data_5CE7 # _entry.id 5CE7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5CE7 pdb_00005ce7 10.2210/pdb5ce7/pdb WWPDB D_1000211399 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-08-05 2 'Structure model' 1 1 2015-08-19 3 'Structure model' 1 2 2015-09-16 4 'Structure model' 1 3 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_entry_details 5 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5CE7 _pdbx_database_status.recvd_initial_deposition_date 2015-07-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Muehlbacher, W.' 1 'Mayer, A.' 2 'Sun, M.' 3 'Remmert, M.' 4 'Cheung, A.C.' 5 'Niesser, J.' 6 'Soeding, J.' 7 'Cramer, P.' 8 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 83 _citation.language ? _citation.page_first 1849 _citation.page_last 1858 _citation.title 'Structure of Ctk3, a subunit of the RNA polymerase II CTD kinase complex, reveals a noncanonical CTD-interacting domain fold.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.24869 _citation.pdbx_database_id_PubMed 26219431 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Muhlbacher, W.' 1 ? primary 'Mayer, A.' 2 ? primary 'Sun, M.' 3 ? primary 'Remmert, M.' 4 ? primary 'Cheung, A.C.' 5 ? primary 'Niesser, J.' 6 ? primary 'Soeding, J.' 7 ? primary 'Cramer, P.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CTD kinase subunit gamma' 15985.353 1 ? ? ? ? 2 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305 2 ? ? ? ? 3 water nat water 18.015 67 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CTDK-I gamma subunit,CTD kinase subunit 3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)DPFEGR(MSE)TFLQLLGKLNASQFSQIKPAQFAIKHLDLEEDLYSCIWEELESGSFNTRVNI(MSE)YFVDTLC E(MSE)CLKNGLTGGYLN(MSE)ISRDICKLVQNVAPIGAAGAANAPEVRKVLQSLHEKKVIDDNQYKDA(MSE)ATVEA HEQA ; _entity_poly.pdbx_seq_one_letter_code_can ;MDPFEGRMTFLQLLGKLNASQFSQIKPAQFAIKHLDLEEDLYSCIWEELESGSFNTRVNIMYFVDTLCEMCLKNGLTGGY LNMISRDICKLVQNVAPIGAAGAANAPEVRKVLQSLHEKKVIDDNQYKDAMATVEAHEQA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASP n 1 3 PRO n 1 4 PHE n 1 5 GLU n 1 6 GLY n 1 7 ARG n 1 8 MSE n 1 9 THR n 1 10 PHE n 1 11 LEU n 1 12 GLN n 1 13 LEU n 1 14 LEU n 1 15 GLY n 1 16 LYS n 1 17 LEU n 1 18 ASN n 1 19 ALA n 1 20 SER n 1 21 GLN n 1 22 PHE n 1 23 SER n 1 24 GLN n 1 25 ILE n 1 26 LYS n 1 27 PRO n 1 28 ALA n 1 29 GLN n 1 30 PHE n 1 31 ALA n 1 32 ILE n 1 33 LYS n 1 34 HIS n 1 35 LEU n 1 36 ASP n 1 37 LEU n 1 38 GLU n 1 39 GLU n 1 40 ASP n 1 41 LEU n 1 42 TYR n 1 43 SER n 1 44 CYS n 1 45 ILE n 1 46 TRP n 1 47 GLU n 1 48 GLU n 1 49 LEU n 1 50 GLU n 1 51 SER n 1 52 GLY n 1 53 SER n 1 54 PHE n 1 55 ASN n 1 56 THR n 1 57 ARG n 1 58 VAL n 1 59 ASN n 1 60 ILE n 1 61 MSE n 1 62 TYR n 1 63 PHE n 1 64 VAL n 1 65 ASP n 1 66 THR n 1 67 LEU n 1 68 CYS n 1 69 GLU n 1 70 MSE n 1 71 CYS n 1 72 LEU n 1 73 LYS n 1 74 ASN n 1 75 GLY n 1 76 LEU n 1 77 THR n 1 78 GLY n 1 79 GLY n 1 80 TYR n 1 81 LEU n 1 82 ASN n 1 83 MSE n 1 84 ILE n 1 85 SER n 1 86 ARG n 1 87 ASP n 1 88 ILE n 1 89 CYS n 1 90 LYS n 1 91 LEU n 1 92 VAL n 1 93 GLN n 1 94 ASN n 1 95 VAL n 1 96 ALA n 1 97 PRO n 1 98 ILE n 1 99 GLY n 1 100 ALA n 1 101 ALA n 1 102 GLY n 1 103 ALA n 1 104 ALA n 1 105 ASN n 1 106 ALA n 1 107 PRO n 1 108 GLU n 1 109 VAL n 1 110 ARG n 1 111 LYS n 1 112 VAL n 1 113 LEU n 1 114 GLN n 1 115 SER n 1 116 LEU n 1 117 HIS n 1 118 GLU n 1 119 LYS n 1 120 LYS n 1 121 VAL n 1 122 ILE n 1 123 ASP n 1 124 ASP n 1 125 ASN n 1 126 GLN n 1 127 TYR n 1 128 LYS n 1 129 ASP n 1 130 ALA n 1 131 MSE n 1 132 ALA n 1 133 THR n 1 134 VAL n 1 135 GLU n 1 136 ALA n 1 137 HIS n 1 138 GLU n 1 139 GLN n 1 140 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 140 _entity_src_gen.gene_src_common_name 'Fission yeast' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ctk3, SPCC4B3.08' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schizosaccharomyces pombe' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4896 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EPE non-polymer . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S' 238.305 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 MSE 8 8 8 MSE MSE A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 MSE 61 61 61 MSE MSE A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 MSE 70 70 70 MSE MSE A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 MSE 83 83 83 MSE MSE A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 MSE 131 131 131 MSE MSE A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 ALA 140 140 140 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EPE 1 201 1 EPE EPE A . C 2 EPE 1 202 1 EPE EPE A . D 3 HOH 1 301 35 HOH HOH A . D 3 HOH 2 302 63 HOH HOH A . D 3 HOH 3 303 26 HOH HOH A . D 3 HOH 4 304 52 HOH HOH A . D 3 HOH 5 305 41 HOH HOH A . D 3 HOH 6 306 12 HOH HOH A . D 3 HOH 7 307 11 HOH HOH A . D 3 HOH 8 308 10 HOH HOH A . D 3 HOH 9 309 67 HOH HOH A . D 3 HOH 10 310 21 HOH HOH A . D 3 HOH 11 311 42 HOH HOH A . D 3 HOH 12 312 49 HOH HOH A . D 3 HOH 13 313 43 HOH HOH A . D 3 HOH 14 314 62 HOH HOH A . D 3 HOH 15 315 17 HOH HOH A . D 3 HOH 16 316 29 HOH HOH A . D 3 HOH 17 317 36 HOH HOH A . D 3 HOH 18 318 14 HOH HOH A . D 3 HOH 19 319 39 HOH HOH A . D 3 HOH 20 320 1 HOH HOH A . D 3 HOH 21 321 30 HOH HOH A . D 3 HOH 22 322 37 HOH HOH A . D 3 HOH 23 323 25 HOH HOH A . D 3 HOH 24 324 54 HOH HOH A . D 3 HOH 25 325 2 HOH HOH A . D 3 HOH 26 326 15 HOH HOH A . D 3 HOH 27 327 31 HOH HOH A . D 3 HOH 28 328 33 HOH HOH A . D 3 HOH 29 329 50 HOH HOH A . D 3 HOH 30 330 24 HOH HOH A . D 3 HOH 31 331 28 HOH HOH A . D 3 HOH 32 332 7 HOH HOH A . D 3 HOH 33 333 58 HOH HOH A . D 3 HOH 34 334 66 HOH HOH A . D 3 HOH 35 335 13 HOH HOH A . D 3 HOH 36 336 4 HOH HOH A . D 3 HOH 37 337 57 HOH HOH A . D 3 HOH 38 338 56 HOH HOH A . D 3 HOH 39 339 44 HOH HOH A . D 3 HOH 40 340 46 HOH HOH A . D 3 HOH 41 341 20 HOH HOH A . D 3 HOH 42 342 16 HOH HOH A . D 3 HOH 43 343 53 HOH HOH A . D 3 HOH 44 344 47 HOH HOH A . D 3 HOH 45 345 32 HOH HOH A . D 3 HOH 46 346 3 HOH HOH A . D 3 HOH 47 347 9 HOH HOH A . D 3 HOH 48 348 38 HOH HOH A . D 3 HOH 49 349 8 HOH HOH A . D 3 HOH 50 350 65 HOH HOH A . D 3 HOH 51 351 45 HOH HOH A . D 3 HOH 52 352 19 HOH HOH A . D 3 HOH 53 353 6 HOH HOH A . D 3 HOH 54 354 18 HOH HOH A . D 3 HOH 55 355 5 HOH HOH A . D 3 HOH 56 356 64 HOH HOH A . D 3 HOH 57 357 55 HOH HOH A . D 3 HOH 58 358 51 HOH HOH A . D 3 HOH 59 359 34 HOH HOH A . D 3 HOH 60 360 60 HOH HOH A . D 3 HOH 61 361 59 HOH HOH A . D 3 HOH 62 362 22 HOH HOH A . D 3 HOH 63 363 40 HOH HOH A . D 3 HOH 64 364 23 HOH HOH A . D 3 HOH 65 365 48 HOH HOH A . D 3 HOH 66 366 27 HOH HOH A . D 3 HOH 67 367 61 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? SOLVE ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.entry_id 5CE7 _cell.length_a 51.310 _cell.length_b 51.310 _cell.length_c 119.050 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5CE7 _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5CE7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 6000, citric acid, lithium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-06-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97964 1.0 2 0.98012 1.0 3 0.97197 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list '0.97964, 0.98012 ,0.97197' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5CE7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.000 _reflns.d_resolution_low 47.1200 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20524 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs 0.082 _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.7 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.890 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.991 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.083 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 157934 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.000 2.050 ? 4.930 ? 12233 1557 ? 1556 99.900 ? ? 0.328 ? 0.456 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.488 ? 0 1 1 ? ? 2.050 2.110 ? 5.890 ? 11238 1433 ? 1433 100.000 ? ? 0.276 ? 0.377 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.403 ? 0 2 1 ? ? 2.110 2.170 ? 6.610 ? 11177 1450 ? 1449 99.900 ? ? 0.247 ? 0.334 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.358 ? 0 3 1 ? ? 2.170 2.240 ? 7.700 ? 10459 1417 ? 1417 100.000 ? ? 0.212 ? 0.274 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.295 ? 0 4 1 ? ? 2.240 2.310 ? 9.230 ? 9949 1326 ? 1325 99.900 ? ? 0.158 ? 0.230 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.247 ? 0 5 1 ? ? 2.310 2.390 ? 11.650 ? 10440 1312 ? 1312 100.000 ? ? 0.124 ? 0.186 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.199 ? 0 6 1 ? ? 2.390 2.480 ? 12.230 ? 10067 1269 ? 1269 100.000 ? ? 0.117 ? 0.169 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.181 ? 0 7 1 ? ? 2.480 2.580 ? 14.790 ? 9666 1248 ? 1248 100.000 ? ? 0.089 ? 0.136 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.146 ? 0 8 1 ? ? 2.580 2.700 ? 16.630 ? 8618 1155 ? 1155 100.000 ? ? 0.080 ? 0.114 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.123 ? 0 9 1 ? ? 2.700 2.830 ? 18.170 ? 8182 1102 ? 1101 99.900 ? ? 0.071 ? 0.105 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.113 ? 0 10 1 ? ? 2.830 2.980 ? 22.940 ? 8420 1052 ? 1052 100.000 ? ? 0.053 ? 0.081 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.087 ? 0 11 1 ? ? 2.980 3.160 ? 25.990 ? 8052 1014 ? 1014 100.000 ? ? 0.046 ? 0.071 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.076 ? 0 12 1 ? ? 3.160 3.380 ? 32.010 ? 7328 944 ? 944 100.000 ? ? 0.036 ? 0.054 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.057 ? 0 13 1 ? ? 3.380 3.650 ? 38.270 ? 6347 874 ? 874 100.000 ? ? 0.027 ? 0.041 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.044 ? 0 14 1 ? ? 3.650 4.000 ? 48.310 ? 6302 804 ? 804 100.000 ? ? 0.020 ? 0.034 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.037 ? 0 15 1 ? ? 4.000 4.470 ? 54.160 ? 5737 737 ? 737 100.000 ? ? 0.016 ? 0.028 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.030 ? 0 16 1 ? ? 4.470 5.160 ? 52.260 ? 4739 651 ? 651 100.000 ? ? 0.016 ? 0.030 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.032 ? 0 17 1 ? ? 5.160 6.330 ? 48.770 ? 4000 528 ? 528 100.000 ? ? 0.020 ? 0.033 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.036 ? 0 18 1 ? ? 6.330 8.950 ? 52.820 ? 3245 422 ? 422 100.000 ? ? 0.017 ? 0.027 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.029 ? 0 19 1 ? ? 8.950 ? ? 70.430 ? 1735 233 ? 233 100.000 ? ? 0.011 ? 0.022 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.023 ? 0 20 1 ? ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5CE7 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 20524 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.58 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 47.120 _refine.ls_d_res_high 2.000 _refine.ls_percent_reflns_obs 99.99 _refine.ls_R_factor_obs 0.1917 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1894 _refine.ls_R_factor_R_free 0.2410 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.79 _refine.ls_number_reflns_R_free 983 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.17 _refine.pdbx_overall_phase_error 20.39 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1097 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 67 _refine_hist.number_atoms_total 1194 _refine_hist.d_res_high 2.000 _refine_hist.d_res_low 47.120 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.008 ? ? 1145 'X-RAY DIFFRACTION' ? f_angle_d 1.047 ? ? 1544 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 17.952 ? ? 439 'X-RAY DIFFRACTION' ? f_chiral_restr 0.072 ? ? 168 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 197 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.0002 2.1056 2757 0.1916 100.00 0.2627 . . 154 . . . . 'X-RAY DIFFRACTION' . 2.1056 2.2376 2842 0.1851 100.00 0.2489 . . 130 . . . . 'X-RAY DIFFRACTION' . 2.2376 2.4103 2754 0.1737 100.00 0.2405 . . 145 . . . . 'X-RAY DIFFRACTION' . 2.4103 2.6528 2777 0.1712 100.00 0.2102 . . 164 . . . . 'X-RAY DIFFRACTION' . 2.6528 3.0367 2812 0.1774 100.00 0.2438 . . 140 . . . . 'X-RAY DIFFRACTION' . 3.0367 3.8256 2790 0.2012 100.00 0.2642 . . 129 . . . . 'X-RAY DIFFRACTION' . 3.8256 47.1329 2809 0.2001 100.00 0.2286 . . 121 . . . . # _struct.entry_id 5CE7 _struct.title 'Structure of a non-canonical CID of Ctk3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5CE7 _struct_keywords.text 'Lsg1, CTD kinase subunit gamma, right-handed superhelix, transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CTK3_SCHPO _struct_ref.pdbx_db_accession Q9USJ8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDPFEGRMTFLQLLGKLNASQFSQIKPAQFAIKHLDLEEDLYSCIWEELESGSFNTRVNIMYFVDTLCEMCLKNGLTGGY LNMISRDICKLVQNVAPIGAAGAANAPEVRKVLQSLHEKKVIDDNQYKDAMATVEAHEQA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5CE7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9USJ8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 140 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 140 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 650 ? 1 MORE 9 ? 1 'SSA (A^2)' 7240 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? GLY A 15 ? ASP A 2 GLY A 15 1 ? 14 HELX_P HELX_P2 AA2 SER A 20 ? SER A 23 ? SER A 20 SER A 23 5 ? 4 HELX_P HELX_P3 AA3 GLN A 24 ? HIS A 34 ? GLN A 24 HIS A 34 1 ? 11 HELX_P HELX_P4 AA4 LEU A 37 ? GLY A 52 ? LEU A 37 GLY A 52 1 ? 16 HELX_P HELX_P5 AA5 SER A 53 ? ASN A 74 ? SER A 53 ASN A 74 1 ? 22 HELX_P HELX_P6 AA6 GLY A 79 ? ASP A 87 ? GLY A 79 ASP A 87 1 ? 9 HELX_P HELX_P7 AA7 ASP A 87 ? ALA A 96 ? ASP A 87 ALA A 96 1 ? 10 HELX_P HELX_P8 AA8 GLY A 99 ? LYS A 119 ? GLY A 99 LYS A 119 1 ? 21 HELX_P HELX_P9 AA9 ASP A 123 ? ALA A 140 ? ASP A 123 ALA A 140 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ASP 2 N ? ? A MSE 1 A ASP 2 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A ARG 7 C ? ? ? 1_555 A MSE 8 N ? ? A ARG 7 A MSE 8 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A MSE 8 C ? ? ? 1_555 A THR 9 N ? ? A MSE 8 A THR 9 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? A ILE 60 C ? ? ? 1_555 A MSE 61 N ? ? A ILE 60 A MSE 61 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale5 covale both ? A MSE 61 C ? ? ? 1_555 A TYR 62 N ? ? A MSE 61 A TYR 62 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale6 covale both ? A GLU 69 C ? ? ? 1_555 A MSE 70 N ? ? A GLU 69 A MSE 70 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale7 covale both ? A MSE 70 C ? ? ? 1_555 A CYS 71 N ? ? A MSE 70 A CYS 71 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? A ASN 82 C ? ? ? 1_555 A MSE 83 N ? ? A ASN 82 A MSE 83 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale9 covale both ? A MSE 83 C ? ? ? 1_555 A ILE 84 N ? ? A MSE 83 A ILE 84 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale10 covale both ? A ALA 130 C ? ? ? 1_555 A MSE 131 N ? ? A ALA 130 A MSE 131 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale11 covale both ? A MSE 131 C ? ? ? 1_555 A ALA 132 N ? ? A MSE 131 A ALA 132 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 1 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 8 ? . . . . MSE A 8 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 61 ? . . . . MSE A 61 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 70 ? . . . . MSE A 70 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 83 ? . . . . MSE A 83 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 131 ? . . . . MSE A 131 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EPE 201 ? 5 'binding site for residue EPE A 201' AC2 Software A EPE 202 ? 9 'binding site for residue EPE A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLN A 12 ? GLN A 12 . ? 1_555 ? 2 AC1 5 LYS A 16 ? LYS A 16 . ? 1_555 ? 3 AC1 5 LEU A 35 ? LEU A 35 . ? 5_655 ? 4 AC1 5 ASP A 36 ? ASP A 36 . ? 5_655 ? 5 AC1 5 GLU A 38 ? GLU A 38 . ? 5_655 ? 6 AC2 9 ALA A 19 ? ALA A 19 . ? 1_555 ? 7 AC2 9 GLN A 21 ? GLN A 21 . ? 1_555 ? 8 AC2 9 GLU A 39 ? GLU A 39 . ? 4_565 ? 9 AC2 9 SER A 43 ? SER A 43 . ? 4_565 ? 10 AC2 9 TYR A 62 ? TYR A 62 . ? 1_555 ? 11 AC2 9 PRO A 107 ? PRO A 107 . ? 1_555 ? 12 AC2 9 GLU A 108 ? GLU A 108 . ? 1_555 ? 13 AC2 9 LYS A 111 ? LYS A 111 . ? 1_555 ? 14 AC2 9 HOH D . ? HOH A 344 . ? 4_565 ? # _pdbx_entry_details.entry_id 5CE7 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NZ A LYS 26 ? ? O A HOH 301 ? ? 2.07 2 1 O A HOH 366 ? ? O A HOH 367 ? ? 2.11 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 365 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 366 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_565 _pdbx_validate_symm_contact.dist 2.08 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET 'modified residue' 2 A MSE 8 A MSE 8 ? MET 'modified residue' 3 A MSE 61 A MSE 61 ? MET 'modified residue' 4 A MSE 70 A MSE 70 ? MET 'modified residue' 5 A MSE 83 A MSE 83 ? MET 'modified residue' 6 A MSE 131 A MSE 131 ? MET 'modified residue' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 2.000 _diffrn_reflns.pdbx_d_res_low ? _diffrn_reflns.pdbx_number_obs 20524 _diffrn_reflns.pdbx_Rmerge_I_obs 0.077 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared 0.99 _diffrn_reflns.pdbx_redundancy ? _diffrn_reflns.pdbx_rejects ? _diffrn_reflns.pdbx_percent_possible_obs 100.00 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.number 157934 _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 8.95 47.120 233 ? 0.022 ? ? ? ? 1 6.33 8.95 422 ? 0.027 ? ? ? ? 1 5.16 6.33 528 ? 0.033 ? ? ? ? 1 4.47 5.16 651 ? 0.030 ? ? ? ? 1 4.00 4.47 737 ? 0.028 ? ? ? ? 1 3.65 4.00 804 ? 0.034 ? ? ? ? 1 3.38 3.65 874 ? 0.041 ? ? ? ? 1 3.16 3.38 944 ? 0.054 ? ? ? ? 1 2.98 3.16 1014 ? 0.071 ? ? ? ? 1 2.83 2.98 1052 ? 0.081 ? ? ? ? 1 2.70 2.83 1101 ? 0.105 ? ? ? ? 1 2.58 2.70 1155 ? 0.114 ? ? ? ? 1 2.48 2.58 1248 ? 0.136 ? ? ? ? 1 2.39 2.48 1269 ? 0.169 ? ? ? ? 1 2.31 2.39 1312 ? 0.186 ? ? ? ? 1 2.24 2.31 1325 ? 0.230 ? ? ? ? 1 2.17 2.24 1417 ? 0.274 ? ? ? ? 1 2.11 2.17 1449 ? 0.334 ? ? ? ? 1 2.05 2.11 1433 ? 0.377 ? ? ? ? 1 2.00 2.05 1556 ? 0.456 ? ? ? ? # _pdbx_phasing_dm.entry_id 5CE7 _pdbx_phasing_dm.fom_acentric 0.730 _pdbx_phasing_dm.fom_centric 0.720 _pdbx_phasing_dm.fom 0.730 _pdbx_phasing_dm.reflns_acentric 4453 _pdbx_phasing_dm.reflns_centric 1410 _pdbx_phasing_dm.reflns 5863 # loop_ _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.delta_phi_final _pdbx_phasing_dm_shell.delta_phi_initial _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 7.100 47.120 ? ? 0.950 0.870 0.900 119 160 279 4.500 7.100 ? ? 0.900 0.850 0.880 533 266 799 3.600 4.500 ? ? 0.890 0.810 0.870 725 251 976 3.100 3.600 ? ? 0.820 0.760 0.800 780 215 995 2.700 3.100 ? ? 0.650 0.580 0.640 1407 332 1739 2.500 2.700 ? ? 0.520 0.470 0.510 889 186 1075 # _phasing.method MAD # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EPE N1 N N N 88 EPE C2 C N N 89 EPE C3 C N N 90 EPE N4 N N N 91 EPE C5 C N N 92 EPE C6 C N N 93 EPE C7 C N N 94 EPE C8 C N N 95 EPE O8 O N N 96 EPE C9 C N N 97 EPE C10 C N N 98 EPE S S N N 99 EPE O1S O N N 100 EPE O2S O N N 101 EPE O3S O N N 102 EPE H21 H N N 103 EPE H22 H N N 104 EPE H31 H N N 105 EPE H32 H N N 106 EPE H51 H N N 107 EPE H52 H N N 108 EPE H61 H N N 109 EPE H62 H N N 110 EPE H71 H N N 111 EPE H72 H N N 112 EPE H81 H N N 113 EPE H82 H N N 114 EPE HO8 H N N 115 EPE H91 H N N 116 EPE H92 H N N 117 EPE H101 H N N 118 EPE H102 H N N 119 EPE HOS3 H N N 120 GLN N N N N 121 GLN CA C N S 122 GLN C C N N 123 GLN O O N N 124 GLN CB C N N 125 GLN CG C N N 126 GLN CD C N N 127 GLN OE1 O N N 128 GLN NE2 N N N 129 GLN OXT O N N 130 GLN H H N N 131 GLN H2 H N N 132 GLN HA H N N 133 GLN HB2 H N N 134 GLN HB3 H N N 135 GLN HG2 H N N 136 GLN HG3 H N N 137 GLN HE21 H N N 138 GLN HE22 H N N 139 GLN HXT H N N 140 GLU N N N N 141 GLU CA C N S 142 GLU C C N N 143 GLU O O N N 144 GLU CB C N N 145 GLU CG C N N 146 GLU CD C N N 147 GLU OE1 O N N 148 GLU OE2 O N N 149 GLU OXT O N N 150 GLU H H N N 151 GLU H2 H N N 152 GLU HA H N N 153 GLU HB2 H N N 154 GLU HB3 H N N 155 GLU HG2 H N N 156 GLU HG3 H N N 157 GLU HE2 H N N 158 GLU HXT H N N 159 GLY N N N N 160 GLY CA C N N 161 GLY C C N N 162 GLY O O N N 163 GLY OXT O N N 164 GLY H H N N 165 GLY H2 H N N 166 GLY HA2 H N N 167 GLY HA3 H N N 168 GLY HXT H N N 169 HIS N N N N 170 HIS CA C N S 171 HIS C C N N 172 HIS O O N N 173 HIS CB C N N 174 HIS CG C Y N 175 HIS ND1 N Y N 176 HIS CD2 C Y N 177 HIS CE1 C Y N 178 HIS NE2 N Y N 179 HIS OXT O N N 180 HIS H H N N 181 HIS H2 H N N 182 HIS HA H N N 183 HIS HB2 H N N 184 HIS HB3 H N N 185 HIS HD1 H N N 186 HIS HD2 H N N 187 HIS HE1 H N N 188 HIS HE2 H N N 189 HIS HXT H N N 190 HOH O O N N 191 HOH H1 H N N 192 HOH H2 H N N 193 ILE N N N N 194 ILE CA C N S 195 ILE C C N N 196 ILE O O N N 197 ILE CB C N S 198 ILE CG1 C N N 199 ILE CG2 C N N 200 ILE CD1 C N N 201 ILE OXT O N N 202 ILE H H N N 203 ILE H2 H N N 204 ILE HA H N N 205 ILE HB H N N 206 ILE HG12 H N N 207 ILE HG13 H N N 208 ILE HG21 H N N 209 ILE HG22 H N N 210 ILE HG23 H N N 211 ILE HD11 H N N 212 ILE HD12 H N N 213 ILE HD13 H N N 214 ILE HXT H N N 215 LEU N N N N 216 LEU CA C N S 217 LEU C C N N 218 LEU O O N N 219 LEU CB C N N 220 LEU CG C N N 221 LEU CD1 C N N 222 LEU CD2 C N N 223 LEU OXT O N N 224 LEU H H N N 225 LEU H2 H N N 226 LEU HA H N N 227 LEU HB2 H N N 228 LEU HB3 H N N 229 LEU HG H N N 230 LEU HD11 H N N 231 LEU HD12 H N N 232 LEU HD13 H N N 233 LEU HD21 H N N 234 LEU HD22 H N N 235 LEU HD23 H N N 236 LEU HXT H N N 237 LYS N N N N 238 LYS CA C N S 239 LYS C C N N 240 LYS O O N N 241 LYS CB C N N 242 LYS CG C N N 243 LYS CD C N N 244 LYS CE C N N 245 LYS NZ N N N 246 LYS OXT O N N 247 LYS H H N N 248 LYS H2 H N N 249 LYS HA H N N 250 LYS HB2 H N N 251 LYS HB3 H N N 252 LYS HG2 H N N 253 LYS HG3 H N N 254 LYS HD2 H N N 255 LYS HD3 H N N 256 LYS HE2 H N N 257 LYS HE3 H N N 258 LYS HZ1 H N N 259 LYS HZ2 H N N 260 LYS HZ3 H N N 261 LYS HXT H N N 262 MSE N N N N 263 MSE CA C N S 264 MSE C C N N 265 MSE O O N N 266 MSE OXT O N N 267 MSE CB C N N 268 MSE CG C N N 269 MSE SE SE N N 270 MSE CE C N N 271 MSE H H N N 272 MSE H2 H N N 273 MSE HA H N N 274 MSE HXT H N N 275 MSE HB2 H N N 276 MSE HB3 H N N 277 MSE HG2 H N N 278 MSE HG3 H N N 279 MSE HE1 H N N 280 MSE HE2 H N N 281 MSE HE3 H N N 282 PHE N N N N 283 PHE CA C N S 284 PHE C C N N 285 PHE O O N N 286 PHE CB C N N 287 PHE CG C Y N 288 PHE CD1 C Y N 289 PHE CD2 C Y N 290 PHE CE1 C Y N 291 PHE CE2 C Y N 292 PHE CZ C Y N 293 PHE OXT O N N 294 PHE H H N N 295 PHE H2 H N N 296 PHE HA H N N 297 PHE HB2 H N N 298 PHE HB3 H N N 299 PHE HD1 H N N 300 PHE HD2 H N N 301 PHE HE1 H N N 302 PHE HE2 H N N 303 PHE HZ H N N 304 PHE HXT H N N 305 PRO N N N N 306 PRO CA C N S 307 PRO C C N N 308 PRO O O N N 309 PRO CB C N N 310 PRO CG C N N 311 PRO CD C N N 312 PRO OXT O N N 313 PRO H H N N 314 PRO HA H N N 315 PRO HB2 H N N 316 PRO HB3 H N N 317 PRO HG2 H N N 318 PRO HG3 H N N 319 PRO HD2 H N N 320 PRO HD3 H N N 321 PRO HXT H N N 322 SER N N N N 323 SER CA C N S 324 SER C C N N 325 SER O O N N 326 SER CB C N N 327 SER OG O N N 328 SER OXT O N N 329 SER H H N N 330 SER H2 H N N 331 SER HA H N N 332 SER HB2 H N N 333 SER HB3 H N N 334 SER HG H N N 335 SER HXT H N N 336 THR N N N N 337 THR CA C N S 338 THR C C N N 339 THR O O N N 340 THR CB C N R 341 THR OG1 O N N 342 THR CG2 C N N 343 THR OXT O N N 344 THR H H N N 345 THR H2 H N N 346 THR HA H N N 347 THR HB H N N 348 THR HG1 H N N 349 THR HG21 H N N 350 THR HG22 H N N 351 THR HG23 H N N 352 THR HXT H N N 353 TRP N N N N 354 TRP CA C N S 355 TRP C C N N 356 TRP O O N N 357 TRP CB C N N 358 TRP CG C Y N 359 TRP CD1 C Y N 360 TRP CD2 C Y N 361 TRP NE1 N Y N 362 TRP CE2 C Y N 363 TRP CE3 C Y N 364 TRP CZ2 C Y N 365 TRP CZ3 C Y N 366 TRP CH2 C Y N 367 TRP OXT O N N 368 TRP H H N N 369 TRP H2 H N N 370 TRP HA H N N 371 TRP HB2 H N N 372 TRP HB3 H N N 373 TRP HD1 H N N 374 TRP HE1 H N N 375 TRP HE3 H N N 376 TRP HZ2 H N N 377 TRP HZ3 H N N 378 TRP HH2 H N N 379 TRP HXT H N N 380 TYR N N N N 381 TYR CA C N S 382 TYR C C N N 383 TYR O O N N 384 TYR CB C N N 385 TYR CG C Y N 386 TYR CD1 C Y N 387 TYR CD2 C Y N 388 TYR CE1 C Y N 389 TYR CE2 C Y N 390 TYR CZ C Y N 391 TYR OH O N N 392 TYR OXT O N N 393 TYR H H N N 394 TYR H2 H N N 395 TYR HA H N N 396 TYR HB2 H N N 397 TYR HB3 H N N 398 TYR HD1 H N N 399 TYR HD2 H N N 400 TYR HE1 H N N 401 TYR HE2 H N N 402 TYR HH H N N 403 TYR HXT H N N 404 VAL N N N N 405 VAL CA C N S 406 VAL C C N N 407 VAL O O N N 408 VAL CB C N N 409 VAL CG1 C N N 410 VAL CG2 C N N 411 VAL OXT O N N 412 VAL H H N N 413 VAL H2 H N N 414 VAL HA H N N 415 VAL HB H N N 416 VAL HG11 H N N 417 VAL HG12 H N N 418 VAL HG13 H N N 419 VAL HG21 H N N 420 VAL HG22 H N N 421 VAL HG23 H N N 422 VAL HXT H N N 423 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EPE N1 C2 sing N N 83 EPE N1 C6 sing N N 84 EPE N1 C9 sing N N 85 EPE C2 C3 sing N N 86 EPE C2 H21 sing N N 87 EPE C2 H22 sing N N 88 EPE C3 N4 sing N N 89 EPE C3 H31 sing N N 90 EPE C3 H32 sing N N 91 EPE N4 C5 sing N N 92 EPE N4 C7 sing N N 93 EPE C5 C6 sing N N 94 EPE C5 H51 sing N N 95 EPE C5 H52 sing N N 96 EPE C6 H61 sing N N 97 EPE C6 H62 sing N N 98 EPE C7 C8 sing N N 99 EPE C7 H71 sing N N 100 EPE C7 H72 sing N N 101 EPE C8 O8 sing N N 102 EPE C8 H81 sing N N 103 EPE C8 H82 sing N N 104 EPE O8 HO8 sing N N 105 EPE C9 C10 sing N N 106 EPE C9 H91 sing N N 107 EPE C9 H92 sing N N 108 EPE C10 S sing N N 109 EPE C10 H101 sing N N 110 EPE C10 H102 sing N N 111 EPE S O1S doub N N 112 EPE S O2S doub N N 113 EPE S O3S sing N N 114 EPE O3S HOS3 sing N N 115 GLN N CA sing N N 116 GLN N H sing N N 117 GLN N H2 sing N N 118 GLN CA C sing N N 119 GLN CA CB sing N N 120 GLN CA HA sing N N 121 GLN C O doub N N 122 GLN C OXT sing N N 123 GLN CB CG sing N N 124 GLN CB HB2 sing N N 125 GLN CB HB3 sing N N 126 GLN CG CD sing N N 127 GLN CG HG2 sing N N 128 GLN CG HG3 sing N N 129 GLN CD OE1 doub N N 130 GLN CD NE2 sing N N 131 GLN NE2 HE21 sing N N 132 GLN NE2 HE22 sing N N 133 GLN OXT HXT sing N N 134 GLU N CA sing N N 135 GLU N H sing N N 136 GLU N H2 sing N N 137 GLU CA C sing N N 138 GLU CA CB sing N N 139 GLU CA HA sing N N 140 GLU C O doub N N 141 GLU C OXT sing N N 142 GLU CB CG sing N N 143 GLU CB HB2 sing N N 144 GLU CB HB3 sing N N 145 GLU CG CD sing N N 146 GLU CG HG2 sing N N 147 GLU CG HG3 sing N N 148 GLU CD OE1 doub N N 149 GLU CD OE2 sing N N 150 GLU OE2 HE2 sing N N 151 GLU OXT HXT sing N N 152 GLY N CA sing N N 153 GLY N H sing N N 154 GLY N H2 sing N N 155 GLY CA C sing N N 156 GLY CA HA2 sing N N 157 GLY CA HA3 sing N N 158 GLY C O doub N N 159 GLY C OXT sing N N 160 GLY OXT HXT sing N N 161 HIS N CA sing N N 162 HIS N H sing N N 163 HIS N H2 sing N N 164 HIS CA C sing N N 165 HIS CA CB sing N N 166 HIS CA HA sing N N 167 HIS C O doub N N 168 HIS C OXT sing N N 169 HIS CB CG sing N N 170 HIS CB HB2 sing N N 171 HIS CB HB3 sing N N 172 HIS CG ND1 sing Y N 173 HIS CG CD2 doub Y N 174 HIS ND1 CE1 doub Y N 175 HIS ND1 HD1 sing N N 176 HIS CD2 NE2 sing Y N 177 HIS CD2 HD2 sing N N 178 HIS CE1 NE2 sing Y N 179 HIS CE1 HE1 sing N N 180 HIS NE2 HE2 sing N N 181 HIS OXT HXT sing N N 182 HOH O H1 sing N N 183 HOH O H2 sing N N 184 ILE N CA sing N N 185 ILE N H sing N N 186 ILE N H2 sing N N 187 ILE CA C sing N N 188 ILE CA CB sing N N 189 ILE CA HA sing N N 190 ILE C O doub N N 191 ILE C OXT sing N N 192 ILE CB CG1 sing N N 193 ILE CB CG2 sing N N 194 ILE CB HB sing N N 195 ILE CG1 CD1 sing N N 196 ILE CG1 HG12 sing N N 197 ILE CG1 HG13 sing N N 198 ILE CG2 HG21 sing N N 199 ILE CG2 HG22 sing N N 200 ILE CG2 HG23 sing N N 201 ILE CD1 HD11 sing N N 202 ILE CD1 HD12 sing N N 203 ILE CD1 HD13 sing N N 204 ILE OXT HXT sing N N 205 LEU N CA sing N N 206 LEU N H sing N N 207 LEU N H2 sing N N 208 LEU CA C sing N N 209 LEU CA CB sing N N 210 LEU CA HA sing N N 211 LEU C O doub N N 212 LEU C OXT sing N N 213 LEU CB CG sing N N 214 LEU CB HB2 sing N N 215 LEU CB HB3 sing N N 216 LEU CG CD1 sing N N 217 LEU CG CD2 sing N N 218 LEU CG HG sing N N 219 LEU CD1 HD11 sing N N 220 LEU CD1 HD12 sing N N 221 LEU CD1 HD13 sing N N 222 LEU CD2 HD21 sing N N 223 LEU CD2 HD22 sing N N 224 LEU CD2 HD23 sing N N 225 LEU OXT HXT sing N N 226 LYS N CA sing N N 227 LYS N H sing N N 228 LYS N H2 sing N N 229 LYS CA C sing N N 230 LYS CA CB sing N N 231 LYS CA HA sing N N 232 LYS C O doub N N 233 LYS C OXT sing N N 234 LYS CB CG sing N N 235 LYS CB HB2 sing N N 236 LYS CB HB3 sing N N 237 LYS CG CD sing N N 238 LYS CG HG2 sing N N 239 LYS CG HG3 sing N N 240 LYS CD CE sing N N 241 LYS CD HD2 sing N N 242 LYS CD HD3 sing N N 243 LYS CE NZ sing N N 244 LYS CE HE2 sing N N 245 LYS CE HE3 sing N N 246 LYS NZ HZ1 sing N N 247 LYS NZ HZ2 sing N N 248 LYS NZ HZ3 sing N N 249 LYS OXT HXT sing N N 250 MSE N CA sing N N 251 MSE N H sing N N 252 MSE N H2 sing N N 253 MSE CA C sing N N 254 MSE CA CB sing N N 255 MSE CA HA sing N N 256 MSE C O doub N N 257 MSE C OXT sing N N 258 MSE OXT HXT sing N N 259 MSE CB CG sing N N 260 MSE CB HB2 sing N N 261 MSE CB HB3 sing N N 262 MSE CG SE sing N N 263 MSE CG HG2 sing N N 264 MSE CG HG3 sing N N 265 MSE SE CE sing N N 266 MSE CE HE1 sing N N 267 MSE CE HE2 sing N N 268 MSE CE HE3 sing N N 269 PHE N CA sing N N 270 PHE N H sing N N 271 PHE N H2 sing N N 272 PHE CA C sing N N 273 PHE CA CB sing N N 274 PHE CA HA sing N N 275 PHE C O doub N N 276 PHE C OXT sing N N 277 PHE CB CG sing N N 278 PHE CB HB2 sing N N 279 PHE CB HB3 sing N N 280 PHE CG CD1 doub Y N 281 PHE CG CD2 sing Y N 282 PHE CD1 CE1 sing Y N 283 PHE CD1 HD1 sing N N 284 PHE CD2 CE2 doub Y N 285 PHE CD2 HD2 sing N N 286 PHE CE1 CZ doub Y N 287 PHE CE1 HE1 sing N N 288 PHE CE2 CZ sing Y N 289 PHE CE2 HE2 sing N N 290 PHE CZ HZ sing N N 291 PHE OXT HXT sing N N 292 PRO N CA sing N N 293 PRO N CD sing N N 294 PRO N H sing N N 295 PRO CA C sing N N 296 PRO CA CB sing N N 297 PRO CA HA sing N N 298 PRO C O doub N N 299 PRO C OXT sing N N 300 PRO CB CG sing N N 301 PRO CB HB2 sing N N 302 PRO CB HB3 sing N N 303 PRO CG CD sing N N 304 PRO CG HG2 sing N N 305 PRO CG HG3 sing N N 306 PRO CD HD2 sing N N 307 PRO CD HD3 sing N N 308 PRO OXT HXT sing N N 309 SER N CA sing N N 310 SER N H sing N N 311 SER N H2 sing N N 312 SER CA C sing N N 313 SER CA CB sing N N 314 SER CA HA sing N N 315 SER C O doub N N 316 SER C OXT sing N N 317 SER CB OG sing N N 318 SER CB HB2 sing N N 319 SER CB HB3 sing N N 320 SER OG HG sing N N 321 SER OXT HXT sing N N 322 THR N CA sing N N 323 THR N H sing N N 324 THR N H2 sing N N 325 THR CA C sing N N 326 THR CA CB sing N N 327 THR CA HA sing N N 328 THR C O doub N N 329 THR C OXT sing N N 330 THR CB OG1 sing N N 331 THR CB CG2 sing N N 332 THR CB HB sing N N 333 THR OG1 HG1 sing N N 334 THR CG2 HG21 sing N N 335 THR CG2 HG22 sing N N 336 THR CG2 HG23 sing N N 337 THR OXT HXT sing N N 338 TRP N CA sing N N 339 TRP N H sing N N 340 TRP N H2 sing N N 341 TRP CA C sing N N 342 TRP CA CB sing N N 343 TRP CA HA sing N N 344 TRP C O doub N N 345 TRP C OXT sing N N 346 TRP CB CG sing N N 347 TRP CB HB2 sing N N 348 TRP CB HB3 sing N N 349 TRP CG CD1 doub Y N 350 TRP CG CD2 sing Y N 351 TRP CD1 NE1 sing Y N 352 TRP CD1 HD1 sing N N 353 TRP CD2 CE2 doub Y N 354 TRP CD2 CE3 sing Y N 355 TRP NE1 CE2 sing Y N 356 TRP NE1 HE1 sing N N 357 TRP CE2 CZ2 sing Y N 358 TRP CE3 CZ3 doub Y N 359 TRP CE3 HE3 sing N N 360 TRP CZ2 CH2 doub Y N 361 TRP CZ2 HZ2 sing N N 362 TRP CZ3 CH2 sing Y N 363 TRP CZ3 HZ3 sing N N 364 TRP CH2 HH2 sing N N 365 TRP OXT HXT sing N N 366 TYR N CA sing N N 367 TYR N H sing N N 368 TYR N H2 sing N N 369 TYR CA C sing N N 370 TYR CA CB sing N N 371 TYR CA HA sing N N 372 TYR C O doub N N 373 TYR C OXT sing N N 374 TYR CB CG sing N N 375 TYR CB HB2 sing N N 376 TYR CB HB3 sing N N 377 TYR CG CD1 doub Y N 378 TYR CG CD2 sing Y N 379 TYR CD1 CE1 sing Y N 380 TYR CD1 HD1 sing N N 381 TYR CD2 CE2 doub Y N 382 TYR CD2 HD2 sing N N 383 TYR CE1 CZ doub Y N 384 TYR CE1 HE1 sing N N 385 TYR CE2 CZ sing Y N 386 TYR CE2 HE2 sing N N 387 TYR CZ OH sing N N 388 TYR OH HH sing N N 389 TYR OXT HXT sing N N 390 VAL N CA sing N N 391 VAL N H sing N N 392 VAL N H2 sing N N 393 VAL CA C sing N N 394 VAL CA CB sing N N 395 VAL CA HA sing N N 396 VAL C O doub N N 397 VAL C OXT sing N N 398 VAL CB CG1 sing N N 399 VAL CB CG2 sing N N 400 VAL CB HB sing N N 401 VAL CG1 HG11 sing N N 402 VAL CG1 HG12 sing N N 403 VAL CG1 HG13 sing N N 404 VAL CG2 HG21 sing N N 405 VAL CG2 HG22 sing N N 406 VAL CG2 HG23 sing N N 407 VAL OXT HXT sing N N 408 # _atom_sites.entry_id 5CE7 _atom_sites.fract_transf_matrix[1][1] 0.019489 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019489 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008400 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_