data_5CCE # _entry.id 5CCE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5CCE pdb_00005cce 10.2210/pdb5cce/pdb WWPDB D_1000211302 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5CCE _pdbx_database_status.recvd_initial_deposition_date 2015-07-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Banco, M.T.' 1 ? 'Kovalevsky, A.Y.' 2 ? 'Ronning, D.R.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 113 _citation.language ? _citation.page_first 13756 _citation.page_last 13761 _citation.title ;Neutron structures of the Helicobacter pylori 5'-methylthioadenosine nucleosidase highlight proton sharing and protonation states. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1609718113 _citation.pdbx_database_id_PubMed 27856757 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Banco, M.T.' 1 ? primary 'Mishra, V.' 2 ? primary 'Ostermann, A.' 3 ? primary 'Schrader, T.E.' 4 ? primary 'Evans, G.B.' 5 ? primary 'Kovalevsky, A.' 6 ? primary 'Ronning, D.R.' 7 ? # _cell.entry_id 5CCE _cell.length_a 83.189 _cell.length_b 83.189 _cell.length_c 67.633 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5CCE _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;5'-Methylthioadenosine Nucleosidase ; 24975.754 1 '3.2.2.30, 3.2.2.9' ? ? ? 2 non-polymer syn S-ribosylhomocysteine 267.299 1 ? ? ? ? 3 non-polymer syn ADENINE 135.127 1 ? ? ? ? 4 non-polymer syn 'deuterium(1+)' 2.014 1 ? ? ? ? 5 water nat water 18.015 70 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aminofutalosine nucleosidase, Aminodeoxyfutalosine nucleosidase, 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase, MTAN, 6-amino-6-deoxyfutalosine N-ribosylhydrolase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAG SLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERK EFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL ; _entity_poly.pdbx_seq_one_letter_code_can ;GQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAG SLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERK EFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLN n 1 3 LYS n 1 4 ILE n 1 5 GLY n 1 6 ILE n 1 7 LEU n 1 8 GLY n 1 9 ALA n 1 10 MET n 1 11 ARG n 1 12 GLU n 1 13 GLU n 1 14 ILE n 1 15 THR n 1 16 PRO n 1 17 ILE n 1 18 LEU n 1 19 GLU n 1 20 LEU n 1 21 PHE n 1 22 GLY n 1 23 VAL n 1 24 ASP n 1 25 PHE n 1 26 GLU n 1 27 GLU n 1 28 ILE n 1 29 PRO n 1 30 LEU n 1 31 GLY n 1 32 GLY n 1 33 ASN n 1 34 VAL n 1 35 PHE n 1 36 HIS n 1 37 LYS n 1 38 GLY n 1 39 VAL n 1 40 TYR n 1 41 HIS n 1 42 ASN n 1 43 LYS n 1 44 GLU n 1 45 ILE n 1 46 ILE n 1 47 VAL n 1 48 ALA n 1 49 TYR n 1 50 SER n 1 51 LYS n 1 52 ILE n 1 53 GLY n 1 54 LYS n 1 55 VAL n 1 56 HIS n 1 57 SER n 1 58 THR n 1 59 LEU n 1 60 THR n 1 61 THR n 1 62 THR n 1 63 SER n 1 64 MET n 1 65 ILE n 1 66 LEU n 1 67 ALA n 1 68 PHE n 1 69 GLY n 1 70 VAL n 1 71 GLN n 1 72 LYS n 1 73 VAL n 1 74 LEU n 1 75 PHE n 1 76 SER n 1 77 GLY n 1 78 VAL n 1 79 ALA n 1 80 GLY n 1 81 SER n 1 82 LEU n 1 83 VAL n 1 84 LYS n 1 85 ASP n 1 86 LEU n 1 87 LYS n 1 88 ILE n 1 89 ASN n 1 90 ASP n 1 91 LEU n 1 92 LEU n 1 93 VAL n 1 94 ALA n 1 95 THR n 1 96 GLN n 1 97 LEU n 1 98 VAL n 1 99 GLN n 1 100 HIS n 1 101 ASP n 1 102 VAL n 1 103 ASP n 1 104 LEU n 1 105 SER n 1 106 ALA n 1 107 PHE n 1 108 ASP n 1 109 HIS n 1 110 PRO n 1 111 LEU n 1 112 GLY n 1 113 PHE n 1 114 ILE n 1 115 PRO n 1 116 GLU n 1 117 SER n 1 118 ALA n 1 119 ILE n 1 120 PHE n 1 121 ILE n 1 122 GLU n 1 123 THR n 1 124 SER n 1 125 GLY n 1 126 SER n 1 127 LEU n 1 128 ASN n 1 129 ALA n 1 130 LEU n 1 131 ALA n 1 132 LYS n 1 133 LYS n 1 134 ILE n 1 135 ALA n 1 136 ASN n 1 137 GLU n 1 138 GLN n 1 139 HIS n 1 140 ILE n 1 141 ALA n 1 142 LEU n 1 143 LYS n 1 144 GLU n 1 145 GLY n 1 146 VAL n 1 147 ILE n 1 148 ALA n 1 149 SER n 1 150 GLY n 1 151 ASP n 1 152 GLN n 1 153 PHE n 1 154 VAL n 1 155 HIS n 1 156 SER n 1 157 LYS n 1 158 GLU n 1 159 ARG n 1 160 LYS n 1 161 GLU n 1 162 PHE n 1 163 LEU n 1 164 VAL n 1 165 SER n 1 166 GLU n 1 167 PHE n 1 168 LYS n 1 169 ALA n 1 170 SER n 1 171 ALA n 1 172 VAL n 1 173 GLU n 1 174 MET n 1 175 GLU n 1 176 GLY n 1 177 ALA n 1 178 SER n 1 179 VAL n 1 180 ALA n 1 181 PHE n 1 182 VAL n 1 183 CYS n 1 184 GLN n 1 185 LYS n 1 186 PHE n 1 187 GLY n 1 188 VAL n 1 189 PRO n 1 190 CYS n 1 191 CYS n 1 192 VAL n 1 193 LEU n 1 194 ARG n 1 195 SER n 1 196 ILE n 1 197 SER n 1 198 ASP n 1 199 ASN n 1 200 ALA n 1 201 ASP n 1 202 GLU n 1 203 LYS n 1 204 ALA n 1 205 GLY n 1 206 MET n 1 207 SER n 1 208 PHE n 1 209 ASP n 1 210 GLU n 1 211 PHE n 1 212 LEU n 1 213 GLU n 1 214 LYS n 1 215 SER n 1 216 ALA n 1 217 HIS n 1 218 THR n 1 219 SER n 1 220 ALA n 1 221 LYS n 1 222 PHE n 1 223 LEU n 1 224 LYS n 1 225 SER n 1 226 MET n 1 227 VAL n 1 228 ASP n 1 229 GLU n 1 230 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 230 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mtnN, mtn, jhp_0082' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Helicobacter pylori' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 210 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.db_code MQMTN_HELPJ _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession Q9ZMY2 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ;QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGS LVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKE FLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_align_end ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5CCE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 230 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ZMY2 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 230 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 230 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5CCE _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9ZMY2 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2WP 'D-saccharide, alpha linking' . S-ribosylhomocysteine '(2S)-2-amino-4-({[(2S,3S,4R,5S)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl}sulfanyl)butanoic acid' 'C9 H17 N O6 S' 267.299 ADE non-polymer . ADENINE ? 'C5 H5 N5' 135.127 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 D8U non-polymer . 'deuterium(1+)' ? 'D 1' 2.014 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 5CCE ? ? 'NEUTRON DIFFRACTION' ? ? ? ? ? ? 5CCE ? ? 'X-RAY DIFFRACTION' ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG550 MME, 50 mM magnesium chloride hexahydrate, 100 mM HEPES, pH 7' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt ? 296 ? ? 1 ? ? ? 1 ? ? ? ? ? ? ? 296 ? ? 1 ? ? ? 2 ? ? ? ? ? ? # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date ? 'IMAGE PLATE' 1 CUSTOM-MADE ? ? ? ? 2013-01-15 ? 'IMAGE PLATE' 2 'RIGAKU RAXIS IV++' ? ? ? ? 2013-01-15 # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? neutron ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 2.66 1.0 2 1.54 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? 'NUCLEAR REACTOR' ? OTHER ? ? 2.66 ? ? ? ? ? 2 ? ? 'ROTATING ANODE' ? RIGAKU ? ? 1.54 ? ? ? # loop_ _reflns.entry_id _reflns.d_resolution_high _reflns.d_resolution_low _reflns.number_obs _reflns.percent_possible_obs _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.observed_criterion_sigma_I _reflns.observed_criterion_sigma_F _reflns.number_all _reflns.pdbx_Rsym_value _reflns.B_iso_Wilson_estimate 5CCE 2.50 50.0 9393 97.1 3.9 0.100 11.5 1 1 ? ? ? ? ? 5CCE 1.82 40.0 23011 94.0 4.4 0.026 43.1 2 2 ? ? ? ? ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_obs _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_Rsym_value _reflns_shell.number_measured_obs _reflns_shell.number_unique_all 2.50 2.59 1.7 94.9 0.681 3.2 1 1 ? ? ? 1.82 1.89 2.9 90.8 0.496 4.5 2 2 ? ? ? # loop_ _refine.pdbx_refine_id _refine.entry_id _refine.ls_number_reflns_all _refine.ls_number_reflns_obs _refine.ls_number_reflns_R_work _refine.ls_percent_reflns_obs _refine.ls_d_res_high _refine.ls_d_res_low _refine.B_iso_min _refine.B_iso_max _refine.B_iso_mean _refine.solvent_model_param_bsol _refine.solvent_model_param_ksol _refine.solvent_model_details _refine.ls_R_factor_R_work _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_number_reflns_R_free _refine.ls_percent_reflns_R_free _refine.pdbx_ls_cross_valid_method _refine.pdbx_stereochemistry_target_values _refine.pdbx_diffrn_id _refine.pdbx_TLS_residual_ADP_flag _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.ls_R_factor_obs _refine.ls_R_factor_all _refine.ls_R_factor_R_free_error_details _refine.ls_number_parameters _refine.ls_number_restraints _refine.occupancy_min _refine.occupancy_max _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.aniso_B[1][1] _refine.aniso_B[2][2] _refine.aniso_B[3][3] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][3] _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.details _refine.pdbx_starting_model _refine.pdbx_method_to_determine_struct _refine.pdbx_isotropic_thermal_model _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_R_Free_selection_details _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.overall_SU_ML _refine.pdbx_overall_phase_error _refine.overall_SU_B _refine.overall_SU_R_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI 'neutron diffraction' 5CCE 9655 7859 7503 81.4 2.50 31.79 0.00 117.37 31.49 29.9553 0.657036 'CNS bulk solvent model used' 0.343 0.376 0.020 356 4.5 'FREE R-VALUE' 'Joint X-ray/neutron ML' 1 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'PDB entry 3NM5' 'MOLECULAR REPLACEMENT' ? ? ? ? ? ? ? ? ? ? ? ? 'x-ray diffraction' 5CCE 24544 20253 19256 82.5 1.82 31.79 0.00 117.37 31.49 37.0855 0.361679 'CNS bulk solvent model used' 0.253 0.257 0.008 997 4.9 'FREE R-VALUE' 'Joint X-ray/neutron ML' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'PDB entry 3NM5' 'MOLECULAR REPLACEMENT' ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _refine_analyze.pdbx_refine_id _refine_analyze.entry_id _refine_analyze.Luzzati_d_res_low_obs _refine_analyze.Luzzati_coordinate_error_obs _refine_analyze.Luzzati_sigma_a_obs _refine_analyze.Luzzati_coordinate_error_free _refine_analyze.Luzzati_sigma_a_free _refine_analyze.Luzzati_d_res_low_free _refine_analyze.number_disordered_residues _refine_analyze.occupancy_sum_hydrogen _refine_analyze.occupancy_sum_non_hydrogen 'neutron diffraction' 5CCE 5.00 0.40 0.34 0.48 0.46 ? ? ? ? 'x-ray diffraction' 5CCE 5.00 0.29 0.29 0.29 0.30 ? ? ? ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1755 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 70 _refine_hist.number_atoms_total 1852 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 31.79 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.pdbx_refine_id _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function x_bond_d 0.129 . 'neutron diffraction' ? ? ? x_angle_deg 4.4 . 'neutron diffraction' ? ? ? x_torsion_deg 19.7 . 'neutron diffraction' ? ? ? x_torsion_impr_deg 14.60 . 'neutron diffraction' ? ? ? x_bond_d 0.129 . 'x-ray diffraction' ? ? ? x_angle_deg 4.4 . 'x-ray diffraction' ? ? ? x_torsion_deg 19.7 . 'x-ray diffraction' ? ? ? x_torsion_impr_deg 14.60 . 'x-ray diffraction' ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs 2.50 2.61 1194 692 659 58.0 0.328 0.389 0.068 33 4.8 8 'neutron diffraction' . . 2.61 2.75 1181 777 748 65.8 0.322 0.409 0.076 29 3.7 8 'neutron diffraction' . . 2.75 2.92 1183 864 830 73.0 0.320 0.340 0.058 34 3.9 8 'neutron diffraction' . . 2.92 3.15 1211 983 933 81.2 0.311 0.378 0.053 50 5.1 8 'neutron diffraction' . . 3.15 3.47 1185 1051 1009 88.7 0.319 0.348 0.054 42 4.0 8 'neutron diffraction' . . 3.47 3.97 1218 1124 1068 92.3 0.284 0.347 0.046 56 5.0 8 'neutron diffraction' . . 3.97 5.00 1208 1148 1097 95.0 0.301 0.239 0.033 51 4.4 8 'neutron diffraction' . . 5.00 31.79 1284 1220 1159 95.0 0.463 0.507 0.065 61 5.0 8 'neutron diffraction' . . 1.82 1.91 3040 1240 1179 40.8 0.326 0.326 0.042 61 4.9 8 'x-ray diffraction' . . 1.91 2.01 3032 2176 2066 71.8 0.328 0.332 0.032 110 5.1 8 'x-ray diffraction' . . 2.01 2.13 3041 2533 2411 83.3 0.314 0.292 0.026 122 4.8 8 'x-ray diffraction' . . 2.13 2.30 3047 2668 2509 87.6 0.302 0.294 0.023 159 6.0 8 'x-ray diffraction' . . 2.30 2.53 3066 2764 2652 90.2 0.297 0.320 0.030 112 4.1 8 'x-ray diffraction' . . 2.53 2.89 3063 2862 2720 93.4 0.276 0.270 0.023 142 5.0 8 'x-ray diffraction' . . 2.89 3.64 3089 2944 2804 95.3 0.245 0.283 0.024 140 4.8 8 'x-ray diffraction' . . 3.64 31.79 3205 3066 2915 95.6 0.190 0.185 0.015 151 4.9 8 'x-ray diffraction' . . # _struct.entry_id 5CCE _struct.title 'Joint X-ray/neutron structure of wild type MTAN complexed with SRH and adenine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5CCE _struct_keywords.text 'Helicobacter pylori, binding sites, s-adenosylhomocysteine, n-glycosyl neutron, deuterium, nucleosidase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 10 ? GLY A 22 ? MET A 10 GLY A 22 1 ? 13 HELX_P HELX_P2 AA2 GLY A 53 ? GLY A 69 ? GLY A 53 GLY A 69 1 ? 17 HELX_P HELX_P3 AA3 LEU A 104 ? ASP A 108 ? LEU A 104 ASP A 108 5 ? 5 HELX_P HELX_P4 AA4 SER A 124 ? GLN A 138 ? SER A 124 GLN A 138 1 ? 15 HELX_P HELX_P5 AA5 SER A 156 ? LYS A 168 ? SER A 156 LYS A 168 1 ? 13 HELX_P HELX_P6 AA6 GLU A 175 ? GLY A 187 ? GLU A 175 GLY A 187 1 ? 13 HELX_P HELX_P7 AA7 LYS A 203 ? LEU A 230 ? LYS A 203 LEU A 230 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 26 ? LEU A 30 ? GLU A 26 LEU A 30 AA1 2 ASN A 33 ? TYR A 40 ? ASN A 33 TYR A 40 AA1 3 LYS A 43 ? TYR A 49 ? LYS A 43 TYR A 49 AA1 4 LYS A 3 ? GLY A 8 ? LYS A 3 GLY A 8 AA1 5 LYS A 72 ? SER A 81 ? LYS A 72 SER A 81 AA1 6 ALA A 171 ? GLU A 173 ? ALA A 171 GLU A 173 AA1 7 LYS A 143 ? SER A 149 ? LYS A 143 SER A 149 AA1 8 LEU A 91 ? GLN A 99 ? LEU A 91 GLN A 99 AA1 9 ILE A 121 ? GLU A 122 ? ILE A 121 GLU A 122 AA2 1 GLU A 26 ? LEU A 30 ? GLU A 26 LEU A 30 AA2 2 ASN A 33 ? TYR A 40 ? ASN A 33 TYR A 40 AA2 3 LYS A 43 ? TYR A 49 ? LYS A 43 TYR A 49 AA2 4 LYS A 3 ? GLY A 8 ? LYS A 3 GLY A 8 AA2 5 LYS A 72 ? SER A 81 ? LYS A 72 SER A 81 AA2 6 CYS A 190 ? ASP A 198 ? CYS A 190 ASP A 198 AA2 7 LEU A 91 ? GLN A 99 ? LEU A 91 GLN A 99 AA2 8 ILE A 121 ? GLU A 122 ? ILE A 121 GLU A 122 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 28 ? N ILE A 28 O PHE A 35 ? O PHE A 35 AA1 2 3 N HIS A 36 ? N HIS A 36 O VAL A 47 ? O VAL A 47 AA1 3 4 O ILE A 46 ? O ILE A 46 N ILE A 6 ? N ILE A 6 AA1 4 5 N GLY A 5 ? N GLY A 5 O LYS A 72 ? O LYS A 72 AA1 5 6 N GLY A 80 ? N GLY A 80 O VAL A 172 ? O VAL A 172 AA1 6 7 O ALA A 171 ? O ALA A 171 N ALA A 148 ? N ALA A 148 AA1 7 8 O SER A 149 ? O SER A 149 N VAL A 98 ? N VAL A 98 AA1 8 9 N LEU A 97 ? N LEU A 97 O ILE A 121 ? O ILE A 121 AA2 1 2 N ILE A 28 ? N ILE A 28 O PHE A 35 ? O PHE A 35 AA2 2 3 N HIS A 36 ? N HIS A 36 O VAL A 47 ? O VAL A 47 AA2 3 4 O ILE A 46 ? O ILE A 46 N ILE A 6 ? N ILE A 6 AA2 4 5 N GLY A 5 ? N GLY A 5 O LYS A 72 ? O LYS A 72 AA2 5 6 N PHE A 75 ? N PHE A 75 O CYS A 191 ? O CYS A 191 AA2 6 7 O ARG A 194 ? O ARG A 194 N LEU A 92 ? N LEU A 92 AA2 7 8 N LEU A 97 ? N LEU A 97 O ILE A 121 ? O ILE A 121 # _atom_sites.entry_id 5CCE _atom_sites.fract_transf_matrix[1][1] 0.012021 _atom_sites.fract_transf_matrix[1][2] 0.006940 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013880 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014786 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C D H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 MET 174 174 174 MET MET A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 CYS 183 183 183 CYS CYS A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 CYS 190 190 190 CYS CYS A . n A 1 191 CYS 191 191 191 CYS CYS A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 MET 206 206 206 MET MET A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 HIS 217 217 217 HIS HIS A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 LYS 221 221 221 LYS LYS A . n A 1 222 PHE 222 222 222 PHE PHE A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 MET 226 226 226 MET MET A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 ASP 228 228 228 ASP ASP A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 LEU 230 230 230 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 2WP 1 301 301 2WP 2WP A . C 3 ADE 1 302 302 ADE ADE A . D 4 D8U 1 303 501 D8U D8U A . E 5 DOD 1 401 1092 DOD DOD A . E 5 DOD 2 402 1064 DOD DOD A . E 5 DOD 3 403 1046 DOD DOD A . E 5 DOD 4 404 1056 DOD DOD A . E 5 DOD 5 405 1018 DOD DOD A . E 5 DOD 6 406 1067 DOD DOD A . E 5 DOD 7 407 1020 DOD DOD A . E 5 DOD 8 408 1058 DOD DOD A . E 5 DOD 9 409 1023 DOD DOD A . E 5 DOD 10 410 1041 DOD DOD A . E 5 DOD 11 411 1083 DOD DOD A . E 5 DOD 12 412 1007 DOD DOD A . E 5 DOD 13 413 1011 DOD DOD A . E 5 DOD 14 414 1071 DOD DOD A . E 5 DOD 15 415 1005 DOD DOD A . E 5 DOD 16 416 1002 DOD DOD A . E 5 DOD 17 417 1069 DOD DOD A . E 5 DOD 18 418 1001 DOD DOD A . E 5 DOD 19 419 1006 DOD DOD A . E 5 DOD 20 420 1022 DOD DOD A . E 5 DOD 21 421 1032 DOD DOD A . E 5 DOD 22 422 1015 DOD DOD A . E 5 DOD 23 423 1021 DOD DOD A . E 5 DOD 24 424 1014 DOD DOD A . E 5 DOD 25 425 1047 DOD DOD A . E 5 DOD 26 426 1091 DOD DOD A . E 5 DOD 27 427 1054 DOD DOD A . E 5 DOD 28 428 1003 DOD DOD A . E 5 DOD 29 429 1016 DOD DOD A . E 5 DOD 30 430 1008 DOD DOD A . E 5 DOD 31 431 1082 DOD DOD A . E 5 DOD 32 432 1013 DOD DOD A . E 5 DOD 33 433 1040 DOD DOD A . E 5 DOD 34 434 1070 DOD DOD A . E 5 DOD 35 435 1017 DOD DOD A . E 5 DOD 36 436 1035 DOD DOD A . E 5 DOD 37 437 1061 DOD DOD A . E 5 DOD 38 438 1030 DOD DOD A . E 5 DOD 39 439 1027 DOD DOD A . E 5 DOD 40 440 1012 DOD DOD A . E 5 DOD 41 441 1045 DOD DOD A . E 5 DOD 42 442 1004 DOD DOD A . E 5 DOD 43 443 1081 DOD DOD A . E 5 DOD 44 444 1009 DOD DOD A . E 5 DOD 45 445 1034 DOD DOD A . E 5 DOD 46 446 1087 DOD DOD A . E 5 DOD 47 447 1039 DOD DOD A . E 5 DOD 48 448 1028 DOD DOD A . E 5 DOD 49 449 1025 DOD DOD A . E 5 DOD 50 450 1024 DOD DOD A . E 5 DOD 51 451 1088 DOD DOD A . E 5 DOD 52 452 1052 DOD DOD A . E 5 DOD 53 453 1019 DOD DOD A . E 5 DOD 54 454 1051 DOD DOD A . E 5 DOD 55 455 1010 DOD DOD A . E 5 DOD 56 456 1089 DOD DOD A . E 5 DOD 57 457 1038 DOD DOD A . E 5 DOD 58 458 1090 DOD DOD A . E 5 DOD 59 459 1026 DOD DOD A . E 5 DOD 60 460 1044 DOD DOD A . E 5 DOD 61 461 1068 DOD DOD A . E 5 DOD 62 462 1063 DOD DOD A . E 5 DOD 63 463 1033 DOD DOD A . E 5 DOD 64 464 1043 DOD DOD A . E 5 DOD 65 465 1042 DOD DOD A . E 5 DOD 66 466 1036 DOD DOD A . E 5 DOD 67 467 1037 DOD DOD A . E 5 DOD 68 468 1031 DOD DOD A . E 5 DOD 69 469 1086 DOD DOD A . E 5 DOD 70 470 1085 DOD DOD A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3450 ? 1 MORE -21 ? 1 'SSA (A^2)' 17800 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-x+y,-z+2/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 45.0886666667 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id DOD _pdbx_struct_special_symmetry.auth_seq_id 470 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id DOD _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-11-16 2 'Structure model' 1 1 2016-12-21 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 2 0 2020-07-29 5 'Structure model' 2 1 2023-09-27 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Refinement description' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_audit_support 2 4 'Structure model' atom_site 3 4 'Structure model' chem_comp 4 4 'Structure model' diffrn_radiation_wavelength 5 4 'Structure model' entity 6 4 'Structure model' pdbx_entity_nonpoly 7 4 'Structure model' struct_site 8 4 'Structure model' struct_site_gen 9 5 'Structure model' chem_comp 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond 12 5 'Structure model' database_2 13 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_atom_site.auth_atom_id' 3 4 'Structure model' '_atom_site.label_atom_id' 4 4 'Structure model' '_chem_comp.name' 5 4 'Structure model' '_chem_comp.type' 6 4 'Structure model' '_entity.pdbx_description' 7 4 'Structure model' '_pdbx_entity_nonpoly.name' 8 5 'Structure model' '_chem_comp.pdbx_synonyms' 9 5 'Structure model' '_database_2.pdbx_DOI' 10 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? CNS ? ? ? . 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? O ? ? ? . 6 ? refinement ? ? ? ? ? ? ? ? ? ? ? nCNS ? ? ? 1.0.0 7 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 166 ? ? D2 A DOD 401 ? ? 1.20 2 1 OE1 A GLU 12 ? ? D1 A DOD 402 ? ? 1.39 3 1 DD1 A HIS 109 ? A O A DOD 404 ? ? 1.49 4 1 HD1 A HIS 109 ? B O A DOD 404 ? ? 1.49 5 1 O A TYR 49 ? ? D1 A DOD 405 ? ? 1.51 6 1 D2 A DOD 439 ? ? O A DOD 460 ? ? 1.51 7 1 OD1 A ASN 199 ? ? D2 A DOD 406 ? ? 1.54 8 1 O A PHE 120 ? ? D2 A DOD 408 ? ? 1.58 9 1 O A LEU 86 ? ? D1 A DOD 406 ? ? 1.60 10 1 OE1 A GLU 166 ? ? O A DOD 401 ? ? 1.95 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 D1 A DOD 428 ? ? 1_555 D2 A DOD 428 ? ? 6_555 0.36 2 1 D2 A DOD 428 ? ? 1_555 D2 A DOD 428 ? ? 6_555 1.36 3 1 D1 A DOD 410 ? ? 1_555 O A DOD 446 ? ? 6_555 1.47 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 51 ? ? 100.43 158.92 2 1 ASN A 89 ? ? 81.56 -13.10 3 1 SER A 117 ? ? -135.73 -159.87 4 1 HIS A 155 ? ? -144.67 59.32 5 1 GLU A 175 ? ? -141.28 -18.04 6 1 ASP A 201 ? ? -107.84 -165.17 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2WP C1 C N S 1 2WP O1 O N N 2 2WP C2 C N R 3 2WP O2 O N N 4 2WP C3 C N S 5 2WP O3 O N N 6 2WP C4 C N S 7 2WP O4 O N N 8 2WP C5 C N N 9 2WP N N N N 10 2WP CA C N S 11 2WP CB C N N 12 2WP CG C N N 13 2WP SD S N N 14 2WP C C N N 15 2WP O O N N 16 2WP OXT O N N 17 2WP H1 H N N 18 2WP HO1 H N N 19 2WP H2 H N N 20 2WP HO2 H N N 21 2WP H3 H N N 22 2WP HO3 H N N 23 2WP H4 H N N 24 2WP H51 H N N 25 2WP H52 H N N 26 2WP H10 H N N 27 2WP H11 H N N 28 2WP H13 H N N 29 2WP H14 H N N 30 2WP H15 H N N 31 2WP H16 H N N 32 2WP H17 H N N 33 2WP H18 H N N 34 ADE N9 N Y N 35 ADE C8 C Y N 36 ADE N7 N Y N 37 ADE C5 C Y N 38 ADE C6 C Y N 39 ADE N6 N N N 40 ADE N1 N Y N 41 ADE C2 C Y N 42 ADE N3 N Y N 43 ADE C4 C Y N 44 ADE HN9 H N N 45 ADE H8 H N N 46 ADE HN61 H N N 47 ADE HN62 H N N 48 ADE H2 H N N 49 ALA N N N N 50 ALA CA C N S 51 ALA C C N N 52 ALA O O N N 53 ALA CB C N N 54 ALA OXT O N N 55 ALA H H N N 56 ALA H2 H N N 57 ALA HA H N N 58 ALA HB1 H N N 59 ALA HB2 H N N 60 ALA HB3 H N N 61 ALA HXT H N N 62 ARG N N N N 63 ARG CA C N S 64 ARG C C N N 65 ARG O O N N 66 ARG CB C N N 67 ARG CG C N N 68 ARG CD C N N 69 ARG NE N N N 70 ARG CZ C N N 71 ARG NH1 N N N 72 ARG NH2 N N N 73 ARG OXT O N N 74 ARG H H N N 75 ARG H2 H N N 76 ARG HA H N N 77 ARG HB2 H N N 78 ARG HB3 H N N 79 ARG HG2 H N N 80 ARG HG3 H N N 81 ARG HD2 H N N 82 ARG HD3 H N N 83 ARG HE H N N 84 ARG HH11 H N N 85 ARG HH12 H N N 86 ARG HH21 H N N 87 ARG HH22 H N N 88 ARG HXT H N N 89 ASN N N N N 90 ASN CA C N S 91 ASN C C N N 92 ASN O O N N 93 ASN CB C N N 94 ASN CG C N N 95 ASN OD1 O N N 96 ASN ND2 N N N 97 ASN OXT O N N 98 ASN H H N N 99 ASN H2 H N N 100 ASN HA H N N 101 ASN HB2 H N N 102 ASN HB3 H N N 103 ASN HD21 H N N 104 ASN HD22 H N N 105 ASN HXT H N N 106 ASP N N N N 107 ASP CA C N S 108 ASP C C N N 109 ASP O O N N 110 ASP CB C N N 111 ASP CG C N N 112 ASP OD1 O N N 113 ASP OD2 O N N 114 ASP OXT O N N 115 ASP H H N N 116 ASP H2 H N N 117 ASP HA H N N 118 ASP HB2 H N N 119 ASP HB3 H N N 120 ASP HD2 H N N 121 ASP HXT H N N 122 CYS N N N N 123 CYS CA C N R 124 CYS C C N N 125 CYS O O N N 126 CYS CB C N N 127 CYS SG S N N 128 CYS OXT O N N 129 CYS H H N N 130 CYS H2 H N N 131 CYS HA H N N 132 CYS HB2 H N N 133 CYS HB3 H N N 134 CYS HG H N N 135 CYS HXT H N N 136 D8U D D N N 137 DOD O O N N 138 DOD D1 D N N 139 DOD D2 D N N 140 GLN N N N N 141 GLN CA C N S 142 GLN C C N N 143 GLN O O N N 144 GLN CB C N N 145 GLN CG C N N 146 GLN CD C N N 147 GLN OE1 O N N 148 GLN NE2 N N N 149 GLN OXT O N N 150 GLN H H N N 151 GLN H2 H N N 152 GLN HA H N N 153 GLN HB2 H N N 154 GLN HB3 H N N 155 GLN HG2 H N N 156 GLN HG3 H N N 157 GLN HE21 H N N 158 GLN HE22 H N N 159 GLN HXT H N N 160 GLU N N N N 161 GLU CA C N S 162 GLU C C N N 163 GLU O O N N 164 GLU CB C N N 165 GLU CG C N N 166 GLU CD C N N 167 GLU OE1 O N N 168 GLU OE2 O N N 169 GLU OXT O N N 170 GLU H H N N 171 GLU H2 H N N 172 GLU HA H N N 173 GLU HB2 H N N 174 GLU HB3 H N N 175 GLU HG2 H N N 176 GLU HG3 H N N 177 GLU HE2 H N N 178 GLU HXT H N N 179 GLY N N N N 180 GLY CA C N N 181 GLY C C N N 182 GLY O O N N 183 GLY OXT O N N 184 GLY H H N N 185 GLY H2 H N N 186 GLY HA2 H N N 187 GLY HA3 H N N 188 GLY HXT H N N 189 HIS N N N N 190 HIS CA C N S 191 HIS C C N N 192 HIS O O N N 193 HIS CB C N N 194 HIS CG C Y N 195 HIS ND1 N Y N 196 HIS CD2 C Y N 197 HIS CE1 C Y N 198 HIS NE2 N Y N 199 HIS OXT O N N 200 HIS H H N N 201 HIS H2 H N N 202 HIS HA H N N 203 HIS HB2 H N N 204 HIS HB3 H N N 205 HIS HD1 H N N 206 HIS HD2 H N N 207 HIS HE1 H N N 208 HIS HE2 H N N 209 HIS HXT H N N 210 ILE N N N N 211 ILE CA C N S 212 ILE C C N N 213 ILE O O N N 214 ILE CB C N S 215 ILE CG1 C N N 216 ILE CG2 C N N 217 ILE CD1 C N N 218 ILE OXT O N N 219 ILE H H N N 220 ILE H2 H N N 221 ILE HA H N N 222 ILE HB H N N 223 ILE HG12 H N N 224 ILE HG13 H N N 225 ILE HG21 H N N 226 ILE HG22 H N N 227 ILE HG23 H N N 228 ILE HD11 H N N 229 ILE HD12 H N N 230 ILE HD13 H N N 231 ILE HXT H N N 232 LEU N N N N 233 LEU CA C N S 234 LEU C C N N 235 LEU O O N N 236 LEU CB C N N 237 LEU CG C N N 238 LEU CD1 C N N 239 LEU CD2 C N N 240 LEU OXT O N N 241 LEU H H N N 242 LEU H2 H N N 243 LEU HA H N N 244 LEU HB2 H N N 245 LEU HB3 H N N 246 LEU HG H N N 247 LEU HD11 H N N 248 LEU HD12 H N N 249 LEU HD13 H N N 250 LEU HD21 H N N 251 LEU HD22 H N N 252 LEU HD23 H N N 253 LEU HXT H N N 254 LYS N N N N 255 LYS CA C N S 256 LYS C C N N 257 LYS O O N N 258 LYS CB C N N 259 LYS CG C N N 260 LYS CD C N N 261 LYS CE C N N 262 LYS NZ N N N 263 LYS OXT O N N 264 LYS H H N N 265 LYS H2 H N N 266 LYS HA H N N 267 LYS HB2 H N N 268 LYS HB3 H N N 269 LYS HG2 H N N 270 LYS HG3 H N N 271 LYS HD2 H N N 272 LYS HD3 H N N 273 LYS HE2 H N N 274 LYS HE3 H N N 275 LYS HZ1 H N N 276 LYS HZ2 H N N 277 LYS HZ3 H N N 278 LYS HXT H N N 279 MET N N N N 280 MET CA C N S 281 MET C C N N 282 MET O O N N 283 MET CB C N N 284 MET CG C N N 285 MET SD S N N 286 MET CE C N N 287 MET OXT O N N 288 MET H H N N 289 MET H2 H N N 290 MET HA H N N 291 MET HB2 H N N 292 MET HB3 H N N 293 MET HG2 H N N 294 MET HG3 H N N 295 MET HE1 H N N 296 MET HE2 H N N 297 MET HE3 H N N 298 MET HXT H N N 299 PHE N N N N 300 PHE CA C N S 301 PHE C C N N 302 PHE O O N N 303 PHE CB C N N 304 PHE CG C Y N 305 PHE CD1 C Y N 306 PHE CD2 C Y N 307 PHE CE1 C Y N 308 PHE CE2 C Y N 309 PHE CZ C Y N 310 PHE OXT O N N 311 PHE H H N N 312 PHE H2 H N N 313 PHE HA H N N 314 PHE HB2 H N N 315 PHE HB3 H N N 316 PHE HD1 H N N 317 PHE HD2 H N N 318 PHE HE1 H N N 319 PHE HE2 H N N 320 PHE HZ H N N 321 PHE HXT H N N 322 PRO N N N N 323 PRO CA C N S 324 PRO C C N N 325 PRO O O N N 326 PRO CB C N N 327 PRO CG C N N 328 PRO CD C N N 329 PRO OXT O N N 330 PRO H H N N 331 PRO HA H N N 332 PRO HB2 H N N 333 PRO HB3 H N N 334 PRO HG2 H N N 335 PRO HG3 H N N 336 PRO HD2 H N N 337 PRO HD3 H N N 338 PRO HXT H N N 339 SER N N N N 340 SER CA C N S 341 SER C C N N 342 SER O O N N 343 SER CB C N N 344 SER OG O N N 345 SER OXT O N N 346 SER H H N N 347 SER H2 H N N 348 SER HA H N N 349 SER HB2 H N N 350 SER HB3 H N N 351 SER HG H N N 352 SER HXT H N N 353 THR N N N N 354 THR CA C N S 355 THR C C N N 356 THR O O N N 357 THR CB C N R 358 THR OG1 O N N 359 THR CG2 C N N 360 THR OXT O N N 361 THR H H N N 362 THR H2 H N N 363 THR HA H N N 364 THR HB H N N 365 THR HG1 H N N 366 THR HG21 H N N 367 THR HG22 H N N 368 THR HG23 H N N 369 THR HXT H N N 370 TYR N N N N 371 TYR CA C N S 372 TYR C C N N 373 TYR O O N N 374 TYR CB C N N 375 TYR CG C Y N 376 TYR CD1 C Y N 377 TYR CD2 C Y N 378 TYR CE1 C Y N 379 TYR CE2 C Y N 380 TYR CZ C Y N 381 TYR OH O N N 382 TYR OXT O N N 383 TYR H H N N 384 TYR H2 H N N 385 TYR HA H N N 386 TYR HB2 H N N 387 TYR HB3 H N N 388 TYR HD1 H N N 389 TYR HD2 H N N 390 TYR HE1 H N N 391 TYR HE2 H N N 392 TYR HH H N N 393 TYR HXT H N N 394 VAL N N N N 395 VAL CA C N S 396 VAL C C N N 397 VAL O O N N 398 VAL CB C N N 399 VAL CG1 C N N 400 VAL CG2 C N N 401 VAL OXT O N N 402 VAL H H N N 403 VAL H2 H N N 404 VAL HA H N N 405 VAL HB H N N 406 VAL HG11 H N N 407 VAL HG12 H N N 408 VAL HG13 H N N 409 VAL HG21 H N N 410 VAL HG22 H N N 411 VAL HG23 H N N 412 VAL HXT H N N 413 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2WP O1 C1 sing N N 1 2WP O4 C1 sing N N 2 2WP O4 C4 sing N N 3 2WP C1 C2 sing N N 4 2WP N CA sing N N 5 2WP C4 C5 sing N N 6 2WP C4 C3 sing N N 7 2WP CA C sing N N 8 2WP CA CB sing N N 9 2WP C2 O2 sing N N 10 2WP C2 C3 sing N N 11 2WP C5 SD sing N N 12 2WP CG CB sing N N 13 2WP CG SD sing N N 14 2WP C3 O3 sing N N 15 2WP C O doub N N 16 2WP C OXT sing N N 17 2WP C1 H1 sing N N 18 2WP O1 HO1 sing N N 19 2WP C2 H2 sing N N 20 2WP O2 HO2 sing N N 21 2WP C3 H3 sing N N 22 2WP O3 HO3 sing N N 23 2WP C4 H4 sing N N 24 2WP C5 H51 sing N N 25 2WP C5 H52 sing N N 26 2WP N H10 sing N N 27 2WP N H11 sing N N 28 2WP CA H13 sing N N 29 2WP CB H14 sing N N 30 2WP CB H15 sing N N 31 2WP CG H16 sing N N 32 2WP CG H17 sing N N 33 2WP OXT H18 sing N N 34 ADE N9 C8 sing Y N 35 ADE N9 C4 sing Y N 36 ADE N9 HN9 sing N N 37 ADE C8 N7 doub Y N 38 ADE C8 H8 sing N N 39 ADE N7 C5 sing Y N 40 ADE C5 C6 sing Y N 41 ADE C5 C4 doub Y N 42 ADE C6 N6 sing N N 43 ADE C6 N1 doub Y N 44 ADE N6 HN61 sing N N 45 ADE N6 HN62 sing N N 46 ADE N1 C2 sing Y N 47 ADE C2 N3 doub Y N 48 ADE C2 H2 sing N N 49 ADE N3 C4 sing Y N 50 ALA N CA sing N N 51 ALA N H sing N N 52 ALA N H2 sing N N 53 ALA CA C sing N N 54 ALA CA CB sing N N 55 ALA CA HA sing N N 56 ALA C O doub N N 57 ALA C OXT sing N N 58 ALA CB HB1 sing N N 59 ALA CB HB2 sing N N 60 ALA CB HB3 sing N N 61 ALA OXT HXT sing N N 62 ARG N CA sing N N 63 ARG N H sing N N 64 ARG N H2 sing N N 65 ARG CA C sing N N 66 ARG CA CB sing N N 67 ARG CA HA sing N N 68 ARG C O doub N N 69 ARG C OXT sing N N 70 ARG CB CG sing N N 71 ARG CB HB2 sing N N 72 ARG CB HB3 sing N N 73 ARG CG CD sing N N 74 ARG CG HG2 sing N N 75 ARG CG HG3 sing N N 76 ARG CD NE sing N N 77 ARG CD HD2 sing N N 78 ARG CD HD3 sing N N 79 ARG NE CZ sing N N 80 ARG NE HE sing N N 81 ARG CZ NH1 sing N N 82 ARG CZ NH2 doub N N 83 ARG NH1 HH11 sing N N 84 ARG NH1 HH12 sing N N 85 ARG NH2 HH21 sing N N 86 ARG NH2 HH22 sing N N 87 ARG OXT HXT sing N N 88 ASN N CA sing N N 89 ASN N H sing N N 90 ASN N H2 sing N N 91 ASN CA C sing N N 92 ASN CA CB sing N N 93 ASN CA HA sing N N 94 ASN C O doub N N 95 ASN C OXT sing N N 96 ASN CB CG sing N N 97 ASN CB HB2 sing N N 98 ASN CB HB3 sing N N 99 ASN CG OD1 doub N N 100 ASN CG ND2 sing N N 101 ASN ND2 HD21 sing N N 102 ASN ND2 HD22 sing N N 103 ASN OXT HXT sing N N 104 ASP N CA sing N N 105 ASP N H sing N N 106 ASP N H2 sing N N 107 ASP CA C sing N N 108 ASP CA CB sing N N 109 ASP CA HA sing N N 110 ASP C O doub N N 111 ASP C OXT sing N N 112 ASP CB CG sing N N 113 ASP CB HB2 sing N N 114 ASP CB HB3 sing N N 115 ASP CG OD1 doub N N 116 ASP CG OD2 sing N N 117 ASP OD2 HD2 sing N N 118 ASP OXT HXT sing N N 119 CYS N CA sing N N 120 CYS N H sing N N 121 CYS N H2 sing N N 122 CYS CA C sing N N 123 CYS CA CB sing N N 124 CYS CA HA sing N N 125 CYS C O doub N N 126 CYS C OXT sing N N 127 CYS CB SG sing N N 128 CYS CB HB2 sing N N 129 CYS CB HB3 sing N N 130 CYS SG HG sing N N 131 CYS OXT HXT sing N N 132 DOD O D1 sing N N 133 DOD O D2 sing N N 134 GLN N CA sing N N 135 GLN N H sing N N 136 GLN N H2 sing N N 137 GLN CA C sing N N 138 GLN CA CB sing N N 139 GLN CA HA sing N N 140 GLN C O doub N N 141 GLN C OXT sing N N 142 GLN CB CG sing N N 143 GLN CB HB2 sing N N 144 GLN CB HB3 sing N N 145 GLN CG CD sing N N 146 GLN CG HG2 sing N N 147 GLN CG HG3 sing N N 148 GLN CD OE1 doub N N 149 GLN CD NE2 sing N N 150 GLN NE2 HE21 sing N N 151 GLN NE2 HE22 sing N N 152 GLN OXT HXT sing N N 153 GLU N CA sing N N 154 GLU N H sing N N 155 GLU N H2 sing N N 156 GLU CA C sing N N 157 GLU CA CB sing N N 158 GLU CA HA sing N N 159 GLU C O doub N N 160 GLU C OXT sing N N 161 GLU CB CG sing N N 162 GLU CB HB2 sing N N 163 GLU CB HB3 sing N N 164 GLU CG CD sing N N 165 GLU CG HG2 sing N N 166 GLU CG HG3 sing N N 167 GLU CD OE1 doub N N 168 GLU CD OE2 sing N N 169 GLU OE2 HE2 sing N N 170 GLU OXT HXT sing N N 171 GLY N CA sing N N 172 GLY N H sing N N 173 GLY N H2 sing N N 174 GLY CA C sing N N 175 GLY CA HA2 sing N N 176 GLY CA HA3 sing N N 177 GLY C O doub N N 178 GLY C OXT sing N N 179 GLY OXT HXT sing N N 180 HIS N CA sing N N 181 HIS N H sing N N 182 HIS N H2 sing N N 183 HIS CA C sing N N 184 HIS CA CB sing N N 185 HIS CA HA sing N N 186 HIS C O doub N N 187 HIS C OXT sing N N 188 HIS CB CG sing N N 189 HIS CB HB2 sing N N 190 HIS CB HB3 sing N N 191 HIS CG ND1 sing Y N 192 HIS CG CD2 doub Y N 193 HIS ND1 CE1 doub Y N 194 HIS ND1 HD1 sing N N 195 HIS CD2 NE2 sing Y N 196 HIS CD2 HD2 sing N N 197 HIS CE1 NE2 sing Y N 198 HIS CE1 HE1 sing N N 199 HIS NE2 HE2 sing N N 200 HIS OXT HXT sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TYR N CA sing N N 356 TYR N H sing N N 357 TYR N H2 sing N N 358 TYR CA C sing N N 359 TYR CA CB sing N N 360 TYR CA HA sing N N 361 TYR C O doub N N 362 TYR C OXT sing N N 363 TYR CB CG sing N N 364 TYR CB HB2 sing N N 365 TYR CB HB3 sing N N 366 TYR CG CD1 doub Y N 367 TYR CG CD2 sing Y N 368 TYR CD1 CE1 sing Y N 369 TYR CD1 HD1 sing N N 370 TYR CD2 CE2 doub Y N 371 TYR CD2 HD2 sing N N 372 TYR CE1 CZ doub Y N 373 TYR CE1 HE1 sing N N 374 TYR CE2 CZ sing Y N 375 TYR CE2 HE2 sing N N 376 TYR CZ OH sing N N 377 TYR OH HH sing N N 378 TYR OXT HXT sing N N 379 VAL N CA sing N N 380 VAL N H sing N N 381 VAL N H2 sing N N 382 VAL CA C sing N N 383 VAL CA CB sing N N 384 VAL CA HA sing N N 385 VAL C O doub N N 386 VAL C OXT sing N N 387 VAL CB CG1 sing N N 388 VAL CB CG2 sing N N 389 VAL CB HB sing N N 390 VAL CG1 HG11 sing N N 391 VAL CG1 HG12 sing N N 392 VAL CG1 HG13 sing N N 393 VAL CG2 HG21 sing N N 394 VAL CG2 HG22 sing N N 395 VAL CG2 HG23 sing N N 396 VAL OXT HXT sing N N 397 # _pdbx_audit_support.funding_organization 'National Aeronautic Space Administration (NASA, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number N-123528-01 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 S-ribosylhomocysteine 2WP 3 ADENINE ADE 4 'deuterium(1+)' D8U 5 water DOD # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3NM5 _pdbx_initial_refinement_model.details ? #