311 PHE C C N N 312 PHE O O N N 313 PHE CB C N N 314 PHE CG C Y N 315 PHE CD1 C Y N 316 PHE CD2 C Y N 317 PHE CE1 C Y N 318 PHE CE2 C Y N 319 PHE CZ C Y N 320 PHE OXT O N N 321 PHE H H N N 322 PHE H2 H N N 323 PHE HA H N N 324 PHE HB2 H N N 325 PHE HB3 H N N 326 PHE HD1 H N N 327 PHE HD2 H N N 328 PHE HE1 H N N 329 PHE HE2 H N N 330 PHE HZ H N N 331 PHE HXT H N N 332 PRO N N N N 333 PRO CA C N S 334 PRO C C N N 335 PRO O O N N 336 PRO CB C N N 337 PRO CG C N N 338 PRO CD C N N 339 PRO OXT O N N 340 PRO H H N N 341 PRO HA H N N 342 PRO HB2 H N N 343 PRO HB3 H N N 344 PRO HG2 H N N 345 PRO HG3 H N N 346 PRO HD2 H N N 347 PRO HD3 H N N 348 PRO HXT H N N 349 SER N N N N 350 SER CA C N S 351 SER C C N N 352 SER O O N N 353 SER CB C N N 354 SER OG O N N 355 SER OXT O N N 356 SER H H N N 357 SER H2 H N N 358 SER HA H N N 359 SER HB2 H N N 360 SER HB3 H N N 361 SER HG H N N 362 SER HXT H N N 363 THR N N N N 364 THR CA C N S 365 THR C C N N 366 THR O O N N 367 THR CB C N R 368 THR OG1 O N N 369 THR CG2 C N N 370 THR OXT O N N 371 THR H H N N 372 THR H2 H N N 373 THR HA H N N 374 THR HB H N N 375 THR HG1 H N N 376 THR HG21 H N N 377 THR HG22 H N N 378 THR HG23 H N N 379 THR HXT H N N 380 TRP N N N N 381 TRP CA C N S 382 TRP C C N N 383 TRP O O N N 384 TRP CB C N N 385 TRP CG C Y N 386 TRP CD1 C Y N 387 TRP CD2 C Y N 388 TRP NE1 N Y N 389 TRP CE2 C Y N 390 TRP CE3 C Y N 391 TRP CZ2 C Y N 392 TRP CZ3 C Y N 393 TRP CH2 C Y N 394 TRP OXT O N N 395 TRP H H N N 396 TRP H2 H N N 397 TRP HA H N N 398 TRP HB2 H N N 399 TRP HB3 H N N 400 TRP HD1 H N N 401 TRP HE1 H N N 402 TRP HE3 H N N 403 TRP HZ2 H N N 404 TRP HZ3 H N N 405 TRP HH2 H N N 406 TRP HXT H N N 407 TYR N N N N 408 TYR CA C N S 409 TYR C C N N 410 TYR O O N N 411 TYR CB C N N 412 TYR CG C Y N 413 TYR CD1 C Y N 414 TYR CD2 C Y N 415 TYR CE1 C Y N 416 TYR CE2 C Y N 417 TYR CZ C Y N 418 TYR OH O N N 419 TYR OXT O N N 420 TYR H H N N 421 TYR H2 H N N 422 TYR HA H N N 423 TYR HB2 H N N 424 TYR HB3 H N N 425 TYR HD1 H N N 426 TYR HD2 H N N 427 TYR HE1 H N N 428 TYR HE2 H N N 429 TYR HH H N N 430 TYR HXT H N N 431 VAL N N N N 432 VAL CA C N S 433 VAL C C N N 434 VAL O O N N 435 VAL CB C N N 436 VAL CG1 C N N 437 VAL CG2 C N N 438 VAL OXT O N N 439 VAL H H N N 440 VAL H2 H N N 441 VAL HA H N N 442 VAL HB H N N 443 VAL HG11 H N N 444 VAL HG12 H N N 445 VAL HG13 H N N 446 VAL HG21 H N N 447 VAL HG22 H N N 448 VAL HG23 H N N 449 VAL HXT H N N 450 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GHZ C3 C1 sing N N 83 GHZ C1 C2 sing N N 84 GHZ C1 C10 sing N N 85 GHZ C10 O11 sing N N 86 GHZ O11 C12 sing N N 87 GHZ C20 C19 doub Y N 88 GHZ C20 C21 sing Y N 89 GHZ C19 C18 sing Y N 90 GHZ C12 N13 sing N N 91 GHZ C12 O14 doub N N 92 GHZ C21 C22 doub Y N 93 GHZ N13 C15 sing N N 94 GHZ C18 C17 doub Y N 95 GHZ C22 C17 sing Y N 96 GHZ C17 C16 sing N N 97 GHZ C16 C15 sing N N 98 GHZ C15 C23 sing N N 99 GHZ C23 O25 doub N N 100 GHZ C23 N24 sing N N 101 GHZ N24 C26 sing N N 102 GHZ C31 C30 sing N N 103 GHZ C31 C32 sing N N 104 GHZ C30 C34 sing N N 105 GHZ C30 C29 sing N N 106 GHZ C32 N33 sing N N 107 GHZ C34 N33 sing N N 108 GHZ C34 O1 doub N N 109 GHZ C26 C29 sing N N 110 GHZ C26 C27 sing N N 111 GHZ C27 O28 sing N N 112 GHZ C15 H1 sing N N 113 GHZ C16 H2 sing N N 114 GHZ C16 H3 sing N N 115 GHZ C22 H4 sing N N 116 GHZ C21 H5 sing N N 117 GHZ C20 H6 sing N N 118 GHZ C19 H7 sing N N 119 GHZ C18 H8 sing N N 120 GHZ N13 H9 sing N N 121 GHZ C10 H10 sing N N 122 GHZ C10 H11 sing N N 123 GHZ C1 H12 sing N N 124 GHZ N24 H13 sing N N 125 GHZ C26 H14 sing N N 126 GHZ C27 H15 sing N N 127 GHZ C27 H16 sing N N 128 GHZ O28 H17 sing N N 129 GHZ C29 H18 sing N N 130 GHZ C29 H19 sing N N 131 GHZ C30 H20 sing N N 132 GHZ C31 H21 sing N N 133 GHZ C31 H22 sing N N 134 GHZ C32 H23 sing N N 135 GHZ C2 H24 sing N N 136 GHZ C2 H25 sing N N 137 GHZ C2 H26 sing N N 138 GHZ C3 H27 sing N N 139 GHZ C3 H28 sing N N 140 GHZ C3 H29 sing N N 141 GHZ C32 H30 sing N N 142 GHZ N33 H31 sing N N 143 GLN N CA sing N N 144 GLN N H sing N N 145 GLN N H2 sing N N 146 GLN CA C sing N N 147 GLN CA CB sing N N 148 GLN CA HA sing N N 149 GLN C O doub N N 150 GLN C OXT sing N N 151 GLN CB CG sing N N 152 GLN CB HB2 sing N N 153 GLN CB HB3 sing N N 154 GLN CG CD sing N N 155 GLN CG HG2 sing N N 156 GLN CG HG3 sing N N 157 GLN CD OE1 doub N N 158 GLN CD NE2 sing N N 159 GLN NE2 HE21 sing N N 160 GLN NE2 HE22 sing N N 161 GLN OXT HXT sing N N 162 GLU N CA sing N N 163 GLU N H sing N N 164 GLU N H2 sing N N 165 GLU CA C sing N N 166 GLU CA CB sing N N 167 GLU CA HA sing N N 168 GLU C O doub N N 169 GLU C OXT sing N N 170 GLU CB CG sing N N 171 GLU CB HB2 sing N N 172 GLU CB HB3 sing N N 173 GLU CG CD sing N N 174 GLU CG HG2 sing N N 175 GLU CG HG3 sing N N 176 GLU CD OE1 doub N N 177 GLU CD OE2 sing N N 178 GLU OE2 HE2 sing N N 179 GLU OXT HXT sing N N 180 GLY N CA sing N N 181 GLY N H sing N N 182 GLY N H2 sing N N 183 GLY CA C sing N N 184 GLY CA HA2 sing N N 185 GLY CA HA3 sing N N 186 GLY C O doub N N 187 GLY C OXT sing N N 188 GLY OXT HXT sing N N 189 HIS N CA sing N N 190 HIS N H sing N N 191 HIS N H2 sing N N 192 HIS CA C sing N N 193 HIS CA CB sing N N 194 HIS CA HA sing N N 195 HIS C O doub N N 196 HIS C OXT sing N N 197 HIS CB CG sing N N 198 HIS CB HB2 sing N N 199 HIS CB HB3 sing N N 200 HIS CG ND1 sing Y N 201 HIS CG CD2 doub Y N 202 HIS ND1 CE1 doub Y N 203 HIS ND1 HD1 sing N N 204 HIS CD2 NE2 sing Y N 205 HIS CD2 HD2 sing N N 206 HIS CE1 NE2 sing Y N 207 HIS CE1 HE1 sing N N 208 HIS NE2 HE2 sing N N 209 HIS OXT HXT sing N N 210 HOH O H1 sing N N 211 HOH O H2 sing N N 212 ILE N CA sing N N 213 ILE N H sing N N 214 ILE N H2 sing N N 215 ILE CA C sing N N 216 ILE CA CB sing N N 217 ILE CA HA sing N N 218 ILE C O doub N N 219 ILE C OXT sing N N 220 ILE CB CG1 sing N N 221 ILE CB CG2 sing N N 222 ILE CB HB sing N N 223 ILE CG1 CD1 sing N N 224 ILE CG1 HG12 sing N N 225 ILE CG1 HG13 sing N N 226 ILE CG2 HG21 sing N N 227 ILE CG2 HG22 sing N N 228 ILE CG2 HG23 sing N N 229 ILE CD1 HD11 sing N N 230 ILE CD1 HD12 sing N N 231 ILE CD1 HD13 sing N N 232 ILE OXT HXT sing N N 233 LEU N CA sing N N 234 LEU N H sing N N 235 LEU N H2 sing N N 236 LEU CA C sing N N 237 LEU CA CB sing N N 238 LEU CA HA sing N N 239 LEU C O doub N N 240 LEU C OXT sing N N 241 LEU CB CG sing N N 242 LEU CB HB2 sing N N 243 LEU CB HB3 sing N N 244 LEU CG CD1 sing N N 245 LEU CG CD2 sing N N 246 LEU CG HG sing N N 247 LEU CD1 HD11 sing N N 248 LEU CD1 HD12 sing N N 249 LEU CD1 HD13 sing N N 250 LEU CD2 HD21 sing N N 251 LEU CD2 HD22 sing N N 252 LEU CD2 HD23 sing N N 253 LEU OXT HXT sing N N 254 LYS N CA sing N N 255 LYS N H sing N N 256 LYS N H2 sing N N 257 LYS CA C sing N N 258 LYS CA CB sing N N 259 LYS CA HA sing N N 260 LYS C O doub N N 261 LYS C OXT sing N N 262 LYS CB CG sing N N 263 LYS CB HB2 sing N N 264 LYS CB HB3 sing N N 265 LYS CG CD sing N N 266 LYS CG HG2 sing N N 267 LYS CG HG3 sing N N 268 LYS CD CE sing N N 269 LYS CD HD2 sing N N 270 LYS CD HD3 sing N N 271 LYS CE NZ sing N N 272 LYS CE HE2 sing N N 273 LYS CE HE3 sing N N 274 LYS NZ HZ1 sing N N 275 LYS NZ HZ2 sing N N 276 LYS NZ HZ3 sing N N 277 LYS OXT HXT sing N N 278 MET N CA sing N N 279 MET N H sing N N 280 MET N H2 sing N N 281 MET CA C sing N N 282 MET CA CB sing N N 283 MET CA HA sing N N 284 MET C O doub N N 285 MET C OXT sing N N 286 MET CB CG sing N N 287 MET CB HB2 sing N N 288 MET CB HB3 sing N N 289 MET CG SD sing N N 290 MET CG HG2 sing N N 291 MET CG HG3 sing N N 292 MET SD CE sing N N 293 MET CE HE1 sing N N 294 MET CE HE2 sing N N 295 MET CE HE3 sing N N 296 MET OXT HXT sing N N 297 PHE N CA sing N N 298 PHE N H sing N N 299 PHE N H2 sing N N 300 PHE CA C sing N N 301 PHE CA CB sing N N 302 PHE CA HA sing N N 303 PHE C O doub N N 304 PHE C OXT sing N N 305 PHE CB CG sing N N 306 PHE CB HB2 sing N N 307 PHE CB HB3 sing N N 308 PHE CG CD1 doub Y N 309 PHE CG CD2 sing Y N 310 PHE CD1 CE1 sing Y N 311 PHE CD1 HD1 sing N N 312 PHE CD2 CE2 doub Y N 313 PHE CD2 HD2 sing N N 314 PHE CE1 CZ doub Y N 315 PHE CE1 HE1 sing N N 316 PHE CE2 CZ sing Y N 317 PHE CE2 HE2 sing N N 318 PHE CZ HZ sing N N 319 PHE OXT HXT sing N N 320 PRO N CA sing N N 321 PRO N CD sing N N 322 PRO N H sing N N 323 PRO CA C sing N N 324 PRO CA CB sing N N 325 PRO CA HA sing N N 326 PRO C O doub N N 327 PRO C OXT sing N N 328 PRO CB CG sing N N 329 PRO CB HB2 sing N N 330 PRO CB HB3 sing N N 331 PRO CG CD sing N N 332 PRO CG HG2 sing N N 333 PRO CG HG3 sing N N 334 PRO CD HD2 sing N N 335 PRO CD HD3 sing N N 336 PRO OXT HXT sing N N 337 SER N CA sing N N 338 SER N H sing N N 339 SER N H2 sing N N 340 SER CA C sing N N 341 SER CA CB sing N N 342 SER CA HA sing N N 343 SER C O doub N N 344 SER C OXT sing N N 345 SER CB OG sing N N 346 SER CB HB2 sing N N 347 SER CB HB3 sing N N 348 SER OG HG sing N N 349 SER OXT HXT sing N N 350 THR N CA sing N N 351 THR N H sing N N 352 THR N H2 sing N N 353 THR CA C sing N N 354 THR CA CB sing N N 355 THR CA HA sing N N 356 THR C O doub N N 357 THR C OXT sing N N 358 THR CB OG1 sing N N 359 THR CB CG2 sing N N 360 THR CB HB sing N N 361 THR OG1 HG1 sing N N 362 THR CG2 HG21 sing N N 363 THR CG2 HG22 sing N N 364 THR CG2 HG23 sing N N 365 THR OXT HXT sing N N 366 TRP N CA sing N N 367 TRP N H sing N N 368 TRP N H2 sing N N 369 TRP CA C sing N N 370 TRP CA CB sing N N 371 TRP CA HA sing N N 372 TRP C O doub N N 373 TRP C OXT sing N N 374 TRP CB CG sing N N 375 TRP CB HB2 sing N N 376 TRP CB HB3 sing N N 377 TRP CG CD1 doub Y N 378 TRP CG CD2 sing Y N 379 TRP CD1 NE1 sing Y N 380 TRP CD1 HD1 sing N N 381 TRP CD2 CE2 doub Y N 382 TRP CD2 CE3 sing Y N 383 TRP NE1 CE2 sing Y N 384 TRP NE1 HE1 sing N N 385 TRP CE2 CZ2 sing Y N 386 TRP CE3 CZ3 doub Y N 387 TRP CE3 HE3 sing N N 388 TRP CZ2 CH2 doub Y N 389 TRP CZ2 HZ2 sing N N 390 TRP CZ3 CH2 sing Y N 391 TRP CZ3 HZ3 sing N N 392 TRP CH2 HH2 sing N N 393 TRP OXT HXT sing N N 394 TYR N CA sing N N 395 TYR N H sing N N 396 TYR N H2 sing N N 397 TYR CA C sing N N 398 TYR CA CB sing N N 399 TYR CA HA sing N N 400 TYR C O doub N N 401 TYR C OXT sing N N 402 TYR CB CG sing N N 403 TYR CB HB2 sing N N 404 TYR CB HB3 sing N N 405 TYR CG CD1 doub Y N 406 TYR CG CD2 sing Y N 407 TYR CD1 CE1 sing Y N 408 TYR CD1 HD1 sing N N 409 TYR CD2 CE2 doub Y N 410 TYR CD2 HD2 sing N N 411 TYR CE1 CZ doub Y N 412 TYR CE1 HE1 sing N N 413 TYR CE2 CZ sing Y N 414 TYR CE2 HE2 sing N N 415 TYR CZ OH sing N N 416 TYR OH HH sing N N 417 TYR OXT HXT sing N N 418 VAL N CA sing N N 419 VAL N H sing N N 420 VAL N H2 sing N N 421 VAL CA C sing N N 422 VAL CA CB sing N N 423 VAL CA HA sing N N 424 VAL C O doub N N 425 VAL C OXT sing N N 426 VAL CB CG1 sing N N 427 VAL CB CG2 sing N N 428 VAL CB HB sing N N 429 VAL CG1 HG11 sing N N 430 VAL CG1 HG12 sing N N 431 VAL CG1 HG13 sing N N 432 VAL CG2 HG21 sing N N 433 VAL CG2 HG22 sing N N 434 VAL CG2 HG23 sing N N 435 VAL OXT HXT sing N N 436 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4GHQ _pdbx_initial_refinement_model.details 'PDB ENTRY 4GHQ' # _atom_sites.entry_id 5C20 _atom_sites.fract_transf_matrix[1][1] 0.015596 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015489 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013274 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_