data_5CMR # _entry.id 5CMR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5CMR pdb_00005cmr 10.2210/pdb5cmr/pdb WWPDB D_1000211821 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5CMQ _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5CMR _pdbx_database_status.recvd_initial_deposition_date 2015-07-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sontz, P.A.' 1 'Bailey, J.B.' 2 'Ahn, S.' 3 'Tezcan, F.A.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 137 _citation.language ? _citation.page_first 11598 _citation.page_last 11601 _citation.title 'A Metal Organic Framework with Spherical Protein Nodes: Rational Chemical Design of 3D Protein Crystals.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.5b07463 _citation.pdbx_database_id_PubMed 26305584 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sontz, P.A.' 1 ? primary 'Bailey, J.B.' 2 ? primary 'Ahn, S.' 3 ? primary 'Tezcan, F.A.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5CMR _cell.details ? _cell.formula_units_Z ? _cell.length_a 155.320 _cell.length_a_esd ? _cell.length_b 155.320 _cell.length_b_esd ? _cell.length_c 155.320 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 48 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5CMR _symmetry.cell_setting ? _symmetry.Int_Tables_number 211 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin heavy chain' 21065.240 1 1.16.3.1 'K86A, C90E, C102A, C130A, T122H' 'Ferritin-like diiron domain containing residues 6-178' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 3 ? ? ? ? 4 non-polymer syn "N,N'-dihydroxybenzene-1,4-dicarboxamide" 196.160 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ferritin H subunit,Cell proliferation-inducing gene 15 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIAKPDEDDWESGLNAMEAALHLEKNVNQSLLELHKLAHDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_seq_one_letter_code_can ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIAKPDEDDWESGLNAMEAALHLEKNVNQSLLELHKLAHDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 THR n 1 3 ALA n 1 4 SER n 1 5 THR n 1 6 SER n 1 7 GLN n 1 8 VAL n 1 9 ARG n 1 10 GLN n 1 11 ASN n 1 12 TYR n 1 13 HIS n 1 14 GLN n 1 15 ASP n 1 16 SER n 1 17 GLU n 1 18 ALA n 1 19 ALA n 1 20 ILE n 1 21 ASN n 1 22 ARG n 1 23 GLN n 1 24 ILE n 1 25 ASN n 1 26 LEU n 1 27 GLU n 1 28 LEU n 1 29 TYR n 1 30 ALA n 1 31 SER n 1 32 TYR n 1 33 VAL n 1 34 TYR n 1 35 LEU n 1 36 SER n 1 37 MET n 1 38 SER n 1 39 TYR n 1 40 TYR n 1 41 PHE n 1 42 ASP n 1 43 ARG n 1 44 ASP n 1 45 ASP n 1 46 VAL n 1 47 ALA n 1 48 LEU n 1 49 LYS n 1 50 ASN n 1 51 PHE n 1 52 ALA n 1 53 LYS n 1 54 TYR n 1 55 PHE n 1 56 LEU n 1 57 HIS n 1 58 GLN n 1 59 SER n 1 60 HIS n 1 61 GLU n 1 62 GLU n 1 63 ARG n 1 64 GLU n 1 65 HIS n 1 66 ALA n 1 67 GLU n 1 68 LYS n 1 69 LEU n 1 70 MET n 1 71 LYS n 1 72 LEU n 1 73 GLN n 1 74 ASN n 1 75 GLN n 1 76 ARG n 1 77 GLY n 1 78 GLY n 1 79 ARG n 1 80 ILE n 1 81 PHE n 1 82 LEU n 1 83 GLN n 1 84 ASP n 1 85 ILE n 1 86 ALA n 1 87 LYS n 1 88 PRO n 1 89 ASP n 1 90 GLU n 1 91 ASP n 1 92 ASP n 1 93 TRP n 1 94 GLU n 1 95 SER n 1 96 GLY n 1 97 LEU n 1 98 ASN n 1 99 ALA n 1 100 MET n 1 101 GLU n 1 102 ALA n 1 103 ALA n 1 104 LEU n 1 105 HIS n 1 106 LEU n 1 107 GLU n 1 108 LYS n 1 109 ASN n 1 110 VAL n 1 111 ASN n 1 112 GLN n 1 113 SER n 1 114 LEU n 1 115 LEU n 1 116 GLU n 1 117 LEU n 1 118 HIS n 1 119 LYS n 1 120 LEU n 1 121 ALA n 1 122 HIS n 1 123 ASP n 1 124 LYS n 1 125 ASN n 1 126 ASP n 1 127 PRO n 1 128 HIS n 1 129 LEU n 1 130 ALA n 1 131 ASP n 1 132 PHE n 1 133 ILE n 1 134 GLU n 1 135 THR n 1 136 HIS n 1 137 TYR n 1 138 LEU n 1 139 ASN n 1 140 GLU n 1 141 GLN n 1 142 VAL n 1 143 LYS n 1 144 ALA n 1 145 ILE n 1 146 LYS n 1 147 GLU n 1 148 LEU n 1 149 GLY n 1 150 ASP n 1 151 HIS n 1 152 VAL n 1 153 THR n 1 154 ASN n 1 155 LEU n 1 156 ARG n 1 157 LYS n 1 158 MET n 1 159 GLY n 1 160 ALA n 1 161 PRO n 1 162 GLU n 1 163 SER n 1 164 GLY n 1 165 LEU n 1 166 ALA n 1 167 GLU n 1 168 TYR n 1 169 LEU n 1 170 PHE n 1 171 ASP n 1 172 LYS n 1 173 HIS n 1 174 THR n 1 175 LEU n 1 176 GLY n 1 177 ASP n 1 178 SER n 1 179 ASP n 1 180 ASN n 1 181 GLU n 1 182 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 182 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRIH_HUMAN _struct_ref.pdbx_db_accession P02794 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5CMR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02794 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5CMR ALA A 86 ? UNP P02794 LYS 87 'engineered mutation' 86 1 1 5CMR GLU A 90 ? UNP P02794 CYS 91 'engineered mutation' 90 2 1 5CMR ALA A 102 ? UNP P02794 CYS 103 'engineered mutation' 102 3 1 5CMR HIS A 122 ? UNP P02794 THR 123 'engineered mutation' 122 4 1 5CMR ALA A 130 ? UNP P02794 CYS 131 'engineered mutation' 130 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BYD non-polymer . "N,N'-dihydroxybenzene-1,4-dicarboxamide" ? 'C8 H8 N2 O4' 196.160 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5CMR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.71 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '50 mM CHES, 150 mM sodium chloride, 0.3 mM zinc chloride, 1 mM H2BDH' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-04-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Rh coated flat mirror' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 94.540 _reflns.entry_id 5CMR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.792 _reflns.d_resolution_low 109.828 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 3401 _reflns.number_obs 3401 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.200 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.185 _reflns.pdbx_netI_over_av_sigmaI 4.125 _reflns.pdbx_netI_over_sigmaI 12.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.194 _reflns.pdbx_Rpim_I_all 0.056 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 38132 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.790 4.000 ? 5.00 5798 ? ? 481 ? 100.000 ? ? ? ? 0.555 ? ? ? ? ? ? ? ? 12.100 0.555 ? ? 5.000 ? 0.162 0 1 1 ? ? 4.000 4.240 ? 1.900 5096 ? ? 457 ? 100.000 ? ? ? ? 0.392 ? ? ? ? ? ? ? ? 11.200 0.392 ? ? 6.700 ? 0.119 0 2 1 ? ? 4.240 4.530 ? 2.300 4311 ? ? 421 ? 99.700 ? ? ? ? 0.327 ? ? ? ? ? ? ? ? 10.200 0.327 ? ? 7.400 ? 0.103 0 3 1 ? ? 4.530 4.890 ? 2.900 4899 ? ? 407 ? 100.000 ? ? ? ? 0.262 ? ? ? ? ? ? ? ? 12.000 0.262 ? ? 9.700 ? 0.077 0 4 1 ? ? 4.890 5.360 ? 3.300 4388 ? ? 378 ? 99.900 ? ? ? ? 0.232 ? ? ? ? ? ? ? ? 11.600 0.232 ? ? 10.400 ? 0.069 0 5 1 ? ? 5.360 5.990 ? 3.200 3501 ? ? 339 ? 99.700 ? ? ? ? 0.239 ? ? ? ? ? ? ? ? 10.300 0.239 ? ? 9.200 ? 0.075 0 6 1 ? ? 5.990 6.920 ? 4.300 3702 ? ? 306 ? 100.000 ? ? ? ? 0.175 ? ? ? ? ? ? ? ? 12.100 0.175 ? ? 12.900 ? 0.052 0 7 1 ? ? 6.920 8.470 ? 7.400 2922 ? ? 265 ? 99.500 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 11.000 0.098 ? ? 21.600 ? 0.030 0 8 1 ? ? 8.470 11.990 ? 13.800 2289 ? ? 213 ? 99.700 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 10.700 0.048 ? ? 32.500 ? 0.016 0 9 1 ? ? 11.990 54.914 ? 15.700 1226 ? ? 134 ? 96.900 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 9.100 0.032 ? ? 35.000 ? 0.011 0 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 145.880 _refine.B_iso_mean 81.9409 _refine.B_iso_min 47.020 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5CMR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.7920 _refine.ls_d_res_low 54.9140 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3400 _refine.ls_number_reflns_R_free 345 _refine.ls_number_reflns_R_work 3055 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5600 _refine.ls_percent_reflns_R_free 10.1500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2124 _refine.ls_R_factor_R_free 0.2560 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2074 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2CEI _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.9200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.7920 _refine_hist.d_res_low 54.9140 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1448 _refine_hist.pdbx_number_residues_total 173 _refine_hist.pdbx_B_iso_mean_ligand 71.17 _refine_hist.pdbx_number_atoms_protein 1421 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 1465 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.067 ? 1974 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.046 ? 204 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 263 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.312 ? 554 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.7917 4.7767 1655 . 167 1488 100.0000 . . . 0.2854 . 0.2206 . . . . . . 2 . . . 'X-RAY DIFFRACTION' 4.7767 54.9196 1745 . 178 1567 99.0000 . . . 0.2374 . 0.1994 . . . . . . 2 . . . # _struct.entry_id 5CMR _struct.title 'Crystal Structure of Linker-Mediated Zn-bound Human H-Ferritin variant 122H-delta C-star' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5CMR _struct_keywords.text 'Protein Engineering, Metal Binding, Supramolecular Assembly, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 13 ? ASP A 42 ? HIS A 13 ASP A 42 1 ? 30 HELX_P HELX_P2 AA2 LEU A 48 ? ARG A 76 ? LEU A 48 ARG A 76 1 ? 29 HELX_P HELX_P3 AA3 SER A 95 ? LYS A 124 ? SER A 95 LYS A 124 1 ? 30 HELX_P HELX_P4 AA4 ASP A 126 ? TYR A 137 ? ASP A 126 TYR A 137 1 ? 12 HELX_P HELX_P5 AA5 TYR A 137 ? MET A 158 ? TYR A 137 MET A 158 1 ? 22 HELX_P HELX_P6 AA6 SER A 163 ? THR A 174 ? SER A 163 THR A 174 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 27 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 27 A ZN 201 1_555 ? ? ? ? ? ? ? 2.023 ? ? metalc2 metalc ? ? A GLU 62 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 62 A ZN 201 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc3 metalc ? ? A GLU 62 OE1 ? ? ? 1_555 F NA . NA ? ? A GLU 62 A NA 205 1_555 ? ? ? ? ? ? ? 2.928 ? ? metalc4 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 F NA . NA ? ? A GLU 62 A NA 205 1_555 ? ? ? ? ? ? ? 2.252 ? ? metalc5 metalc ? ? A HIS 65 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 65 A ZN 201 1_555 ? ? ? ? ? ? ? 2.242 ? ? metalc6 metalc ? ? A GLU 107 OE1 ? ? ? 1_555 F NA . NA ? ? A GLU 107 A NA 205 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc7 metalc ? ? A GLU 107 OE2 ? ? ? 1_555 F NA . NA ? ? A GLU 107 A NA 205 1_555 ? ? ? ? ? ? ? 2.452 ? ? metalc8 metalc ? ? A HIS 122 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 122 A ZN 202 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc9 metalc ? ? A HIS 122 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 122 A ZN 202 5_555 ? ? ? ? ? ? ? 2.031 ? ? metalc10 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 D NA . NA ? ? A ASP 131 A NA 203 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc11 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 D NA . NA ? ? A ASP 131 A NA 203 5_555 ? ? ? ? ? ? ? 2.355 ? ? metalc12 metalc ? ? A GLU 134 OE1 ? ? ? 1_555 D NA . NA ? ? A GLU 134 A NA 203 1_555 ? ? ? ? ? ? ? 2.454 ? ? metalc13 metalc ? ? A GLU 134 OE1 ? ? ? 1_555 D NA . NA ? ? A GLU 134 A NA 203 5_555 ? ? ? ? ? ? ? 2.454 ? ? metalc14 metalc ? ? A GLU 134 OE1 ? ? ? 1_555 E NA . NA ? ? A GLU 134 A NA 204 1_555 ? ? ? ? ? ? ? 2.409 ? ? metalc15 metalc ? ? A GLU 134 OE2 ? ? ? 1_555 E NA . NA ? ? A GLU 134 A NA 204 1_555 ? ? ? ? ? ? ? 2.824 ? ? metalc16 metalc ? ? A GLU 134 OE1 ? ? ? 1_555 E NA . NA ? ? A GLU 134 A NA 204 5_555 ? ? ? ? ? ? ? 2.409 ? ? metalc17 metalc ? ? A GLU 134 OE2 ? ? ? 1_555 E NA . NA ? ? A GLU 134 A NA 204 5_555 ? ? ? ? ? ? ? 2.824 ? ? metalc18 metalc ? ? A GLN 141 OE1 ? ? ? 1_555 F NA . NA ? ? A GLN 141 A NA 205 1_555 ? ? ? ? ? ? ? 2.823 ? ? metalc19 metalc ? ? C ZN . ZN ? ? ? 1_555 G BYD . OAN ? ? A ZN 202 A BYD 206 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc20 metalc ? ? C ZN . ZN ? ? ? 1_555 G BYD . OAM ? ? A ZN 202 A BYD 206 1_555 ? ? ? ? ? ? ? 2.149 ? ? metalc21 metalc ? ? C ZN . ZN ? ? ? 1_555 G BYD . OAN ? ? A ZN 202 A BYD 206 9_555 ? ? ? ? ? ? ? 2.278 ? ? metalc22 metalc ? ? C ZN . ZN ? ? ? 1_555 G BYD . OAJ ? ? A ZN 202 A BYD 206 38_555 ? ? ? ? ? ? ? 2.287 ? ? metalc23 metalc ? ? C ZN . ZN ? ? ? 1_555 G BYD . OAM ? ? A ZN 202 A BYD 206 5_555 ? ? ? ? ? ? ? 2.149 ? ? metalc24 metalc ? ? C ZN . ZN ? ? ? 1_555 G BYD . OAH ? ? A ZN 202 A BYD 206 38_555 ? ? ? ? ? ? ? 2.163 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 160 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 160 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 161 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 161 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.00 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 5 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 9 'binding site for residue ZN A 202' AC3 Software A NA 203 ? 9 'binding site for residue NA A 203' AC4 Software A NA 204 ? 6 'binding site for residue NA A 204' AC5 Software A NA 205 ? 4 'binding site for residue NA A 205' AC6 Software A BYD 206 ? 12 'binding site for residue BYD A 206' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLU A 27 ? GLU A 27 . ? 1_555 ? 2 AC1 5 GLU A 62 ? GLU A 62 . ? 1_555 ? 3 AC1 5 HIS A 65 ? HIS A 65 . ? 1_555 ? 4 AC1 5 GLN A 141 ? GLN A 141 . ? 1_555 ? 5 AC1 5 NA F . ? NA A 205 . ? 1_555 ? 6 AC2 9 HIS A 122 ? HIS A 122 . ? 1_555 ? 7 AC2 9 HIS A 122 ? HIS A 122 . ? 9_555 ? 8 AC2 9 HIS A 122 ? HIS A 122 . ? 5_555 ? 9 AC2 9 BYD G . ? BYD A 206 . ? 5_555 ? 10 AC2 9 BYD G . ? BYD A 206 . ? 48_555 ? 11 AC2 9 BYD G . ? BYD A 206 . ? 38_555 ? 12 AC2 9 BYD G . ? BYD A 206 . ? 1_555 ? 13 AC2 9 BYD G . ? BYD A 206 . ? 9_555 ? 14 AC2 9 BYD G . ? BYD A 206 . ? 43_555 ? 15 AC3 9 ASP A 131 ? ASP A 131 . ? 5_555 ? 16 AC3 9 ASP A 131 ? ASP A 131 . ? 1_555 ? 17 AC3 9 ASP A 131 ? ASP A 131 . ? 9_555 ? 18 AC3 9 GLU A 134 ? GLU A 134 . ? 1_555 ? 19 AC3 9 GLU A 134 ? GLU A 134 . ? 5_555 ? 20 AC3 9 GLU A 134 ? GLU A 134 . ? 9_555 ? 21 AC3 9 NA E . ? NA A 204 . ? 5_555 ? 22 AC3 9 NA E . ? NA A 204 . ? 9_555 ? 23 AC3 9 NA E . ? NA A 204 . ? 1_555 ? 24 AC4 6 GLU A 134 ? GLU A 134 . ? 1_555 ? 25 AC4 6 GLU A 134 ? GLU A 134 . ? 5_555 ? 26 AC4 6 GLU A 134 ? GLU A 134 . ? 9_555 ? 27 AC4 6 NA D . ? NA A 203 . ? 9_555 ? 28 AC4 6 NA D . ? NA A 203 . ? 5_555 ? 29 AC4 6 NA D . ? NA A 203 . ? 1_555 ? 30 AC5 4 GLU A 62 ? GLU A 62 . ? 1_555 ? 31 AC5 4 GLU A 107 ? GLU A 107 . ? 1_555 ? 32 AC5 4 GLN A 141 ? GLN A 141 . ? 1_555 ? 33 AC5 4 ZN B . ? ZN A 201 . ? 1_555 ? 34 AC6 12 HIS A 122 ? HIS A 122 . ? 43_555 ? 35 AC6 12 HIS A 122 ? HIS A 122 . ? 1_555 ? 36 AC6 12 HIS A 122 ? HIS A 122 . ? 48_555 ? 37 AC6 12 HIS A 122 ? HIS A 122 . ? 9_555 ? 38 AC6 12 HIS A 122 ? HIS A 122 . ? 5_555 ? 39 AC6 12 HIS A 122 ? HIS A 122 . ? 38_555 ? 40 AC6 12 ZN C . ? ZN A 202 . ? 9_555 ? 41 AC6 12 ZN C . ? ZN A 202 . ? 5_555 ? 42 AC6 12 ZN C . ? ZN A 202 . ? 1_555 ? 43 AC6 12 ZN C . ? ZN A 202 . ? 48_555 ? 44 AC6 12 ZN C . ? ZN A 202 . ? 43_555 ? 45 AC6 12 ZN C . ? ZN A 202 . ? 38_555 ? # _atom_sites.entry_id 5CMR _atom_sites.fract_transf_matrix[1][1] 0.006438 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006438 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006438 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N NA O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 SER 178 178 ? ? ? A . n A 1 179 ASP 179 179 ? ? ? A . n A 1 180 ASN 180 180 ? ? ? A . n A 1 181 GLU 181 181 ? ? ? A . n A 1 182 SER 182 182 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 178 ZN ZN A . C 2 ZN 1 202 179 ZN ZN A . D 3 NA 1 203 180 NA NA A . E 3 NA 1 204 181 NA NA A . F 3 NA 1 205 182 NA NA A . G 4 BYD 1 206 183 BYD BYD A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A ZN 202 ? C ZN . 2 1 A NA 203 ? D NA . 3 1 A NA 204 ? E NA . 4 1 A BYD 206 ? G BYD . 5 1 A BYD 206 ? G BYD . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 27 ? A GLU 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 81.1 ? 2 OE1 ? A GLU 27 ? A GLU 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 65 ? A HIS 65 ? 1_555 106.3 ? 3 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 65 ? A HIS 65 ? 1_555 80.0 ? 4 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 NA ? F NA . ? A NA 205 ? 1_555 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 48.1 ? 5 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 NA ? F NA . ? A NA 205 ? 1_555 OE1 ? A GLU 107 ? A GLU 107 ? 1_555 153.5 ? 6 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 NA ? F NA . ? A NA 205 ? 1_555 OE1 ? A GLU 107 ? A GLU 107 ? 1_555 129.1 ? 7 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 NA ? F NA . ? A NA 205 ? 1_555 OE2 ? A GLU 107 ? A GLU 107 ? 1_555 120.9 ? 8 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 NA ? F NA . ? A NA 205 ? 1_555 OE2 ? A GLU 107 ? A GLU 107 ? 1_555 76.2 ? 9 OE1 ? A GLU 107 ? A GLU 107 ? 1_555 NA ? F NA . ? A NA 205 ? 1_555 OE2 ? A GLU 107 ? A GLU 107 ? 1_555 54.3 ? 10 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 NA ? F NA . ? A NA 205 ? 1_555 OE1 ? A GLN 141 ? A GLN 141 ? 1_555 112.2 ? 11 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 NA ? F NA . ? A NA 205 ? 1_555 OE1 ? A GLN 141 ? A GLN 141 ? 1_555 149.6 ? 12 OE1 ? A GLU 107 ? A GLU 107 ? 1_555 NA ? F NA . ? A NA 205 ? 1_555 OE1 ? A GLN 141 ? A GLN 141 ? 1_555 79.4 ? 13 OE2 ? A GLU 107 ? A GLU 107 ? 1_555 NA ? F NA . ? A NA 205 ? 1_555 OE1 ? A GLN 141 ? A GLN 141 ? 1_555 126.9 ? 14 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 0.0 ? 15 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAN ? G BYD . ? A BYD 206 ? 1_555 163.8 ? 16 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAN ? G BYD . ? A BYD 206 ? 1_555 163.8 ? 17 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAM ? G BYD . ? A BYD 206 ? 1_555 89.1 ? 18 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAM ? G BYD . ? A BYD 206 ? 1_555 89.1 ? 19 OAN ? G BYD . ? A BYD 206 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAM ? G BYD . ? A BYD 206 ? 1_555 74.8 ? 20 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAN ? G BYD . ? A BYD 206 ? 9_555 72.0 ? 21 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAN ? G BYD . ? A BYD 206 ? 9_555 72.0 ? 22 OAN ? G BYD . ? A BYD 206 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAN ? G BYD . ? A BYD 206 ? 9_555 98.6 ? 23 OAM ? G BYD . ? A BYD 206 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAN ? G BYD . ? A BYD 206 ? 9_555 51.6 ? 24 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAJ ? G BYD . ? A BYD 206 ? 38_555 72.7 ? 25 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAJ ? G BYD . ? A BYD 206 ? 38_555 72.7 ? 26 OAN ? G BYD . ? A BYD 206 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAJ ? G BYD . ? A BYD 206 ? 38_555 97.9 ? 27 OAM ? G BYD . ? A BYD 206 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAJ ? G BYD . ? A BYD 206 ? 38_555 51.4 ? 28 OAN ? G BYD . ? A BYD 206 ? 9_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAJ ? G BYD . ? A BYD 206 ? 38_555 0.6 ? 29 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAM ? G BYD . ? A BYD 206 ? 5_555 112.7 ? 30 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAM ? G BYD . ? A BYD 206 ? 5_555 112.7 ? 31 OAN ? G BYD . ? A BYD 206 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAM ? G BYD . ? A BYD 206 ? 5_555 51.6 ? 32 OAM ? G BYD . ? A BYD 206 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAM ? G BYD . ? A BYD 206 ? 5_555 24.5 ? 33 OAN ? G BYD . ? A BYD 206 ? 9_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAM ? G BYD . ? A BYD 206 ? 5_555 58.4 ? 34 OAJ ? G BYD . ? A BYD 206 ? 38_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAM ? G BYD . ? A BYD 206 ? 5_555 58.0 ? 35 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAH ? G BYD . ? A BYD 206 ? 38_555 106.6 ? 36 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAH ? G BYD . ? A BYD 206 ? 38_555 106.6 ? 37 OAN ? G BYD . ? A BYD 206 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAH ? G BYD . ? A BYD 206 ? 38_555 57.6 ? 38 OAM ? G BYD . ? A BYD 206 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAH ? G BYD . ? A BYD 206 ? 38_555 24.8 ? 39 OAN ? G BYD . ? A BYD 206 ? 9_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAH ? G BYD . ? A BYD 206 ? 38_555 74.8 ? 40 OAJ ? G BYD . ? A BYD 206 ? 38_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAH ? G BYD . ? A BYD 206 ? 38_555 74.5 ? 41 OAM ? G BYD . ? A BYD 206 ? 5_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OAH ? G BYD . ? A BYD 206 ? 38_555 23.8 ? 42 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 0.0 ? 43 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 82.5 ? 44 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 82.5 ? 45 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 82.5 ? 46 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 82.5 ? 47 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 0.0 ? 48 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 48.9 ? 49 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 0.0 ? 50 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 48.9 ? 51 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 48.9 ? 52 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 0.0 ? 53 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 48.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-09 2 'Structure model' 1 1 2015-09-23 3 'Structure model' 1 2 2015-09-30 4 'Structure model' 1 3 2017-09-20 5 'Structure model' 1 4 2019-12-04 6 'Structure model' 1 5 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Derived calculations' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' 9 6 'Structure model' 'Derived calculations' 10 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_audit_support 2 4 'Structure model' pdbx_struct_oper_list 3 5 'Structure model' pdbx_audit_support 4 5 'Structure model' pdbx_struct_special_symmetry 5 6 'Structure model' chem_comp_atom 6 6 'Structure model' chem_comp_bond 7 6 'Structure model' database_2 8 6 'Structure model' pdbx_initial_refinement_model 9 6 'Structure model' pdbx_struct_conn_angle 10 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 5 'Structure model' '_pdbx_audit_support.funding_organization' 4 6 'Structure model' '_database_2.pdbx_DOI' 5 6 'Structure model' '_database_2.pdbx_database_accession' 6 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 6 'Structure model' '_pdbx_struct_conn_angle.value' 19 6 'Structure model' '_struct_conn.pdbx_dist_value' 20 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 6 'Structure model' '_struct_conn.ptnr1_label_asym_id' 23 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 24 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 25 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 26 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 27 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 28 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 29 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 30 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 31 6 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 11 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NZ _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 124 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.13 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 44 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OG1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 THR _pdbx_validate_symm_contact.auth_seq_id_2 153 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 15_555 _pdbx_validate_symm_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 46 ? ? -120.84 -59.34 2 1 GLU A 94 ? ? 73.81 -50.96 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id ASN _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 125 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -14.19 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 1 ? A THR 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A SER 178 ? A SER 178 6 1 Y 1 A ASP 179 ? A ASP 179 7 1 Y 1 A ASN 180 ? A ASN 180 8 1 Y 1 A GLU 181 ? A GLU 181 9 1 Y 1 A SER 182 ? A SER 182 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BYD CAA C Y N 74 BYD CAB C Y N 75 BYD CAC C Y N 76 BYD CAD C Y N 77 BYD CAE C Y N 78 BYD CAF C Y N 79 BYD CAG C N N 80 BYD CAK C N N 81 BYD NAI N N N 82 BYD NAL N N N 83 BYD OAH O N N 84 BYD OAJ O N N 85 BYD OAM O N N 86 BYD OAN O N N 87 BYD HAA H N N 88 BYD HAB H N N 89 BYD HAD H N N 90 BYD HAE H N N 91 BYD HAI H N N 92 BYD HAL H N N 93 BYD HAJ H N N 94 BYD HAN H N N 95 CYS N N N N 96 CYS CA C N R 97 CYS C C N N 98 CYS O O N N 99 CYS CB C N N 100 CYS SG S N N 101 CYS OXT O N N 102 CYS H H N N 103 CYS H2 H N N 104 CYS HA H N N 105 CYS HB2 H N N 106 CYS HB3 H N N 107 CYS HG H N N 108 CYS HXT H N N 109 GLN N N N N 110 GLN CA C N S 111 GLN C C N N 112 GLN O O N N 113 GLN CB C N N 114 GLN CG C N N 115 GLN CD C N N 116 GLN OE1 O N N 117 GLN NE2 N N N 118 GLN OXT O N N 119 GLN H H N N 120 GLN H2 H N N 121 GLN HA H N N 122 GLN HB2 H N N 123 GLN HB3 H N N 124 GLN HG2 H N N 125 GLN HG3 H N N 126 GLN HE21 H N N 127 GLN HE22 H N N 128 GLN HXT H N N 129 GLU N N N N 130 GLU CA C N S 131 GLU C C N N 132 GLU O O N N 133 GLU CB C N N 134 GLU CG C N N 135 GLU CD C N N 136 GLU OE1 O N N 137 GLU OE2 O N N 138 GLU OXT O N N 139 GLU H H N N 140 GLU H2 H N N 141 GLU HA H N N 142 GLU HB2 H N N 143 GLU HB3 H N N 144 GLU HG2 H N N 145 GLU HG3 H N N 146 GLU HE2 H N N 147 GLU HXT H N N 148 GLY N N N N 149 GLY CA C N N 150 GLY C C N N 151 GLY O O N N 152 GLY OXT O N N 153 GLY H H N N 154 GLY H2 H N N 155 GLY HA2 H N N 156 GLY HA3 H N N 157 GLY HXT H N N 158 HIS N N N N 159 HIS CA C N S 160 HIS C C N N 161 HIS O O N N 162 HIS CB C N N 163 HIS CG C Y N 164 HIS ND1 N Y N 165 HIS CD2 C Y N 166 HIS CE1 C Y N 167 HIS NE2 N Y N 168 HIS OXT O N N 169 HIS H H N N 170 HIS H2 H N N 171 HIS HA H N N 172 HIS HB2 H N N 173 HIS HB3 H N N 174 HIS HD1 H N N 175 HIS HD2 H N N 176 HIS HE1 H N N 177 HIS HE2 H N N 178 HIS HXT H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 LEU N N N N 202 LEU CA C N S 203 LEU C C N N 204 LEU O O N N 205 LEU CB C N N 206 LEU CG C N N 207 LEU CD1 C N N 208 LEU CD2 C N N 209 LEU OXT O N N 210 LEU H H N N 211 LEU H2 H N N 212 LEU HA H N N 213 LEU HB2 H N N 214 LEU HB3 H N N 215 LEU HG H N N 216 LEU HD11 H N N 217 LEU HD12 H N N 218 LEU HD13 H N N 219 LEU HD21 H N N 220 LEU HD22 H N N 221 LEU HD23 H N N 222 LEU HXT H N N 223 LYS N N N N 224 LYS CA C N S 225 LYS C C N N 226 LYS O O N N 227 LYS CB C N N 228 LYS CG C N N 229 LYS CD C N N 230 LYS CE C N N 231 LYS NZ N N N 232 LYS OXT O N N 233 LYS H H N N 234 LYS H2 H N N 235 LYS HA H N N 236 LYS HB2 H N N 237 LYS HB3 H N N 238 LYS HG2 H N N 239 LYS HG3 H N N 240 LYS HD2 H N N 241 LYS HD3 H N N 242 LYS HE2 H N N 243 LYS HE3 H N N 244 LYS HZ1 H N N 245 LYS HZ2 H N N 246 LYS HZ3 H N N 247 LYS HXT H N N 248 MET N N N N 249 MET CA C N S 250 MET C C N N 251 MET O O N N 252 MET CB C N N 253 MET CG C N N 254 MET SD S N N 255 MET CE C N N 256 MET OXT O N N 257 MET H H N N 258 MET H2 H N N 259 MET HA H N N 260 MET HB2 H N N 261 MET HB3 H N N 262 MET HG2 H N N 263 MET HG3 H N N 264 MET HE1 H N N 265 MET HE2 H N N 266 MET HE3 H N N 267 MET HXT H N N 268 NA NA NA N N 269 PHE N N N N 270 PHE CA C N S 271 PHE C C N N 272 PHE O O N N 273 PHE CB C N N 274 PHE CG C Y N 275 PHE CD1 C Y N 276 PHE CD2 C Y N 277 PHE CE1 C Y N 278 PHE CE2 C Y N 279 PHE CZ C Y N 280 PHE OXT O N N 281 PHE H H N N 282 PHE H2 H N N 283 PHE HA H N N 284 PHE HB2 H N N 285 PHE HB3 H N N 286 PHE HD1 H N N 287 PHE HD2 H N N 288 PHE HE1 H N N 289 PHE HE2 H N N 290 PHE HZ H N N 291 PHE HXT H N N 292 PRO N N N N 293 PRO CA C N S 294 PRO C C N N 295 PRO O O N N 296 PRO CB C N N 297 PRO CG C N N 298 PRO CD C N N 299 PRO OXT O N N 300 PRO H H N N 301 PRO HA H N N 302 PRO HB2 H N N 303 PRO HB3 H N N 304 PRO HG2 H N N 305 PRO HG3 H N N 306 PRO HD2 H N N 307 PRO HD3 H N N 308 PRO HXT H N N 309 SER N N N N 310 SER CA C N S 311 SER C C N N 312 SER O O N N 313 SER CB C N N 314 SER OG O N N 315 SER OXT O N N 316 SER H H N N 317 SER H2 H N N 318 SER HA H N N 319 SER HB2 H N N 320 SER HB3 H N N 321 SER HG H N N 322 SER HXT H N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TRP N N N N 341 TRP CA C N S 342 TRP C C N N 343 TRP O O N N 344 TRP CB C N N 345 TRP CG C Y N 346 TRP CD1 C Y N 347 TRP CD2 C Y N 348 TRP NE1 N Y N 349 TRP CE2 C Y N 350 TRP CE3 C Y N 351 TRP CZ2 C Y N 352 TRP CZ3 C Y N 353 TRP CH2 C Y N 354 TRP OXT O N N 355 TRP H H N N 356 TRP H2 H N N 357 TRP HA H N N 358 TRP HB2 H N N 359 TRP HB3 H N N 360 TRP HD1 H N N 361 TRP HE1 H N N 362 TRP HE3 H N N 363 TRP HZ2 H N N 364 TRP HZ3 H N N 365 TRP HH2 H N N 366 TRP HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 ZN ZN ZN N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BYD OAN NAL sing N N 70 BYD NAL CAK sing N N 71 BYD OAM CAK doub N N 72 BYD CAK CAC sing N N 73 BYD CAD CAC doub Y N 74 BYD CAD CAE sing Y N 75 BYD CAC CAB sing Y N 76 BYD CAE CAF doub Y N 77 BYD CAB CAA doub Y N 78 BYD CAF CAA sing Y N 79 BYD CAF CAG sing N N 80 BYD OAH CAG doub N N 81 BYD CAG NAI sing N N 82 BYD NAI OAJ sing N N 83 BYD CAA HAA sing N N 84 BYD CAB HAB sing N N 85 BYD CAD HAD sing N N 86 BYD CAE HAE sing N N 87 BYD NAI HAI sing N N 88 BYD NAL HAL sing N N 89 BYD OAJ HAJ sing N N 90 BYD OAN HAN sing N N 91 CYS N CA sing N N 92 CYS N H sing N N 93 CYS N H2 sing N N 94 CYS CA C sing N N 95 CYS CA CB sing N N 96 CYS CA HA sing N N 97 CYS C O doub N N 98 CYS C OXT sing N N 99 CYS CB SG sing N N 100 CYS CB HB2 sing N N 101 CYS CB HB3 sing N N 102 CYS SG HG sing N N 103 CYS OXT HXT sing N N 104 GLN N CA sing N N 105 GLN N H sing N N 106 GLN N H2 sing N N 107 GLN CA C sing N N 108 GLN CA CB sing N N 109 GLN CA HA sing N N 110 GLN C O doub N N 111 GLN C OXT sing N N 112 GLN CB CG sing N N 113 GLN CB HB2 sing N N 114 GLN CB HB3 sing N N 115 GLN CG CD sing N N 116 GLN CG HG2 sing N N 117 GLN CG HG3 sing N N 118 GLN CD OE1 doub N N 119 GLN CD NE2 sing N N 120 GLN NE2 HE21 sing N N 121 GLN NE2 HE22 sing N N 122 GLN OXT HXT sing N N 123 GLU N CA sing N N 124 GLU N H sing N N 125 GLU N H2 sing N N 126 GLU CA C sing N N 127 GLU CA CB sing N N 128 GLU CA HA sing N N 129 GLU C O doub N N 130 GLU C OXT sing N N 131 GLU CB CG sing N N 132 GLU CB HB2 sing N N 133 GLU CB HB3 sing N N 134 GLU CG CD sing N N 135 GLU CG HG2 sing N N 136 GLU CG HG3 sing N N 137 GLU CD OE1 doub N N 138 GLU CD OE2 sing N N 139 GLU OE2 HE2 sing N N 140 GLU OXT HXT sing N N 141 GLY N CA sing N N 142 GLY N H sing N N 143 GLY N H2 sing N N 144 GLY CA C sing N N 145 GLY CA HA2 sing N N 146 GLY CA HA3 sing N N 147 GLY C O doub N N 148 GLY C OXT sing N N 149 GLY OXT HXT sing N N 150 HIS N CA sing N N 151 HIS N H sing N N 152 HIS N H2 sing N N 153 HIS CA C sing N N 154 HIS CA CB sing N N 155 HIS CA HA sing N N 156 HIS C O doub N N 157 HIS C OXT sing N N 158 HIS CB CG sing N N 159 HIS CB HB2 sing N N 160 HIS CB HB3 sing N N 161 HIS CG ND1 sing Y N 162 HIS CG CD2 doub Y N 163 HIS ND1 CE1 doub Y N 164 HIS ND1 HD1 sing N N 165 HIS CD2 NE2 sing Y N 166 HIS CD2 HD2 sing N N 167 HIS CE1 NE2 sing Y N 168 HIS CE1 HE1 sing N N 169 HIS NE2 HE2 sing N N 170 HIS OXT HXT sing N N 171 ILE N CA sing N N 172 ILE N H sing N N 173 ILE N H2 sing N N 174 ILE CA C sing N N 175 ILE CA CB sing N N 176 ILE CA HA sing N N 177 ILE C O doub N N 178 ILE C OXT sing N N 179 ILE CB CG1 sing N N 180 ILE CB CG2 sing N N 181 ILE CB HB sing N N 182 ILE CG1 CD1 sing N N 183 ILE CG1 HG12 sing N N 184 ILE CG1 HG13 sing N N 185 ILE CG2 HG21 sing N N 186 ILE CG2 HG22 sing N N 187 ILE CG2 HG23 sing N N 188 ILE CD1 HD11 sing N N 189 ILE CD1 HD12 sing N N 190 ILE CD1 HD13 sing N N 191 ILE OXT HXT sing N N 192 LEU N CA sing N N 193 LEU N H sing N N 194 LEU N H2 sing N N 195 LEU CA C sing N N 196 LEU CA CB sing N N 197 LEU CA HA sing N N 198 LEU C O doub N N 199 LEU C OXT sing N N 200 LEU CB CG sing N N 201 LEU CB HB2 sing N N 202 LEU CB HB3 sing N N 203 LEU CG CD1 sing N N 204 LEU CG CD2 sing N N 205 LEU CG HG sing N N 206 LEU CD1 HD11 sing N N 207 LEU CD1 HD12 sing N N 208 LEU CD1 HD13 sing N N 209 LEU CD2 HD21 sing N N 210 LEU CD2 HD22 sing N N 211 LEU CD2 HD23 sing N N 212 LEU OXT HXT sing N N 213 LYS N CA sing N N 214 LYS N H sing N N 215 LYS N H2 sing N N 216 LYS CA C sing N N 217 LYS CA CB sing N N 218 LYS CA HA sing N N 219 LYS C O doub N N 220 LYS C OXT sing N N 221 LYS CB CG sing N N 222 LYS CB HB2 sing N N 223 LYS CB HB3 sing N N 224 LYS CG CD sing N N 225 LYS CG HG2 sing N N 226 LYS CG HG3 sing N N 227 LYS CD CE sing N N 228 LYS CD HD2 sing N N 229 LYS CD HD3 sing N N 230 LYS CE NZ sing N N 231 LYS CE HE2 sing N N 232 LYS CE HE3 sing N N 233 LYS NZ HZ1 sing N N 234 LYS NZ HZ2 sing N N 235 LYS NZ HZ3 sing N N 236 LYS OXT HXT sing N N 237 MET N CA sing N N 238 MET N H sing N N 239 MET N H2 sing N N 240 MET CA C sing N N 241 MET CA CB sing N N 242 MET CA HA sing N N 243 MET C O doub N N 244 MET C OXT sing N N 245 MET CB CG sing N N 246 MET CB HB2 sing N N 247 MET CB HB3 sing N N 248 MET CG SD sing N N 249 MET CG HG2 sing N N 250 MET CG HG3 sing N N 251 MET SD CE sing N N 252 MET CE HE1 sing N N 253 MET CE HE2 sing N N 254 MET CE HE3 sing N N 255 MET OXT HXT sing N N 256 PHE N CA sing N N 257 PHE N H sing N N 258 PHE N H2 sing N N 259 PHE CA C sing N N 260 PHE CA CB sing N N 261 PHE CA HA sing N N 262 PHE C O doub N N 263 PHE C OXT sing N N 264 PHE CB CG sing N N 265 PHE CB HB2 sing N N 266 PHE CB HB3 sing N N 267 PHE CG CD1 doub Y N 268 PHE CG CD2 sing Y N 269 PHE CD1 CE1 sing Y N 270 PHE CD1 HD1 sing N N 271 PHE CD2 CE2 doub Y N 272 PHE CD2 HD2 sing N N 273 PHE CE1 CZ doub Y N 274 PHE CE1 HE1 sing N N 275 PHE CE2 CZ sing Y N 276 PHE CE2 HE2 sing N N 277 PHE CZ HZ sing N N 278 PHE OXT HXT sing N N 279 PRO N CA sing N N 280 PRO N CD sing N N 281 PRO N H sing N N 282 PRO CA C sing N N 283 PRO CA CB sing N N 284 PRO CA HA sing N N 285 PRO C O doub N N 286 PRO C OXT sing N N 287 PRO CB CG sing N N 288 PRO CB HB2 sing N N 289 PRO CB HB3 sing N N 290 PRO CG CD sing N N 291 PRO CG HG2 sing N N 292 PRO CG HG3 sing N N 293 PRO CD HD2 sing N N 294 PRO CD HD3 sing N N 295 PRO OXT HXT sing N N 296 SER N CA sing N N 297 SER N H sing N N 298 SER N H2 sing N N 299 SER CA C sing N N 300 SER CA CB sing N N 301 SER CA HA sing N N 302 SER C O doub N N 303 SER C OXT sing N N 304 SER CB OG sing N N 305 SER CB HB2 sing N N 306 SER CB HB3 sing N N 307 SER OG HG sing N N 308 SER OXT HXT sing N N 309 THR N CA sing N N 310 THR N H sing N N 311 THR N H2 sing N N 312 THR CA C sing N N 313 THR CA CB sing N N 314 THR CA HA sing N N 315 THR C O doub N N 316 THR C OXT sing N N 317 THR CB OG1 sing N N 318 THR CB CG2 sing N N 319 THR CB HB sing N N 320 THR OG1 HG1 sing N N 321 THR CG2 HG21 sing N N 322 THR CG2 HG22 sing N N 323 THR CG2 HG23 sing N N 324 THR OXT HXT sing N N 325 TRP N CA sing N N 326 TRP N H sing N N 327 TRP N H2 sing N N 328 TRP CA C sing N N 329 TRP CA CB sing N N 330 TRP CA HA sing N N 331 TRP C O doub N N 332 TRP C OXT sing N N 333 TRP CB CG sing N N 334 TRP CB HB2 sing N N 335 TRP CB HB3 sing N N 336 TRP CG CD1 doub Y N 337 TRP CG CD2 sing Y N 338 TRP CD1 NE1 sing Y N 339 TRP CD1 HD1 sing N N 340 TRP CD2 CE2 doub Y N 341 TRP CD2 CE3 sing Y N 342 TRP NE1 CE2 sing Y N 343 TRP NE1 HE1 sing N N 344 TRP CE2 CZ2 sing Y N 345 TRP CE3 CZ3 doub Y N 346 TRP CE3 HE3 sing N N 347 TRP CZ2 CH2 doub Y N 348 TRP CZ2 HZ2 sing N N 349 TRP CZ3 CH2 sing Y N 350 TRP CZ3 HZ3 sing N N 351 TRP CH2 HH2 sing N N 352 TRP OXT HXT sing N N 353 TYR N CA sing N N 354 TYR N H sing N N 355 TYR N H2 sing N N 356 TYR CA C sing N N 357 TYR CA CB sing N N 358 TYR CA HA sing N N 359 TYR C O doub N N 360 TYR C OXT sing N N 361 TYR CB CG sing N N 362 TYR CB HB2 sing N N 363 TYR CB HB3 sing N N 364 TYR CG CD1 doub Y N 365 TYR CG CD2 sing Y N 366 TYR CD1 CE1 sing Y N 367 TYR CD1 HD1 sing N N 368 TYR CD2 CE2 doub Y N 369 TYR CD2 HD2 sing N N 370 TYR CE1 CZ doub Y N 371 TYR CE1 HE1 sing N N 372 TYR CE2 CZ sing Y N 373 TYR CE2 HE2 sing N N 374 TYR CZ OH sing N N 375 TYR OH HH sing N N 376 TYR OXT HXT sing N N 377 VAL N CA sing N N 378 VAL N H sing N N 379 VAL N H2 sing N N 380 VAL CA C sing N N 381 VAL CA CB sing N N 382 VAL CA HA sing N N 383 VAL C O doub N N 384 VAL C OXT sing N N 385 VAL CB CG1 sing N N 386 VAL CB CG2 sing N N 387 VAL CB HB sing N N 388 VAL CG1 HG11 sing N N 389 VAL CG1 HG12 sing N N 390 VAL CG1 HG13 sing N N 391 VAL CG2 HG21 sing N N 392 VAL CG2 HG22 sing N N 393 VAL CG2 HG23 sing N N 394 VAL OXT HXT sing N N 395 # _pdbx_audit_support.funding_organization 'Department of Energy (DOE, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number DE-FG02-10ER46677 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'SODIUM ION' NA 4 "N,N'-dihydroxybenzene-1,4-dicarboxamide" BYD # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2CEI _pdbx_initial_refinement_model.details ? #